Metagenome / Metatranscriptome Family F039851

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F039851
Family Type	Metagenome / Metatranscriptome
Number of Sequences	163
Average Sequence Length	39 residues
Representative Sequence	MDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL
Number of Associated Samples	120
Number of Associated Scaffolds	163

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	93.33 %
% of genes near scaffold ends (potentially truncated)	66.26 %
% of genes from short scaffolds (< 2000 bps)	64.42 %
Associated GOLD sequencing projects	118
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (64.417 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.472 % of family members)
Environment Ontology (ENVO)	Unclassified (33.742 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (33.742 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 26.98% β-sheet: 0.00% Coil/Unstructured: 73.02%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 163 Family Scaffolds
PF04392	ABC_sub_bind	41.10
PF12867	DinB_2	3.07
PF04303	PrpF	1.84
PF02518	HATPase_c	1.84
PF00596	Aldolase_II	1.23
PF04226	Transgly_assoc	1.23
PF02371	Transposase_20	1.23
PF03992	ABM	1.23
PF00296	Bac_luciferase	1.23
PF09995	MPAB_Lcp_cat	1.23
PF01548	DEDD_Tnp_IS110	1.23
PF00924	MS_channel	1.23
PF00072	Response_reg	0.61
PF00497	SBP_bac_3	0.61
PF13432	TPR_16	0.61
PF00578	AhpC-TSA	0.61
PF14659	Phage_int_SAM_3	0.61
PF13501	SoxY	0.61
PF07978	NIPSNAP	0.61
PF05163	DinB	0.61
PF00589	Phage_integrase	0.61
PF01850	PIN	0.61
PF03328	HpcH_HpaI	0.61
PF13541	ChlI	0.61
PF12773	DZR	0.61
PF00753	Lactamase_B	0.61
PF07883	Cupin_2	0.61
PF13240	zinc_ribbon_2	0.61
PF01568	Molydop_binding	0.61
PF08734	GYD	0.61
PF02416	TatA_B_E	0.61
PF03988	DUF347	0.61
PF05494	MlaC	0.61

COG ID	Name	Functional Category	% Frequency in 163 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	41.10
COG3547	Transposase	Mobilome: prophages, transposons [X]	2.45
COG2828	2-Methylaconitate cis-trans-isomerase PrpF (2-methyl citrate pathway)	Energy production and conversion [C]	1.84
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	1.23
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.23
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	1.23
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	1.23
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.61
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.61
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.61
COG2318	Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.61
COG2854	Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla	Cell wall/membrane/envelope biogenesis [M]	0.61
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.61
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.61
COG4705	Uncharacterized membrane-anchored protein	Function unknown [S]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.42 %
Unclassified	root	N/A	35.58 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.42 %
Unclassified	root	N/A	35.58 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.42 %
Unclassified	root	N/A	35.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	15.95 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	11.66 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	6.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	11.66 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11.04 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4.91 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.84 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	11.66 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7.98 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4.91 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.84 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	1.84 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.82 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6.13 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	4.29 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.84 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.23 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.82 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6.13 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.29 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.84 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.23 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.61 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.82 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.29 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.84 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	1.23 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.23 %
Mycolicibacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium	0.61 %
Bradyrhizobium symbiodeficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	0.61 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.58 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.82 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.29 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.84 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.23 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.61 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.61 %
Mycolicibacterium moriokaense	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium moriokaense	0.61 %
Bradyrhizobium symbiodeficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	0.61 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090009\|LWAnN_F624WLL02G1IN9	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
2088090014\|GPIPI_17427372	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium moriokaense	2629	Open in IMG/M
2199352025\|deepsgr__Contig_170177	All Organisms → cellular organisms → Bacteria	1816	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100660223	Not Available	739	Open in IMG/M
3300000955\|JGI1027J12803_106348681	All Organisms → cellular organisms → Bacteria	1023	Open in IMG/M
3300003994\|Ga0055435_10226898	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300004633\|Ga0066395_10421464	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300005332\|Ga0066388_102236868	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300005363\|Ga0008090_15198892	All Organisms → cellular organisms → Bacteria → Proteobacteria	514	Open in IMG/M
3300005437\|Ga0070710_10936954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	627	Open in IMG/M
3300005713\|Ga0066905_100148782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1683	Open in IMG/M
3300005719\|Ga0068861_100881903	Not Available	846	Open in IMG/M
3300005764\|Ga0066903_102059217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1098	Open in IMG/M
3300005841\|Ga0068863_100134940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2358	Open in IMG/M
3300005841\|Ga0068863_100205350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1896	Open in IMG/M
3300005844\|Ga0068862_101471005	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	686	Open in IMG/M
3300006046\|Ga0066652_100281752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1468	Open in IMG/M
3300006163\|Ga0070715_10161790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1107	Open in IMG/M
3300006755\|Ga0079222_11445819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	640	Open in IMG/M
3300007076\|Ga0075435_100137533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2047	Open in IMG/M
3300009012\|Ga0066710_100139606	All Organisms → cellular organisms → Bacteria	3345	Open in IMG/M
3300009038\|Ga0099829_10060150	All Organisms → cellular organisms → Bacteria	2846	Open in IMG/M
3300009038\|Ga0099829_11182163	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300009089\|Ga0099828_10363635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1304	Open in IMG/M
3300009089\|Ga0099828_11129096	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300009162\|Ga0075423_12014433	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300010046\|Ga0126384_10432837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1119	Open in IMG/M
3300010046\|Ga0126384_11227652	Not Available	692	Open in IMG/M
3300010046\|Ga0126384_11823164	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	578	Open in IMG/M
3300010047\|Ga0126382_11131735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	696	Open in IMG/M
3300010358\|Ga0126370_11520677	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	637	Open in IMG/M
3300010358\|Ga0126370_12080901	Not Available	557	Open in IMG/M
3300010360\|Ga0126372_10532137	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1111	Open in IMG/M
3300010360\|Ga0126372_12887720	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	532	Open in IMG/M
3300010361\|Ga0126378_10060594	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	3577	Open in IMG/M
3300010366\|Ga0126379_11208371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	862	Open in IMG/M
3300010391\|Ga0136847_10150711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	3339	Open in IMG/M
3300010403\|Ga0134123_10301218	Not Available	1422	Open in IMG/M
3300011106\|Ga0151489_1469485	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300011269\|Ga0137392_10004678	All Organisms → cellular organisms → Bacteria	8533	Open in IMG/M
3300011269\|Ga0137392_11108112	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300011271\|Ga0137393_10949565	All Organisms → cellular organisms → Bacteria	733	Open in IMG/M
3300012096\|Ga0137389_10854959	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300012189\|Ga0137388_11850861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	535	Open in IMG/M
3300012199\|Ga0137383_10381427	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1033	Open in IMG/M
3300012199\|Ga0137383_10470098	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300012202\|Ga0137363_11333232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	606	Open in IMG/M
3300012205\|Ga0137362_10360524	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300012205\|Ga0137362_10367055	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1247	Open in IMG/M
3300012207\|Ga0137381_10352905	All Organisms → cellular organisms → Bacteria → Proteobacteria	1282	Open in IMG/M
3300012207\|Ga0137381_10603123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	957	Open in IMG/M
3300012207\|Ga0137381_10753168	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300012209\|Ga0137379_10834448	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	826	Open in IMG/M
3300012211\|Ga0137377_10755380	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300012354\|Ga0137366_10055613	All Organisms → cellular organisms → Bacteria	3029	Open in IMG/M
3300012359\|Ga0137385_10403667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	1165	Open in IMG/M
3300012361\|Ga0137360_10534763	Not Available	1000	Open in IMG/M
3300012362\|Ga0137361_10792820	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300012917\|Ga0137395_10287213	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300012927\|Ga0137416_10661094	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	915	Open in IMG/M
3300012929\|Ga0137404_11685419	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300012930\|Ga0137407_12291678	Not Available	516	Open in IMG/M
3300012944\|Ga0137410_11822981	Not Available	537	Open in IMG/M
3300012948\|Ga0126375_10876338	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300012948\|Ga0126375_11134147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	646	Open in IMG/M
3300012948\|Ga0126375_11796604	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300012948\|Ga0126375_12008011	Not Available	511	Open in IMG/M
3300012976\|Ga0134076_10459610	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	576	Open in IMG/M
3300014882\|Ga0180069_1043620	Not Available	997	Open in IMG/M
3300014884\|Ga0180104_1212340	Not Available	577	Open in IMG/M
3300015374\|Ga0132255_101685596	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	962	Open in IMG/M
3300015374\|Ga0132255_104803278	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	572	Open in IMG/M
3300018051\|Ga0184620_10122161	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300018052\|Ga0184638_1024481	All Organisms → cellular organisms → Bacteria	2153	Open in IMG/M
3300018078\|Ga0184612_10359100	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	738	Open in IMG/M
3300018084\|Ga0184629_10023998	All Organisms → cellular organisms → Bacteria	2565	Open in IMG/M
3300025313\|Ga0209431_10570097	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300025910\|Ga0207684_10025634	All Organisms → cellular organisms → Bacteria	5025	Open in IMG/M
3300025935\|Ga0207709_11394847	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	580	Open in IMG/M
3300026018\|Ga0208418_1032612	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	552	Open in IMG/M
3300026317\|Ga0209154_1052232	All Organisms → cellular organisms → Bacteria	1819	Open in IMG/M
3300026334\|Ga0209377_1080576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1384	Open in IMG/M
3300026469\|Ga0257169_1045617	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300026497\|Ga0257164_1042890	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300026529\|Ga0209806_1069810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1586	Open in IMG/M
3300026538\|Ga0209056_10354618	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300026555\|Ga0179593_1172387	All Organisms → cellular organisms → Bacteria	2871	Open in IMG/M
3300027862\|Ga0209701_10212758	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300027882\|Ga0209590_10189826	All Organisms → cellular organisms → Bacteria	1294	Open in IMG/M
3300028047\|Ga0209526_10264794	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1172	Open in IMG/M
3300031231\|Ga0170824_125724282	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	573	Open in IMG/M
3300031720\|Ga0307469_10794512	All Organisms → cellular organisms → Bacteria	867	Open in IMG/M
3300031720\|Ga0307469_11434517	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	659	Open in IMG/M
3300031740\|Ga0307468_100179756	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1403	Open in IMG/M
3300031740\|Ga0307468_100470028	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300031740\|Ga0307468_101359508	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300031740\|Ga0307468_101452302	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300031780\|Ga0318508_1216860	Not Available	549	Open in IMG/M
3300031820\|Ga0307473_10530089	Not Available	800	Open in IMG/M
3300031910\|Ga0306923_10103626	All Organisms → cellular organisms → Bacteria → Proteobacteria	3212	Open in IMG/M
3300031949\|Ga0214473_10788394	All Organisms → cellular organisms → Bacteria	1026	Open in IMG/M
3300032174\|Ga0307470_10297509	Not Available	1093	Open in IMG/M
3300032180\|Ga0307471_100082302	All Organisms → cellular organisms → Bacteria	2838	Open in IMG/M
3300032180\|Ga0307471_100644075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1221	Open in IMG/M
3300032180\|Ga0307471_100822397	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1096	Open in IMG/M
3300032180\|Ga0307471_100903332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1050	Open in IMG/M
3300032180\|Ga0307471_101390988	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300032180\|Ga0307471_102290045	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	681	Open in IMG/M
3300032180\|Ga0307471_102343224	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	674	Open in IMG/M
3300032180\|Ga0307471_102674136	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	633	Open in IMG/M
3300032180\|Ga0307471_104255958	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300032205\|Ga0307472_101703707	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	623	Open in IMG/M
3300032205\|Ga0307472_101734313	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	618	Open in IMG/M
3300032342\|Ga0315286_11769228	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300032401\|Ga0315275_10800165	All Organisms → cellular organisms → Bacteria	1045	Open in IMG/M
3300032516\|Ga0315273_11902410	All Organisms → cellular organisms → Bacteria → Proteobacteria	711	Open in IMG/M
3300033004\|Ga0335084_11901614	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300033500\|Ga0326730_1112486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	505	Open in IMG/M
3300033501\|Ga0326732_1044463	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300034178\|Ga0364934_0265577	Not Available	650	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.02%
Host-Associated	Host-Associated	7.98%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.37%
Aquatic	Environmental → Aquatic	11.66%
Plants	Host-Associated → Plants	7.98%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.53%
Freshwater	Environmental → Aquatic → Freshwater	6.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.29%
Sediment	Environmental → Aquatic → Sediment	3.68%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.68%
Marine	Environmental → Aquatic → Marine	1.23%
Peat	Environmental → Terrestrial → Peat	1.23%
Floodplain	Environmental → Terrestrial → Floodplain	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	67.48%
Loam	Environmental → Terrestrial → Soil → Loam	9.82%
Lake	Environmental → Aquatic → Freshwater → Lake	6.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.68%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.45%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.23%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.23%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.23%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	22.09%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	6.13%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.13%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.29%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.45%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.23%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.23%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.23%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.61%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.61%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.61%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.61%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	21.47%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	14.11%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.75%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.68%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.84%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	1.23%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.23%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.23%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.23%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.23%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.23%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.23%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.23%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.61%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.61%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.61%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.61%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.61%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090009	Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate	Environmental	Open in IMG/M
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300003994	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2	Environmental	Open in IMG/M
3300004022	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014882	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026018	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental	Open in IMG/M
3300026340	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A	Environmental	Open in IMG/M
3300026376	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B	Environmental	Open in IMG/M
3300026469	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B	Environmental	Open in IMG/M
3300026482	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B	Environmental	Open in IMG/M
3300026489	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A	Environmental	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031780	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental	Open in IMG/M
3300033501	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
LWAnN_07020730	2088090009	Freshwater Sediment	MDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGVGP
GPIPI_03244820	2088090014	Soil	MDRRTFLAGTSAVLVAAPRAAEAIEDKPARIGVLSS
deepsgr_02864190	2199352025	Soil	MDRRTFLAGTGAILFAVPLVTEAQPGGKTWQIGFLTGRRAPA
INPhiseqgaiiFebDRAFT_1006602231	3300000364	Soil	LAGTGAVLLAGPSAAEAQQPRKVYRVGWIIGKIHG*
JGI1027J12803_1063486813	3300000955	Soil	LIDRRTFLAGTGVVLLVSPLAAEAQFPEKVPRVGYLSP
JGI12053J15887_103103722	3300001661	Forest Soil	MDRRSFLGIVGTGLLAAPLAAEAQKSEKMPRVGILNIGPAPSPQE
Ga0055435_102268981	3300003994	Natural And Restored Wetlands	VIDRRTVLAGTGAVLLATPLVPEAQQARKVPRVGILGSAPTP
Ga0055432_101607772	3300004022	Natural And Restored Wetlands	VIDRRTFLAGTGVVLLAAPVAAEAQKSQKMARVGILGIGPAPSPQ
Ga0066398_101205332	3300004268	Tropical Forest Soil	VISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSPQE
Ga0066395_104214641	3300004633	Tropical Forest Soil	VDRRTFLAGTGGGLLATPLAAEAQPTARVYRVGFLSPGPAPH
Ga0066388_1022368683	3300005332	Tropical Forest Soil	VRRRRFLQVAGAGLLAAPLAAQAQPAGRVRRIGVLHITPDP
Ga0066388_1074586481	3300005332	Tropical Forest Soil	MERRTFLAGTGAVLLATPVPAEPQQLPKTYRIGVMIGSSPSAA
Ga0070687_1013859142	3300005343	Switchgrass Rhizosphere	MIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLGPTPTPQE
Ga0008090_151988921	3300005363	Tropical Rainforest Soil	MDRRTFLAGTGAVLLAAPLAAWAQPAKKPWRIGVLGLGQVTSEM
Ga0070710_109369541	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	LIDRRIFLAGTGAVLLAAPLTAEGQQPGKVYRIGWLASGS
Ga0066905_1001487821	3300005713	Tropical Forest Soil	MDRRTFLAGTGALLLATPLGAEAQQARKVHRIGFLP
Ga0068861_1008819031	3300005719	Switchgrass Rhizosphere	MIDRRAFLAGTGAVLLAAPLAAEAQKSEKKARVGILGLG
Ga0066903_1020592172	3300005764	Tropical Forest Soil	MDRRTFLAGTSAVLLAAPLAVEAQQPRRVYRIALLYAG
Ga0068863_1001349404	3300005841	Switchgrass Rhizosphere	MDRRTFLAGTGAVLLAAPLSAGAQQAGRVYKIGFL*
Ga0068863_1002053501	3300005841	Switchgrass Rhizosphere	VIDRRRFLAGRAAVLLAAPLAAEAQPVGTTYRIGFLGGA
Ga0068862_1014710051	3300005844	Switchgrass Rhizosphere	MTSVMDRRTFLAGTGAVLLAAPLAAEGQQAGKVWRI
Ga0070717_119762952	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MERRTFLRVITGGLLAAPITAEAQKSEKMARVGILGIGPAPS
Ga0066652_1002817523	3300006046	Soil	MIDRRTFLAGTGAVILAAPLAAEGQPARLYRVGVVLE
Ga0070715_101617901	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	VIDRRTFLAGTGAVLLAAPLAAQAQQPGKVSRLGYLGVNRPEE
Ga0079222_114458192	3300006755	Agricultural Soil	MDRRTFLAGTGAVLLAAPLAAEGQQAAKVPRIGYLGLNRA
Ga0075425_1015491741	3300006854	Populus Rhizosphere	MISRRAFIGFVAGGLLVAPLAAEAQKSQKMARVGILGI
Ga0075424_1015272201	3300006904	Populus Rhizosphere	MDRRALLAGATALLAAPLAAEGQPAGKVWRIGFLHP
Ga0075435_1001375335	3300007076	Populus Rhizosphere	MISRRIFLAGTGAVLLAAPLAAEAQQARKVHRIGFLVYGPG
Ga0075435_1005335304	3300007076	Populus Rhizosphere	MNRRTFLCGLTLGAMAAPLAAVAQKSEKMARVGILGIG
Ga0066710_1001396061	3300009012	Grasslands Soil	LLDRRTFLAGTSALLLVAPFASEAQQAKKVYKIGYLS
Ga0066710_1043497821	3300009012	Grasslands Soil	MISRRAFINTLASGLLAAPLAAEAQKSEKMARVGILG
Ga0099829_100601501	3300009038	Vadose Zone Soil	VIDRRTFLAGTGAVLLAAPFAAQAQQGEKVWRLGVLSPG
Ga0099829_111821632	3300009038	Vadose Zone Soil	MDRRTFLAGTGAVLLAAPRVSEAQPSGKVPRVGYLSVF
Ga0099828_103636353	3300009089	Vadose Zone Soil	VIDRRTFLAGTGAVVLAAPLTAAAQPAGTVPRVGYLSAGS
Ga0099828_111290962	3300009089	Vadose Zone Soil	MERRTFLAGTGTVLLAAPLKAEAQEAAKAYRIGILG*
Ga0114129_125640111	3300009147	Populus Rhizosphere	VNRRAFIGTIAGGLLTAPLAAVAQKSEQKSEKMARVGILGIGPAPNPQE
Ga0075423_120144332	3300009162	Populus Rhizosphere	VIDRRTFLAGTGAALLAAPLAGEAQQSGKVPRVGYATSTDKSI
Ga0126374_108412352	3300009792	Tropical Forest Soil	MNRRAFVTGLGATLAAPLAAEGQPAAAVPKIGYLSPWA
Ga0126384_104328371	3300010046	Tropical Forest Soil	VIVRRTFLAGTGAVLLAAPLAAEGQQSGKVRRVGF
Ga0126384_112276521	3300010046	Tropical Forest Soil	MSRYMAGMKRRTFLGTVGAALLAMPLAAEAQQAGK
Ga0126384_118231641	3300010046	Tropical Forest Soil	VINRRTFLAGTGAVLLAAPLAADAAPTRKVPVVGYLAPEAE
Ga0126382_111317352	3300010047	Tropical Forest Soil	VIDRRTFLAGAGAVLLAAPLAAETQEAKKVYRIGYLSAGSLF
Ga0126373_132848073	3300010048	Tropical Forest Soil	VIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPV
Ga0134063_107348911	3300010335	Grasslands Soil	VHRRAFLAGTGAVLLTAPLVAQAQPAGRATRIGFLSPSSLHDPRTQT
Ga0126370_115206772	3300010358	Tropical Forest Soil	MIARRTFLAGTGAVLLAVPLVAEAQQPGKLYRIGWLGLNPP
Ga0126370_120809012	3300010358	Tropical Forest Soil	MDRRTFLAGTGAVLLAAPLAAGAQPAGKVYRVATVSWANEFS
Ga0126372_105321372	3300010360	Tropical Forest Soil	LIDRRTFLAGTAAVVLAAPLAAEGQQPGRLYKIGY
Ga0126372_128877201	3300010360	Tropical Forest Soil	MDRRTFLAGTGAVLLAAPLAAEAQESPKKVARVGILG
Ga0126378_100605941	3300010361	Tropical Forest Soil	VIDRRTFLACTGAVVLAAPLVAEAQQAGEVPRIGYLLPNANR
Ga0126379_112083711	3300010366	Tropical Forest Soil	VDRRTFLAGTGAVLLAAPLAAEAQQARKAPLIGILWNNPLA
Ga0136847_101507115	3300010391	Freshwater Sediment	VIDRRTFLAGTGAVLLAAPLATDAQPTAKIPRIGVLQVGTA
Ga0136847_108030875	3300010391	Freshwater Sediment	MNRRAFLAGTGAALLAAPRAAEAQKTEKKARVGILGIG
Ga0126383_114425813	3300010398	Tropical Forest Soil	VIDRRVFVGTLSGGILATQFAAEAQKPEKMARVGILGLGPVPSPQE
Ga0134122_130913891	3300010400	Terrestrial Soil	MHRRAFLKTLSGGLLAAPLAAEAQKSEKKARVGILN
Ga0134123_103012182	3300010403	Terrestrial Soil	VERRIFLAGTGAVLLTRPLPAEAQQPERVYRIGFLWDS
Ga0151489_14694852	3300011106	Soil	MNRRTFLSATGAVLLAAPIEAQSATKVPRIGYLGLDLA*
Ga0137392_1000467811	3300011269	Vadose Zone Soil	VIARRAFLVGTGAVLLAAPFAAVTAQPREKVPRVGY
Ga0137392_111081122	3300011269	Vadose Zone Soil	LIDRRTFLAGIGVVLLAPPLAAEAQQARKVYKIGS
Ga0137393_109495652	3300011271	Vadose Zone Soil	VIDRRTFLAGTGAVLLATPLAAGAQQAGKMWRIVTMQEDFTS
Ga0137389_108549591	3300012096	Vadose Zone Soil	VDRRTFLAGTGAVLLAAPLAAEGQPSVKLRKIGFLRPGLPPQ
Ga0137388_118508611	3300012189	Vadose Zone Soil	LIDRRTFLAGTGAVLLAAPLAADAQQPGKVWRIGYLQAGARTPDG
Ga0137383_103814273	3300012199	Vadose Zone Soil	VIDRRAFLAGTGAVLLAAPLAAEAQQAGKVYRVGILGEKASD
Ga0137383_104700981	3300012199	Vadose Zone Soil	MDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLAAGT
Ga0137363_113332321	3300012202	Vadose Zone Soil	VIDRRTFLAGTGAVLLAAPLAAEGQQGGKVDRIGHI
Ga0137362_103605242	3300012205	Vadose Zone Soil	VIDRRTFIAGTGAVILAAPLAAEGQLAKKVYRIR*
Ga0137362_103670553	3300012205	Vadose Zone Soil	MHAVMDRRTFLAGTGAALLSTSLAAEAQQAGKVWRIGY
Ga0137381_103529053	3300012207	Vadose Zone Soil	MDRRTFLAGTGAVVFAAPLAVQAQQPKKVWRIGFLA
Ga0137381_106031232	3300012207	Vadose Zone Soil	MDRRAFLTGTGAVLLAAPLAAEAQQAGKAYRVGILVIA
Ga0137381_107531682	3300012207	Vadose Zone Soil	LIDRRTFLAGAGAALLAAPLAAEAQQATKVARIGYLGNTLGAP
Ga0137379_108344482	3300012209	Vadose Zone Soil	MERRAFLTGTGALLLAAPLAAEAQETGKGLASVCS
Ga0137377_107553801	3300012211	Vadose Zone Soil	MMERRAFLAGTGAVLLAAPLAAQAQTVGTVRRIGVVGGAN
Ga0137366_100556131	3300012354	Vadose Zone Soil	MDRRTFLAGTGAVFLAASLAAEAQQPGKKVWIGVLSQGLPDPPPG
Ga0137385_104036672	3300012359	Vadose Zone Soil	MDRRTFLAGTGAVLLAAPLAAQAEQADRVFRIGVL
Ga0137360_105347632	3300012361	Vadose Zone Soil	VIDRRTFLAGTSAVLLAAPFAAEAQQTEKVWRIGW
Ga0137361_107928201	3300012362	Vadose Zone Soil	VERRAFLAGAGAVLLAAPLAAEAQQAGKVYRVGILGEKAS
Ga0137361_113340041	3300012362	Vadose Zone Soil	VIDRRTFLVGTGALLLAAPLAAEAQQAKKVWRIGLLS
Ga0137395_102872132	3300012917	Vadose Zone Soil	VIDRRTFLAGTGAVLLAAPLAAETQQAGKVARVGYLSPN
Ga0137416_106610941	3300012927	Vadose Zone Soil	MDRSFIAGATALLTAPLVAEAQQAGTVPRIGFLQG
Ga0137416_114485721	3300012927	Vadose Zone Soil	MERRAFLAGTGAVLLASPLAVEAQQPRVYRVGVVMQGGP
Ga0137404_106840613	3300012929	Vadose Zone Soil	MDRRVFLSALSGGLLAAPLAAEAQKPEKKARVGILNLGS
Ga0137404_116854191	3300012929	Vadose Zone Soil	MDRRTFLAGTGAVLLAAPLAAEGQKSEKKARVGIL
Ga0137407_122916782	3300012930	Vadose Zone Soil	VIDRRTFLAGTGGVFLAAPLAAEAQPTGKVHRIGFLAFSPP
Ga0137410_118229811	3300012944	Vadose Zone Soil	VIDRRTFLAGTGAVLLAAPPPGEGQPAGKVPRIALL
Ga0126375_101996693	3300012948	Tropical Forest Soil	MDRRTFLAGTGVVLLTAPLAGEAQQAKKVWRIGFLSSRSSPANL
Ga0126375_108763382	3300012948	Tropical Forest Soil	VDRRTFLAGTGAVLLAAPLAAEGQQAGKVARIGYSF*
Ga0126375_111341472	3300012948	Tropical Forest Soil	VNRRTFLAGTGAVLLAAPLSAKAQPAGKVYRIGYLSSGS
Ga0126375_117966042	3300012948	Tropical Forest Soil	VERRTFLAGTGAVLLAAPLVAEAQQPGKVHRIGFLSG
Ga0126375_120080112	3300012948	Tropical Forest Soil	MIRLWFAGTGAVLLAAPLAVEAQPAGKVARVGLLGLFT
Ga0134076_104596102	3300012976	Grasslands Soil	MDRRTFLAGTGAVLLAAPLAAEAQQAAKVARIGYL
Ga0134087_101506891	3300012977	Grasslands Soil	MDRRTFMGALTGGFLVAPLSAEAQKSEKMARVGILGI
Ga0180069_10436202	3300014882	Soil	MIDRRTFLAGPGAVLLAAPFGAQAQQAAKVHRIGFLSAARSL*
Ga0180104_12123401	3300014884	Soil	LIDRRTFLAGTGAVLLAAPLAAEAQKSERTARVGILGIG
Ga0132255_1016855961	3300015374	Arabidopsis Rhizosphere	MDRRTFLAGTGAMFLAAPLAAEAQQAKKVYRIGWMIGSSI
Ga0132255_1048032782	3300015374	Arabidopsis Rhizosphere	VIARRTFLAGTGAVLLAAPLAAGAQQAKKVYRLGYLSAGS
Ga0184620_101221612	3300018051	Groundwater Sediment	VIDRRTFLAGTGAVLLAAPLAAQEQPAGKVWRIGQ
Ga0184638_10244811	3300018052	Groundwater Sediment	MNRRTFLAGTGALLAAPLAAQAQTAGKVYRIAVLGLT
Ga0184612_103591002	3300018078	Groundwater Sediment	VIDRRSFLAGTGAVLLAAPLAAEAQQAAKIARIGYLA
Ga0184629_100239985	3300018084	Groundwater Sediment	MIDRRTFLAGTGAVLLAAPFGAQAQQAAKVHRIGFLSAVRSL
Ga0210400_111513201	3300021170	Soil	MDRRTFIAGITGGLLAAPLAAEAQKSEKMARVGILGVG
Ga0210384_100630714	3300021432	Soil	MIDRRAFISGITLSLLAAPLAAEAQKSEKMVRVGILGVGPAPSP
Ga0209431_105700971	3300025313	Soil	VIDRRTFLAGTGVALLAAPFAAEAQQAAKIARIGYLS
Ga0207684_100256346	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MERRAFLAGTGAVLAAAPLTAGAQQSSDKVYRVTVI
Ga0207693_106501601	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MERRTFLAGTGAMLLAAPLAAEAQKPRKTARVGYLLVGPANSAPSQ
Ga0207709_113948472	3300025935	Miscanthus Rhizosphere	MIDRRTFLAGTGAVLLAAPFGAEAQQASGQPRLGWLS
Ga0207665_110554521	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VNRRAFIGTVTGGLLAAPLAAEAQKSEQKSEKMARVGILGIGPAPN
Ga0208418_10326122	3300026018	Natural And Restored Wetlands	MIDRRAFLAGTGAMLLAAPLAAEAQPTNKVARIGV
Ga0209154_10522323	3300026317	Soil	MTSVMDRRTFLAGTGAMFLATPLGAEAQPATIRDRC
Ga0209377_10805761	3300026334	Soil	MTSVMDRRTFLAGTGAMFLATPLAAEAQPATIRDR
Ga0257162_10301251	3300026340	Soil	MDRRVFLSALSGGLLAAPLAAEAQKSEKKARVGILNPGS
Ga0257167_10229373	3300026376	Soil	MDRRAFLSALSGGLLAAPLAAEAQKSEKKARVGIL
Ga0257169_10456172	3300026469	Soil	MDRRTFLAGTGAVLLAAPLVAEAQQAGKVFRIGSVN
Ga0257172_10724873	3300026482	Soil	VERRVFIRTVSGGLLAAPLAAEAQLARKVARVGILFWEMG
Ga0257160_10680521	3300026489	Soil	MDRRVFLSALSGGLLAAPLAAEAQKSEKKACVGILNLGSVP
Ga0257164_10428902	3300026497	Soil	VIDRRTFLAGTGAVLLAAPLAAEAQQAGTVCRIGIAR
Ga0209806_10698103	3300026529	Soil	MNRRTFLAGTGAVLLAAPLAAEAQSAGKVPRVGYLS
Ga0209056_103546181	3300026538	Soil	VIDRRTFLAGTGAVLLAAPLAVEAQPPRKTARVGVLGVGPTP
Ga0179593_11723872	3300026555	Vadose Zone Soil	MTSVMDRRTFLAGTGAMFLAPPLAAEAQPATIRDR
Ga0209701_102127582	3300027862	Vadose Zone Soil	VDRRRFIAGAVAVIAAPLVAEAQQAGRMRRIGVLIH
Ga0209590_101898261	3300027882	Vadose Zone Soil	MNRRTFLAGTGAVLLAAPLSAQAQQPGKVYQVGLLS
Ga0209590_104136591	3300027882	Vadose Zone Soil	MISRRAFFGTMAGGLLAAPLAAEAQKSEKMARVGILGIGPA
Ga0209526_102647941	3300028047	Forest Soil	MHRRTFLAGTGAVLLAVPLAAQAQPAGNVSRIGFL
Ga0307504_102792961	3300028792	Soil	MDRRVFLGALSGGLLAAPLAAEAQKSERKARVGILNLGS
Ga0170824_1257242821	3300031231	Forest Soil	MDRRTFLAGTGAVLLAAPPAAEAQQAGKVPRVGFL
Ga0307469_107945121	3300031720	Hardwood Forest Soil	MIDRRTFLAGTGAVLLAAPLAAEAQQAGKVPRIGFLSV
Ga0307469_114345171	3300031720	Hardwood Forest Soil	MIDRRTFLAATGAVLLAAPLGAEAQPASGVPRLGWLSP
Ga0307469_123597761	3300031720	Hardwood Forest Soil	MSESTVMDRRTFLAGTGAVLLARPLAAEAQKSEKMTHVGILGIGPAPS
Ga0307468_1001096543	3300031740	Hardwood Forest Soil	MISRRAFIGSVAGGLLAAPLAAEAQKSEKKARVGILG
Ga0307468_1001797564	3300031740	Hardwood Forest Soil	VIDRRTFLAGTGVMLLAAPLAAEAQSPLKVHQIGFLPSGA
Ga0307468_1004700281	3300031740	Hardwood Forest Soil	MERRTFLAGTGAILLAAPLAAEGQQPGKVYRVGILGIKA
Ga0307468_1013595082	3300031740	Hardwood Forest Soil	MDRRAFLAGTGAVLLAAPLAAEAQQTKKVYRIGWMIG
Ga0307468_1014523021	3300031740	Hardwood Forest Soil	MERRTFLAGIGAVLLAAPFAAHAQKSGKTARVGVLNIGPAPSPQE
Ga0318508_12168602	3300031780	Soil	LNRVQRRQFLIAAGGLLAAPFAAEAQRAAKVARIG
Ga0307473_105300891	3300031820	Hardwood Forest Soil	VIDRRRFLAGTGAVLLAAPLAAQAQQAAKVYRIGMLLA
Ga0315290_113279741	3300031834	Sediment	MDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGVG
Ga0306923_101036264	3300031910	Soil	MDRRRFLAGTGAVLLATPLAAWAQQAAKVYRVGLLGGS
Ga0310909_112989533	3300031947	Soil	VICRRAFVAGLTGGLLVAPLATVAQKSEKIARVGILG
Ga0214473_107883942	3300031949	Soil	MDRRTFLADTVAVLLAAPLAAQQAGKMPRVGVIASTTS
Ga0318530_102967602	3300031959	Soil	VISRRAFVASLTGGLLTAPPAAEAQKSEKIARVGILGIGSAPSP
Ga0315278_116960481	3300031997	Sediment	LIDRRTFLAGTGVVFLAAPLAAEAQKSEKMARVGILGVGSVPSP
Ga0315281_121185733	3300032163	Sediment	MDRRTFLAGTGAVLLAAPRAAEAQKSEKKARVGILGIGPAPS
Ga0307470_102975092	3300032174	Hardwood Forest Soil	VIERRAFLAGTGAVLLAAPLAAEVQSAEKVYRIGILT
Ga0307471_1000823024	3300032180	Hardwood Forest Soil	MTSVICRRTFLAGTGAVLLAAPLALEAQPAKKTARVGVLGVGPT
Ga0307471_1006440753	3300032180	Hardwood Forest Soil	VIDRRTFLAGTGTLLLAAPLGAEAQPTEKLPRVGILSP
Ga0307471_1008223972	3300032180	Hardwood Forest Soil	MDRRTFLAGTGAVVLATPLAAEAQQAGQMPHVGFVTSNPRTATS
Ga0307471_1009033323	3300032180	Hardwood Forest Soil	VIDRRTFLAGTGAVLLAAPLAAGAQQAEKAARVAVL
Ga0307471_1013909882	3300032180	Hardwood Forest Soil	VIDRRTFLAGTGAVLLAAPFAAEAQQAAKVARIGYL
Ga0307471_1022900452	3300032180	Hardwood Forest Soil	MMDRRTFLAGTGAVLLAAPFGAEAQPAGKVHHIGFLPSGASEA
Ga0307471_1023432242	3300032180	Hardwood Forest Soil	LRENPVIDRRTFLAGTGAVLLAAPLTAGEHEAGKVWRIGYLSPG
Ga0307471_1026741362	3300032180	Hardwood Forest Soil	MTSVIDRRTFLAGTGAVLLAAPLAAHAQQATKVPRIGF
Ga0307471_1028214142	3300032180	Hardwood Forest Soil	VDRRGFIVAVTGGLLAAPRAAEAQKSEKKARVGVL
Ga0307471_1042559581	3300032180	Hardwood Forest Soil	MIDRRTFLAGTGAVVLAAPFAAEAQQAGRMYRIGWL
Ga0307472_1008069631	3300032205	Hardwood Forest Soil	MISRRAFIGSVAGGLLAAPLAAEAQRSEKMARVGILGIGTAPTPQ
Ga0307472_1017037071	3300032205	Hardwood Forest Soil	VIDRRTFLAGTGAVLLAAPLTAGEQEAGKVWRIGYLSPGFP
Ga0307472_1017343132	3300032205	Hardwood Forest Soil	VIDRRTFLAGTGAVLLAAPLAAEAQQEKKLPRVGIIW
Ga0315286_117692282	3300032342	Sediment	VIDRRTFLAGTGAVLLAAPLAAEGQQARKVYRIGYLG
Ga0315287_114791271	3300032397	Sediment	MDRRTFLAGTGALLLAAPRAAEAQKSEKKARVGILGI
Ga0315275_108001651	3300032401	Sediment	VIDRRTFLAGTGAVLLAAPLAAEAQTGRMYRIGVIDLAGSGP
Ga0315275_125087121	3300032401	Sediment	MRKDPLIDRRTFLAGTGVVLLAAPLAAEAQKSEKMARVGILGIG
Ga0315273_119024101	3300032516	Sediment	MMYRRTFIAIAVGAVLAAPRRSGAQVAGKVYRIGYLGQ
Ga0335084_119016142	3300033004	Soil	VIDRRTFLAGTGAVLLPAPLAAEAQQAAKVARIGYLTVDVAPDR
Ga0326730_11124861	3300033500	Peat Soil	MNRRTFLAGTGAALLAAPLAAEAQQTGKLHRVGYMSVVSRQSA
Ga0326732_10444631	3300033501	Peat Soil	MMDRRAFLTGTGAVLLAAPLVADAQQAGKVAHIGVLGDTSP
Ga0364934_0265577_2_118	3300034178	Sediment	MERRTFLAGTGAVLLAPPLAAQQAAKVARIGYLAGNLAA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039851

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences