NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F039873

Metagenome Family F039873

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039873
Family Type Metagenome
Number of Sequences 163
Average Sequence Length 90 residues
Representative Sequence MDDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Number of Associated Samples 134
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.88 %
% of genes near scaffold ends (potentially truncated) 32.52 %
% of genes from short scaffolds (< 2000 bps) 65.03 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.141 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(18.405 % of family members)
Environment Ontology (ENVO) Unclassified
(70.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.276 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.66%    β-sheet: 9.89%    Coil/Unstructured: 49.45%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF00856SET 54.60
PF01464SLT 11.66
PF16945Phage_r1t_holin 4.91
PF14090HTH_39 3.07
PF07728AAA_5 2.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.32 %
UnclassifiedrootN/A3.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10003435All Organisms → cellular organisms → Bacteria11794Open in IMG/M
3300000101|DelMOSum2010_c10014681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4829Open in IMG/M
3300000101|DelMOSum2010_c10025768All Organisms → Viruses → Predicted Viral3321Open in IMG/M
3300000115|DelMOSum2011_c10027249All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2590Open in IMG/M
3300000116|DelMOSpr2010_c10009609All Organisms → cellular organisms → Bacteria5078Open in IMG/M
3300000116|DelMOSpr2010_c10019829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3294Open in IMG/M
3300000116|DelMOSpr2010_c10035022All Organisms → Viruses → Predicted Viral2312Open in IMG/M
3300000117|DelMOWin2010_c10078142All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1301Open in IMG/M
3300000117|DelMOWin2010_c10188223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium645Open in IMG/M
3300000947|BBAY92_10142362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium631Open in IMG/M
3300001355|JGI20158J14315_10022618All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3145Open in IMG/M
3300001355|JGI20158J14315_10089287All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1098Open in IMG/M
3300001450|JGI24006J15134_10022465All Organisms → Viruses → Predicted Viral2878Open in IMG/M
3300001472|JGI24004J15324_10000808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium12565Open in IMG/M
3300001720|JGI24513J20088_1033046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium516Open in IMG/M
3300004279|Ga0066605_10270721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium631Open in IMG/M
3300004448|Ga0065861_1056583All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300004460|Ga0066222_1089479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium989Open in IMG/M
3300005057|Ga0068511_1005273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1541Open in IMG/M
3300005078|Ga0070770_10203074All Organisms → Viruses → Predicted Viral3724Open in IMG/M
3300005086|Ga0072334_10454626All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3252Open in IMG/M
3300005821|Ga0078746_1038385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1021Open in IMG/M
3300005822|Ga0078744_1079546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium755Open in IMG/M
3300005882|Ga0080455_1056707All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300005942|Ga0070742_10006041All Organisms → Viruses → Predicted Viral3155Open in IMG/M
3300006025|Ga0075474_10014396All Organisms → cellular organisms → Bacteria2956Open in IMG/M
3300006025|Ga0075474_10062136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1245Open in IMG/M
3300006026|Ga0075478_10021113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2194Open in IMG/M
3300006027|Ga0075462_10000284All Organisms → cellular organisms → Bacteria14971Open in IMG/M
3300006029|Ga0075466_1030946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1672Open in IMG/M
3300006752|Ga0098048_1000546All Organisms → cellular organisms → Bacteria17768Open in IMG/M
3300006793|Ga0098055_1006132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5719Open in IMG/M
3300006793|Ga0098055_1015273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3358Open in IMG/M
3300006802|Ga0070749_10035174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3100Open in IMG/M
3300006810|Ga0070754_10015354All Organisms → Viruses → Predicted Viral4624Open in IMG/M
3300006916|Ga0070750_10000212All Organisms → cellular organisms → Bacteria31084Open in IMG/M
3300006916|Ga0070750_10061038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1805Open in IMG/M
3300006916|Ga0070750_10145546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1074Open in IMG/M
3300006919|Ga0070746_10375349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium641Open in IMG/M
3300006921|Ga0098060_1029250All Organisms → Viruses → Predicted Viral1681Open in IMG/M
3300006990|Ga0098046_1050470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium973Open in IMG/M
3300006990|Ga0098046_1054893All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium925Open in IMG/M
3300007236|Ga0075463_10054857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1289Open in IMG/M
3300007236|Ga0075463_10176524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium689Open in IMG/M
3300007345|Ga0070752_1097207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1265Open in IMG/M
3300007555|Ga0102817_1074776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium741Open in IMG/M
3300007623|Ga0102948_1226360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium569Open in IMG/M
3300007640|Ga0070751_1163171All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium885Open in IMG/M
3300007692|Ga0102823_1180696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium562Open in IMG/M
3300007778|Ga0102954_1280329All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium506Open in IMG/M
3300007862|Ga0105737_1127709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium653Open in IMG/M
3300007863|Ga0105744_1122509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium645Open in IMG/M
3300007863|Ga0105744_1153304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium575Open in IMG/M
3300007863|Ga0105744_1153305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium575Open in IMG/M
3300007864|Ga0105749_1035922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium958Open in IMG/M
3300007956|Ga0105741_1008841All Organisms → Viruses → Predicted Viral2590Open in IMG/M
3300007973|Ga0105746_1073496All Organisms → Viruses → Predicted Viral1099Open in IMG/M
3300008012|Ga0075480_10471531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium608Open in IMG/M
3300008999|Ga0102816_1027121All Organisms → Viruses → Predicted Viral1665Open in IMG/M
3300009000|Ga0102960_1014506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2968Open in IMG/M
3300009000|Ga0102960_1045683All Organisms → Viruses → Predicted Viral1616Open in IMG/M
3300009001|Ga0102963_1005768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5379Open in IMG/M
3300009071|Ga0115566_10105093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1810Open in IMG/M
3300009071|Ga0115566_10119524All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300009076|Ga0115550_1294414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium522Open in IMG/M
3300009086|Ga0102812_10619957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
3300009193|Ga0115551_1028177All Organisms → cellular organisms → Bacteria2886Open in IMG/M
3300009420|Ga0114994_10022463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4436Open in IMG/M
3300009423|Ga0115548_1275221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium516Open in IMG/M
3300009435|Ga0115546_1003711All Organisms → cellular organisms → Bacteria8315Open in IMG/M
3300009435|Ga0115546_1099461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1058Open in IMG/M
3300009445|Ga0115553_1314919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium602Open in IMG/M
3300009449|Ga0115558_1236014All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium742Open in IMG/M
3300009497|Ga0115569_10315848All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium686Open in IMG/M
3300009497|Ga0115569_10500810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium513Open in IMG/M
3300009508|Ga0115567_10309143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium989Open in IMG/M
3300009508|Ga0115567_10310985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium986Open in IMG/M
3300010148|Ga0098043_1065573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1092Open in IMG/M
3300010149|Ga0098049_1012700All Organisms → Viruses → Predicted Viral2834Open in IMG/M
3300010150|Ga0098056_1091588All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300010150|Ga0098056_1158381All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium763Open in IMG/M
3300010392|Ga0118731_104854075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium606Open in IMG/M
3300017697|Ga0180120_10097847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1279Open in IMG/M
3300017697|Ga0180120_10204142All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium818Open in IMG/M
3300017713|Ga0181391_1000972All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium8656Open in IMG/M
3300017737|Ga0187218_1072836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium838Open in IMG/M
3300017740|Ga0181418_1055247All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium984Open in IMG/M
3300017741|Ga0181421_1112112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium708Open in IMG/M
3300017751|Ga0187219_1015338All Organisms → Viruses → Predicted Viral2884Open in IMG/M
3300017752|Ga0181400_1063599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1122Open in IMG/M
3300017753|Ga0181407_1046142All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300017755|Ga0181411_1025903All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300017755|Ga0181411_1026094All Organisms → Viruses → Predicted Viral1875Open in IMG/M
3300017758|Ga0181409_1001097All Organisms → cellular organisms → Bacteria10457Open in IMG/M
3300017758|Ga0181409_1057595All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300017760|Ga0181408_1058346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1026Open in IMG/M
3300017762|Ga0181422_1227113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium557Open in IMG/M
3300017771|Ga0181425_1116337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium853Open in IMG/M
3300017781|Ga0181423_1040395All Organisms → Viruses → Predicted Viral1880Open in IMG/M
3300017782|Ga0181380_1060388All Organisms → Viruses → Predicted Viral1345Open in IMG/M
3300017783|Ga0181379_1009189All Organisms → cellular organisms → Bacteria4182Open in IMG/M
3300018420|Ga0181563_10124699All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1651Open in IMG/M
3300020438|Ga0211576_10002835All Organisms → cellular organisms → Bacteria12386Open in IMG/M
3300020438|Ga0211576_10217931All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1011Open in IMG/M
3300021373|Ga0213865_10135817All Organisms → Viruses → Predicted Viral1275Open in IMG/M
3300021375|Ga0213869_10030775All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2928Open in IMG/M
3300021375|Ga0213869_10070679All Organisms → Viruses → Predicted Viral1758Open in IMG/M
3300021375|Ga0213869_10079041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1639Open in IMG/M
3300021378|Ga0213861_10314444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium799Open in IMG/M
3300021389|Ga0213868_10650957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium544Open in IMG/M
3300021958|Ga0222718_10009107All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium7570Open in IMG/M
3300021964|Ga0222719_10006266All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium10155Open in IMG/M
3300022050|Ga0196883_1015541All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium909Open in IMG/M
3300022057|Ga0212025_1024675All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium992Open in IMG/M
3300022067|Ga0196895_1005437All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1343Open in IMG/M
3300022072|Ga0196889_1000912Not Available8259Open in IMG/M
3300022168|Ga0212027_1039359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium612Open in IMG/M
3300022169|Ga0196903_1014465All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium966Open in IMG/M
3300022178|Ga0196887_1008196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3512Open in IMG/M
3300022183|Ga0196891_1004177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3032Open in IMG/M
3300022183|Ga0196891_1011274All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1764Open in IMG/M
3300022929|Ga0255752_10379052All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium566Open in IMG/M
(restricted) 3300023210|Ga0233412_10083214All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1331Open in IMG/M
(restricted) 3300024059|Ga0255040_10114806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1060Open in IMG/M
(restricted) 3300024062|Ga0255039_10305804All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium679Open in IMG/M
3300024230|Ga0228638_1038991All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1331Open in IMG/M
3300025070|Ga0208667_1001827All Organisms → cellular organisms → Bacteria7394Open in IMG/M
3300025071|Ga0207896_1003575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2910Open in IMG/M
3300025099|Ga0208669_1025992All Organisms → Viruses → Predicted Viral1461Open in IMG/M
3300025120|Ga0209535_1020128All Organisms → Viruses → Predicted Viral3400Open in IMG/M
3300025137|Ga0209336_10186098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium521Open in IMG/M
3300025138|Ga0209634_1001085All Organisms → cellular organisms → Bacteria20456Open in IMG/M
3300025138|Ga0209634_1063533Not Available1765Open in IMG/M
3300025168|Ga0209337_1290112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium599Open in IMG/M
3300025508|Ga0208148_1009430All Organisms → Viruses → Predicted Viral3034Open in IMG/M
3300025543|Ga0208303_1003280All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5916Open in IMG/M
3300025610|Ga0208149_1125023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium602Open in IMG/M
3300025632|Ga0209194_1004331Not Available6653Open in IMG/M
3300025694|Ga0209406_1067196All Organisms → Viruses → Predicted Viral1289Open in IMG/M
3300025816|Ga0209193_1002495All Organisms → cellular organisms → Bacteria8568Open in IMG/M
3300025881|Ga0209309_10039143Not Available2953Open in IMG/M
3300025889|Ga0208644_1120945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1250Open in IMG/M
3300025890|Ga0209631_10045865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2912Open in IMG/M
3300025897|Ga0209425_10194292All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1089Open in IMG/M
3300026138|Ga0209951_1113919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium550Open in IMG/M
3300026187|Ga0209929_1003728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5301Open in IMG/M
3300027191|Ga0208021_1073435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium504Open in IMG/M
3300027571|Ga0208897_1186453All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium504Open in IMG/M
3300027779|Ga0209709_10005941All Organisms → cellular organisms → Bacteria9490Open in IMG/M
(restricted) 3300027861|Ga0233415_10004297All Organisms → cellular organisms → Bacteria5853Open in IMG/M
(restricted) 3300027996|Ga0233413_10098221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1178Open in IMG/M
3300028297|Ga0228617_1113143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium647Open in IMG/M
3300028397|Ga0228639_1160725All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium515Open in IMG/M
3300028600|Ga0265303_10882861All Organisms → Viruses737Open in IMG/M
3300029448|Ga0183755_1000729All Organisms → cellular organisms → Bacteria19316Open in IMG/M
3300031774|Ga0315331_10033002Not Available3837Open in IMG/M
3300031851|Ga0315320_10006800Not Available9268Open in IMG/M
3300031851|Ga0315320_10372204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium998Open in IMG/M
3300032136|Ga0316201_10412564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1163Open in IMG/M
3300032254|Ga0316208_1039754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1520Open in IMG/M
3300032255|Ga0316209_1098516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium791Open in IMG/M
3300032257|Ga0316205_10178856All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium808Open in IMG/M
3300034374|Ga0348335_008543All Organisms → cellular organisms → Bacteria5885Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.40%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.11%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine10.43%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.52%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.52%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water4.29%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.07%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.07%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.45%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.45%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.84%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.84%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.84%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.23%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.23%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.23%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.23%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.23%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.23%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.23%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water1.23%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.61%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.61%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.61%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.61%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005822Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1EnvironmentalOpen in IMG/M
3300005882Hydrocarbon microbial community from Halfdan Field MHFEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024230Seawater microbial communities from Monterey Bay, California, United States - 48DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028297Seawater microbial communities from Monterey Bay, California, United States - 18DEnvironmentalOpen in IMG/M
3300028397Seawater microbial communities from Monterey Bay, California, United States - 50DEnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1000343573300000101MarineMTEDISAIREQALERATGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
DelMOSum2010_1001468193300000101MarineMDDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
DelMOSum2010_1002576833300000101MarineMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
DelMOSum2011_1002724963300000115MarineMDDIAQIREEAFKRAGNACEWANCGSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
DelMOSpr2010_1000960973300000116MarineMDDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
DelMOSpr2010_1001982923300000116MarineMSMDDIALIREEAFRRAGNVCEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
DelMOSpr2010_1003502223300000116MarineMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLNRYSDVNE*
DelMOWin2010_1007814223300000117MarineMDDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
DelMOWin2010_1018822323300000117MarineMDDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
BBAY92_1014236213300000947Macroalgal SurfaceMNDIAQIREQAFIRAGNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELL
JGI20158J14315_1002261843300001355Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
JGI20158J14315_1008928733300001355Pelagic MarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVA
JGI24006J15134_1002246533300001450MarineMDDIAQIREQAFIRAGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
JGI24004J15324_1000080823300001472MarineMNDIAQIREEAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
JGI24513J20088_103304613300001720MarineMDDIAQIREQAFIRAGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYR
Ga0066605_1027072123300004279MarineMKKSHLNIVCTASMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNSAVKRKWEYDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0065861_105658333300004448MarineMKKLHLNILCIVSMNDIAQIREEAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0066222_108947933300004460MarineMTKLHLNILCIVSMNDIAQIREEAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0068511_100527333300005057Marine WaterMEDIAQIRKQAFKRARNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGYLNRWSGVT*
Ga0070770_1020307473300005078WaterVTEDISAIREQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0072334_1045462653300005086WaterMDDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0078746_103838523300005821Marine SedimentMNDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0078744_107954633300005822Marine SedimentREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0080455_105670753300005882WaterKNKRSFVTEDISAIREQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0070742_1000604143300005942EstuarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0075474_1001439663300006025AqueousMDDIAQIREEAFKRARNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
Ga0075474_1006213633300006025AqueousMMSMDDIALIREEAFRRAGNVCEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0075478_1002111333300006026AqueousMDNIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
Ga0075462_1000028493300006027AqueousMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0075466_103094653300006029AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEAYLDRHSGVS*
Ga0098048_100054693300006752MarineMTEDISAIREQALQRARGRCEWADCGSHKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0098055_100613243300006793MarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0098055_101527343300006793MarineMSDIAQIREQAFIRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0070749_1003517453300006802AqueousMLIICILLNLSKLTKKLHLNILCMMSMDDITQIREEAFRRAGNACEWANCGSSKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0070754_10015354123300006810AqueousMSMDDIALIREEAFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0070750_10000212343300006916AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0070750_1006103863300006916AqueousMSMDDITQIREEAFRRAGNACEWANCGSSKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0070750_1014554613300006916AqueousAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
Ga0070746_1037534913300006919AqueousMMSMDDIALIREEAFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCMWHHGIYDGRQSMGIKVAYRELLEGYLDRHSGVS*
Ga0098060_102925013300006921MarineMTEDISAIREQALQRARGRCEWADCGSHKWLELAHIKDIGMGGNPTRKFDVQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0098046_105047013300006990MarineMNDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0098046_105489343300006990MarineCTLLMSDIAQIREQAFIRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0075463_1005485733300007236AqueousMDDITQIREEAFRRAGNACEWANCGSSKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0075463_1017652423300007236AqueousMDDIALIREEAFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0070752_109720723300007345AqueousMDDIALIREEVFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0102817_107477633300007555EstuarineMNDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGV
Ga0102948_122636013300007623WaterMNDIAQIREEAFKRAGNACEWANCSSNKWLELAHIKDIGMGGNKARKYNVNNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLNRHSGVS*
Ga0070751_116317133300007640AqueousMDDIALIREEAFRRAGNVCEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0102823_118069613300007692EstuarineMNDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLE
Ga0102954_128032923300007778WaterEEAFKRAGNACEWANCDSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
Ga0105737_112770913300007862Estuary WaterIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0105744_112250933300007863Estuary WaterDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0105744_115330433300007863Estuary WaterAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0105744_115330533300007863Estuary WaterAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLNRHSGVS*
Ga0105749_103592223300007864Estuary WaterMSDIAQIREQAFIRAGNVCEWTNCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0105741_100884173300007956Estuary WaterMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRE
Ga0105746_107349633300007973Estuary WaterMTEDISAIREQALERARGRCEWADCGSSKWIELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDINE*
Ga0075480_1047153123300008012AqueousMDDIALIREEAFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHVIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0102816_102712153300008999EstuarineMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0102960_101450683300009000Pond WaterMDDIAQIREEAFKRAGNACEWANCDSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT*
Ga0102960_104568313300009000Pond WaterMNDIAQIREEAFKRAGNACEWANCSSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYREL
Ga0102963_100576823300009001Pond WaterMNDIAQIREEAFKRAGNACEWANCSSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0115566_1010509333300009071Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0115566_1011952413300009071Pelagic MarineMDDIAQIREQAFIRAGNVCEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHS
Ga0115550_129441423300009076Pelagic MarineMTEDISAIREQALERARGRCEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAY
Ga0102812_1061995733300009086EstuarineVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0115551_102817763300009193Pelagic MarineVTEDISAIREQALERARGRCEWADCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0114994_1002246383300009420MarineMDNIAQIREEAFTRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTSVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0115548_127522123300009423Pelagic MarineMTEDISAIRKQALERATGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDR
Ga0115546_100371153300009435Pelagic MarineMTEDISAIRKQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE*
Ga0115546_109946123300009435Pelagic MarineMSDIAPIREEAFRRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0115553_131491913300009445Pelagic MarineIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0115558_123601423300009449Pelagic MarineMSDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0115569_1031584813300009497Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYREL
Ga0115569_1050081023300009497Pelagic MarineVTEDISAIREQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSNVNE*
Ga0115567_1030914333300009508Pelagic MarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYREL
Ga0115567_1031098523300009508Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGFS*
Ga0098043_106557323300010148MarineMEDIAQIREQAFKRAGNVCEWANCKDNKWLELAHIKDIGMGGNKNRKYNVDNTAVLCKWHHDIYDGRQRIGTKVAYRELLQGYLNRWSGVT*
Ga0098049_101270043300010149MarineMSDIAPIRVEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS*
Ga0098056_109158823300010150MarineMSDIAQIREQAFIRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLGGYLDRHSGVT*
Ga0098056_115838133300010150MarineAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0118731_10485407523300010392MarineMDDISQIREEAFRRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT*
Ga0180120_1009784753300017697Freshwater To Marine Saline GradientSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0180120_1020414213300017697Freshwater To Marine Saline GradientSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0181391_1000972163300017713SeawaterMDNIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0187218_107283633300017737SeawaterIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0181418_105524733300017740SeawaterMNDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0181421_111211213300017741SeawaterMSDIAQIREQAFTRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0187219_101533823300017751SeawaterMKKSHLNIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0181400_106359933300017752SeawaterMKKLHLNIVCTASMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0181407_104614233300017753SeawaterMNDIAQIREQAFIRAGNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGYLDRWSGVT
Ga0181411_102590313300017755SeawaterMKKSHLNIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSG
Ga0181411_102609413300017755SeawaterMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSG
Ga0181409_100109773300017758SeawaterMTEDISAIREQALERARGRCEWADCGSSKWIELAHIKDIGMGGNPTRKFDIQNVAMLYKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0181409_105759533300017758SeawaterMNDIAEIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLD
Ga0181408_105834613300017760SeawaterMNDIAQIREQAFIRAGNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGF
Ga0181422_122711323300017762SeawaterMDDIAQIREQAFTRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0181425_111633733300017771SeawaterCTLLMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQFMGTKVAYRELLEGYLDRHSGVS
Ga0181423_104039573300017781SeawaterMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRH
Ga0181380_106038843300017782SeawaterMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEG
Ga0181379_100918913300017783SeawaterAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0181563_1012469953300018420Salt MarshMEDIAQIREQAFKRARNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGYLNRWSGVT
Ga0211576_10002835163300020438MarineMTEDISAIREQALERARGRCEWADCGSSKWIELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0211576_1021793143300020438MarineCIVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0213865_1013581723300021373SeawaterMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0213869_1003077553300021375SeawaterMSDIAQIREQSFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0213869_1007067923300021375SeawaterMTEDISAIREQALERATGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0213869_1007904143300021375SeawaterMDDIAQIREEAFKRAGNACEWANCGSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0213861_1031444443300021378SeawaterAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0213868_1065095713300021389SeawaterMISMDDIAQIREEAFKRAGNACEWANCGSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0222718_10009107113300021958Estuarine WaterMNDIAQIREEAFKRAGNACEWANCSSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0222719_10006266223300021964Estuarine WaterMNDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVNNTAVLCKWHHDIYDGRQSMGTKVAYRELLKGYLDRHSDVS
Ga0196883_101554113300022050AqueousMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYRELLRG
Ga0212025_102467533300022057AqueousMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLNRYSDVNE
Ga0196895_100543733300022067AqueousMDDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT
Ga0196889_1000912213300022072AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEAYLDRHSGVT
Ga0212027_103935913300022168AqueousMTEDISAIREQALERAGNACEWANCGSNKWLELAHIKDIGMGGNPTRKFDIENVAMLCKWHHDIYDGRQSMGTKVAYREL
Ga0196903_101446533300022169AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0196887_1008196103300022178AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEAYLDRHSGVS
Ga0196891_100417763300022183AqueousMSMDDITQIREEAFRRAGNACEWANCGSSKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0196891_101127433300022183AqueousMSMDDIALIREEAFRRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0255752_1037905213300022929Salt MarshTVRQILYYIRLMEDIAQIREQAFKRARNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGYLNRWSGVT
(restricted) Ga0233412_1008321433300023210SeawaterMKKSHLNIVCTASMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
(restricted) Ga0255040_1011480623300024059SeawaterMKKSHLNIVCTVSMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
(restricted) Ga0255039_1030580433300024062SeawaterSHLNIVCTVSMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0228638_103899123300024230SeawaterMKKLHLNIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0208667_1001827113300025070MarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0207896_100357573300025071MarineMDDIAQIREQAFIRAGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0208669_102599253300025099MarineMTEDISAIREQALQRARGRCEWADCGSHKWLELAHIKDIGMGGNPTRKFDVQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVN
Ga0209535_102012883300025120MarineMNDIAQIREEAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0209336_1018609813300025137MarineGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0209634_100108533300025138MarineMDDIAQIREQAFIRAGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0209634_106353313300025138MarineIREQAFIRAGNVCEWANCSSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0209337_129011223300025168MarineMEDISAIREQALERARGRCEWADCGSSKWIELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0208148_100943013300025508AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLE
Ga0208303_1003280153300025543AqueousMSDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0208149_112502333300025610AqueousEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT
Ga0209194_100433173300025632Pelagic MarineMTEDISAIRKQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0209406_106719643300025694Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0209193_1002495163300025816Pelagic MarineVTEDISAIREQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0209309_1003914373300025881Pelagic MarineMDNIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0208644_112094533300025889AqueousMDDIAQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0209631_1004586553300025890Pelagic MarineMDDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0209425_1019429243300025897Pelagic MarineMSDIAPIRKEAFRRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0209951_111391923300026138Pond WaterMDDIAQIREEAFKRAGNACEWANCDSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT
Ga0209929_1003728113300026187Pond WaterMNDIAQIREEAFKRAGNVCEWANCGSNKWLELAHIKDIGMGGNKARKYNVNNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0208021_107343523300027191EstuarineCTASMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0208897_118645323300027571EstuarineMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAY
Ga0209709_10005941173300027779MarineMDNIAQIREEAFTRAGNVCEWANCSSSKWLELAHLKDIGMGGNKARKYNVDNTSVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
(restricted) Ga0233415_1000429793300027861SeawaterMTEDISAIREQALERARGRCEWADCGSSKWIELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDINE
(restricted) Ga0233413_1009822133300027996SeawaterMKKLHLNIVCTVSMSDIAPIREEAFRRAGNVCEWANCDSNKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0228617_111314333300028297SeawaterMKKLHLNIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLE
Ga0228639_116072523300028397SeawaterMNDIAQIREQAFIRAGNVCEWANCDSSKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0265303_1088286113300028600SedimentIREQALERARGRCEWANCGSSKWLELAHIKDIGMGGNPTRKFDIQNVAMLCKWHHDIYDGRQSMGTKVAYRELLRGYLDRYSDVNE
Ga0183755_1000729103300029448MarineMNDIAQIREQAFIRAGNVCEWANCEDNKWLELAHIKDIGMGGNKNRKYNLDNTAVLCKWHHDIYDGRQRMGTKVAYRELLQGYLNRWSNVT
Ga0315331_1003300213300031774SeawaterGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLNRHSGVS
Ga0315320_1000680093300031851SeawaterMDNIAQIREHAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVS
Ga0315320_1037220433300031851SeawaterMKKLHLNIVCTVLMNDIAQIREQAFIRAGNVCEWANCDSGKWLELAHLKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0316201_1041256433300032136Worm BurrowMDDIAQIREEAFKRARNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT
Ga0316208_103975413300032254Microbial MatMDDISQIREEAFRRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0316209_109851633300032255Microbial MatMISMDDISQIREEAFRRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0316205_1017885623300032257Microbial MatMMSMDDITQIREEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLEGYLDRHSGVT
Ga0348335_008543_3517_37923300034374AqueousMDDIAQIRKEAFKRAGNACEWANCGSNKWLELAHIKDIGMGGNKARKYNVDNTAVLCKWHHDIYDGRQSMGTKVAYRELLQGYLNRWSGVT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.