Basic Information | |
---|---|
Family ID | F039944 |
Family Type | Metagenome |
Number of Sequences | 162 |
Average Sequence Length | 45 residues |
Representative Sequence | MIRDLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLNLEK |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 162 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 66.23 % |
% of genes near scaffold ends (potentially truncated) | 22.84 % |
% of genes from short scaffolds (< 2000 bps) | 64.81 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.815 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (46.914 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.556 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (62.346 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 162 Family Scaffolds |
---|---|---|
PF08299 | Bac_DnaA_C | 11.11 |
PF14279 | HNH_5 | 1.85 |
PF03837 | RecT | 1.23 |
PF12684 | DUF3799 | 1.23 |
PF13392 | HNH_3 | 1.23 |
PF00145 | DNA_methylase | 0.62 |
PF00149 | Metallophos | 0.62 |
PF13884 | Peptidase_S74 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 11.11 |
COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 1.23 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.81 % |
All Organisms | root | All Organisms | 35.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109460422 | Not Available | 781 | Open in IMG/M |
3300002835|B570J40625_100064610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4948 | Open in IMG/M |
3300002835|B570J40625_100073673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4496 | Open in IMG/M |
3300002835|B570J40625_100162036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 2521 | Open in IMG/M |
3300002835|B570J40625_100243927 | Not Available | 1882 | Open in IMG/M |
3300002835|B570J40625_100730991 | Not Available | 881 | Open in IMG/M |
3300002835|B570J40625_100745652 | Not Available | 869 | Open in IMG/M |
3300002835|B570J40625_100982261 | Not Available | 723 | Open in IMG/M |
3300002835|B570J40625_101568685 | Not Available | 539 | Open in IMG/M |
3300005582|Ga0049080_10257295 | Not Available | 569 | Open in IMG/M |
3300005582|Ga0049080_10303945 | Not Available | 514 | Open in IMG/M |
3300007972|Ga0105745_1070595 | Not Available | 991 | Open in IMG/M |
3300007973|Ga0105746_1278866 | Not Available | 578 | Open in IMG/M |
3300007974|Ga0105747_1026158 | Not Available | 1627 | Open in IMG/M |
3300008107|Ga0114340_1003382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9711 | Open in IMG/M |
3300008110|Ga0114343_1064737 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1362 | Open in IMG/M |
3300009085|Ga0105103_10173664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300009085|Ga0105103_10290841 | Not Available | 889 | Open in IMG/M |
3300009085|Ga0105103_10404479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 756 | Open in IMG/M |
3300009085|Ga0105103_10855506 | Not Available | 531 | Open in IMG/M |
3300009165|Ga0105102_10105020 | Not Available | 1331 | Open in IMG/M |
3300009165|Ga0105102_10497971 | Not Available | 661 | Open in IMG/M |
3300009165|Ga0105102_10866334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 519 | Open in IMG/M |
3300009168|Ga0105104_10191601 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
3300009169|Ga0105097_10054019 | Not Available | 2165 | Open in IMG/M |
3300009169|Ga0105097_10056099 | Not Available | 2125 | Open in IMG/M |
3300009169|Ga0105097_10225379 | Not Available | 1032 | Open in IMG/M |
3300009169|Ga0105097_10254747 | Not Available | 967 | Open in IMG/M |
3300009169|Ga0105097_10288249 | Not Available | 906 | Open in IMG/M |
3300009169|Ga0105097_10416947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300009169|Ga0105097_10417853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300009170|Ga0105096_10094777 | Not Available | 1487 | Open in IMG/M |
3300010354|Ga0129333_10940546 | Not Available | 729 | Open in IMG/M |
3300010354|Ga0129333_11750835 | Not Available | 504 | Open in IMG/M |
3300012017|Ga0153801_1085357 | Not Available | 556 | Open in IMG/M |
3300013004|Ga0164293_10015544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 6389 | Open in IMG/M |
3300013005|Ga0164292_10653065 | Not Available | 675 | Open in IMG/M |
3300013372|Ga0177922_10208233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1165 | Open in IMG/M |
3300013372|Ga0177922_10671676 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1085 | Open in IMG/M |
3300013372|Ga0177922_11275324 | Not Available | 588 | Open in IMG/M |
3300017754|Ga0181344_1238285 | Not Available | 505 | Open in IMG/M |
3300017780|Ga0181346_1014689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3323 | Open in IMG/M |
3300020160|Ga0211733_10270798 | Not Available | 1636 | Open in IMG/M |
3300020490|Ga0208052_100166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7139 | Open in IMG/M |
3300020491|Ga0208829_104356 | Not Available | 1291 | Open in IMG/M |
3300020533|Ga0208364_1023308 | Not Available | 862 | Open in IMG/M |
3300020533|Ga0208364_1031724 | Not Available | 716 | Open in IMG/M |
3300020550|Ga0208600_1000014 | Not Available | 25366 | Open in IMG/M |
3300020550|Ga0208600_1057396 | Not Available | 575 | Open in IMG/M |
3300020553|Ga0208855_1028699 | Not Available | 782 | Open in IMG/M |
3300027721|Ga0209492_1008441 | Not Available | 3413 | Open in IMG/M |
3300027721|Ga0209492_1050504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1466 | Open in IMG/M |
3300027721|Ga0209492_1119266 | Not Available | 926 | Open in IMG/M |
3300027900|Ga0209253_10599078 | Not Available | 809 | Open in IMG/M |
3300027972|Ga0209079_10293220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 552 | Open in IMG/M |
3300031707|Ga0315291_10144277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2499 | Open in IMG/M |
3300031707|Ga0315291_10361295 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300031746|Ga0315293_10135759 | Not Available | 2063 | Open in IMG/M |
3300031772|Ga0315288_10279106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1758 | Open in IMG/M |
3300031772|Ga0315288_10319194 | Not Available | 1613 | Open in IMG/M |
3300031885|Ga0315285_10189503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
3300031885|Ga0315285_10352464 | Not Available | 1075 | Open in IMG/M |
3300031885|Ga0315285_10752694 | Not Available | 618 | Open in IMG/M |
3300031885|Ga0315285_10850609 | Not Available | 565 | Open in IMG/M |
3300031885|Ga0315285_10874683 | Not Available | 553 | Open in IMG/M |
3300031952|Ga0315294_11245086 | Not Available | 600 | Open in IMG/M |
3300031999|Ga0315274_10396783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1600 | Open in IMG/M |
3300031999|Ga0315274_10540854 | Not Available | 1304 | Open in IMG/M |
3300031999|Ga0315274_10715374 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300031999|Ga0315274_11402352 | Not Available | 672 | Open in IMG/M |
3300031999|Ga0315274_11762696 | Not Available | 570 | Open in IMG/M |
3300031999|Ga0315274_11986380 | Not Available | 523 | Open in IMG/M |
3300031999|Ga0315274_12007273 | Not Available | 519 | Open in IMG/M |
3300032046|Ga0315289_11199138 | Not Available | 612 | Open in IMG/M |
3300032046|Ga0315289_11452498 | Not Available | 527 | Open in IMG/M |
3300032053|Ga0315284_10197397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2606 | Open in IMG/M |
3300032342|Ga0315286_10660593 | Not Available | 1071 | Open in IMG/M |
3300032342|Ga0315286_10897055 | Not Available | 889 | Open in IMG/M |
3300032401|Ga0315275_10836249 | Not Available | 1019 | Open in IMG/M |
3300032516|Ga0315273_10150635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3189 | Open in IMG/M |
3300033418|Ga0316625_101857395 | Not Available | 587 | Open in IMG/M |
3300033992|Ga0334992_0003979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 10904 | Open in IMG/M |
3300033992|Ga0334992_0009864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 6404 | Open in IMG/M |
3300033992|Ga0334992_0025835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3566 | Open in IMG/M |
3300033992|Ga0334992_0059635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 2139 | Open in IMG/M |
3300033992|Ga0334992_0217668 | Not Available | 939 | Open in IMG/M |
3300033992|Ga0334992_0387675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 631 | Open in IMG/M |
3300033993|Ga0334994_0006624 | Not Available | 8113 | Open in IMG/M |
3300033993|Ga0334994_0009151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 6846 | Open in IMG/M |
3300033993|Ga0334994_0034473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3255 | Open in IMG/M |
3300033993|Ga0334994_0045553 | Not Available | 2763 | Open in IMG/M |
3300033993|Ga0334994_0127065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1463 | Open in IMG/M |
3300033993|Ga0334994_0467909 | Not Available | 593 | Open in IMG/M |
3300033994|Ga0334996_0205388 | Not Available | 1048 | Open in IMG/M |
3300033994|Ga0334996_0347906 | Not Available | 716 | Open in IMG/M |
3300033995|Ga0335003_0051177 | Not Available | 2217 | Open in IMG/M |
3300033996|Ga0334979_0006157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 8400 | Open in IMG/M |
3300034012|Ga0334986_0120822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1544 | Open in IMG/M |
3300034013|Ga0334991_0055916 | Not Available | 2037 | Open in IMG/M |
3300034018|Ga0334985_0008567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8168 | Open in IMG/M |
3300034061|Ga0334987_0004351 | All Organisms → cellular organisms → Bacteria | 13535 | Open in IMG/M |
3300034061|Ga0334987_0025134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 5283 | Open in IMG/M |
3300034061|Ga0334987_0060106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 3092 | Open in IMG/M |
3300034061|Ga0334987_0134587 | Not Available | 1836 | Open in IMG/M |
3300034061|Ga0334987_0138124 | Not Available | 1804 | Open in IMG/M |
3300034061|Ga0334987_0142216 | Not Available | 1769 | Open in IMG/M |
3300034061|Ga0334987_0144568 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
3300034061|Ga0334987_0158802 | Not Available | 1644 | Open in IMG/M |
3300034061|Ga0334987_0374927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 911 | Open in IMG/M |
3300034061|Ga0334987_0480833 | Not Available | 762 | Open in IMG/M |
3300034062|Ga0334995_0093829 | Not Available | 2295 | Open in IMG/M |
3300034062|Ga0334995_0159497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1617 | Open in IMG/M |
3300034064|Ga0335001_0001417 | All Organisms → cellular organisms → Bacteria | 14450 | Open in IMG/M |
3300034064|Ga0335001_0015324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4533 | Open in IMG/M |
3300034064|Ga0335001_0022670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3693 | Open in IMG/M |
3300034066|Ga0335019_0450741 | Not Available | 777 | Open in IMG/M |
3300034092|Ga0335010_0053108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2902 | Open in IMG/M |
3300034092|Ga0335010_0378987 | Not Available | 781 | Open in IMG/M |
3300034092|Ga0335010_0488941 | Not Available | 650 | Open in IMG/M |
3300034093|Ga0335012_0388039 | Not Available | 686 | Open in IMG/M |
3300034095|Ga0335022_0453735 | Not Available | 679 | Open in IMG/M |
3300034101|Ga0335027_0002865 | All Organisms → cellular organisms → Bacteria | 15155 | Open in IMG/M |
3300034102|Ga0335029_0592007 | Not Available | 624 | Open in IMG/M |
3300034104|Ga0335031_0020780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4813 | Open in IMG/M |
3300034104|Ga0335031_0233195 | Not Available | 1229 | Open in IMG/M |
3300034104|Ga0335031_0379619 | Not Available | 894 | Open in IMG/M |
3300034104|Ga0335031_0549768 | Not Available | 691 | Open in IMG/M |
3300034104|Ga0335031_0727913 | Not Available | 565 | Open in IMG/M |
3300034105|Ga0335035_0188288 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
3300034106|Ga0335036_0001650 | Not Available | 19800 | Open in IMG/M |
3300034106|Ga0335036_0001717 | All Organisms → cellular organisms → Bacteria | 19440 | Open in IMG/M |
3300034106|Ga0335036_0337889 | Not Available | 988 | Open in IMG/M |
3300034106|Ga0335036_0547422 | Not Available | 712 | Open in IMG/M |
3300034106|Ga0335036_0650333 | Not Available | 632 | Open in IMG/M |
3300034108|Ga0335050_0049528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2626 | Open in IMG/M |
3300034111|Ga0335063_0578888 | Not Available | 532 | Open in IMG/M |
3300034117|Ga0335033_0028200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3597 | Open in IMG/M |
3300034119|Ga0335054_0308213 | Not Available | 927 | Open in IMG/M |
3300034120|Ga0335056_0380662 | Not Available | 764 | Open in IMG/M |
3300034121|Ga0335058_0015734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4539 | Open in IMG/M |
3300034121|Ga0335058_0064078 | Not Available | 2141 | Open in IMG/M |
3300034121|Ga0335058_0367775 | Not Available | 828 | Open in IMG/M |
3300034121|Ga0335058_0801775 | Not Available | 513 | Open in IMG/M |
3300034122|Ga0335060_0040649 | Not Available | 2975 | Open in IMG/M |
3300034122|Ga0335060_0046101 | Not Available | 2766 | Open in IMG/M |
3300034279|Ga0335052_0150121 | Not Available | 1374 | Open in IMG/M |
3300034279|Ga0335052_0155804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1343 | Open in IMG/M |
3300034279|Ga0335052_0275835 | Not Available | 937 | Open in IMG/M |
3300034279|Ga0335052_0363581 | Not Available | 780 | Open in IMG/M |
3300034280|Ga0334997_0269829 | Not Available | 1103 | Open in IMG/M |
3300034283|Ga0335007_0000976 | Not Available | 22088 | Open in IMG/M |
3300034283|Ga0335007_0017164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 5736 | Open in IMG/M |
3300034283|Ga0335007_0086989 | Not Available | 2339 | Open in IMG/M |
3300034356|Ga0335048_0047686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2789 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 46.91% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 16.05% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 14.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.64% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.09% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.47% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.23% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.23% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.23% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020491 | Freshwater microbial communities from Lake Mendota, WI - 19JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1094604221 | 3300002408 | Freshwater | LFLSLALLALLGLAIAITSGTFGGPSDIETRLRSSEPLSLEP* |
B570J40625_1000646104 | 3300002835 | Freshwater | MIRDLSLALALLVLLGFAVAITSGVLGGPSDLEMRVRASEPVNL* |
B570J40625_10007367311 | 3300002835 | Freshwater | MKLSNLFLCLALLALLALAIAITSGCFGGPSDIETRLRASEPVSLQK* |
B570J40625_1001620365 | 3300002835 | Freshwater | MIRDLFLALALLALLGLAVAVTSGKLGGPSDIEMRKRASEPFIR* |
B570J40625_1002439272 | 3300002835 | Freshwater | MIRDLFLALALVALLGLAIAVTSGCFGDPSDIETRLRASEPLNL* |
B570J40625_1007309913 | 3300002835 | Freshwater | MIRNLFLSLALLALLGLAIAITSGTFGGPSDIETRLRSSEPLSLEP* |
B570J40625_1007456523 | 3300002835 | Freshwater | MIRDLFLALAWLACLGFAIAVTSGVFGGPSDLEMRIRASEPLNL* |
B570J40625_1009822612 | 3300002835 | Freshwater | MKLSDLFLAIALLACLGIAVAVTNGTFGGPSDIETRLRASEPLNLEP* |
B570J40625_1015686852 | 3300002835 | Freshwater | MKASDLFLCLALLALLAIAVAVTSGAFGGPSDIEMRVRASEPVNLEP* |
Ga0049081_102806663 | 3300005581 | Freshwater Lentic | LALLALGIAITSGALGGPSDIEMRMRASEPLNLKP* |
Ga0049080_102572952 | 3300005582 | Freshwater Lentic | MKASDLFLSLALLALLGIAIAVTSGTFGGPSDIEMRVRASEPLNLKN* |
Ga0049080_103039452 | 3300005582 | Freshwater Lentic | MKASDLFLALTLVALLALGIAITSGTFGGPSDLEMRVRASEPFKL* |
Ga0105745_10705952 | 3300007972 | Estuary Water | MIRDLLLALALVALLGLAIAVTSGKLGGPSDIETRLRASEPLNLEP* |
Ga0105745_10815942 | 3300007972 | Estuary Water | LALLGFAIALTSGAFGGPRDIETRVRASEPLNLEP* |
Ga0105746_12788663 | 3300007973 | Estuary Water | MKASDLFLSLALLALLGFAIALTSGAFGGPSDIETRVRA |
Ga0105747_10261584 | 3300007974 | Estuary Water | MIRETFLAIALLALLGLAIAITSGKLGGPSDIETRLRASEPLNLEP* |
Ga0114340_100338219 | 3300008107 | Freshwater, Plankton | MIRDLFLALALVLCFALGIAISSGMFGGPSDIEMRMRASEPVSLQK* |
Ga0114343_10647371 | 3300008110 | Freshwater, Plankton | MIRNLFLSLAWFALLCLGIAISSGAFGGPSDLEMRMRASEPVRLQK* |
Ga0105103_101736642 | 3300009085 | Freshwater Sediment | MIRETLLFLALVLCLGLSIAITSGTFGGPSDIETRLRASEPLNLEP* |
Ga0105103_102908413 | 3300009085 | Freshwater Sediment | MIRETFLALALLALLGFAIAVTSGAFGGPSDIEMRKRASEPLKLQK* |
Ga0105103_104044792 | 3300009085 | Freshwater Sediment | MKASDLFLSLVLLALLGFAIAITSGVLGGPSDIEMRVRASEPLNRLK* |
Ga0105103_108555061 | 3300009085 | Freshwater Sediment | SDLSLSLALLALLGFAIAVTSGKLGGPSDLEMRVRASEPLKQ* |
Ga0105102_101050201 | 3300009165 | Freshwater Sediment | LKASDLFLALALVALLALGIAVTSGAFGGPSDLKMRVRASEPFTR* |
Ga0105102_102908353 | 3300009165 | Freshwater Sediment | LALLGFAVAITSGKLGGPSDLEMRVRASEPLNLKN* |
Ga0105102_104979711 | 3300009165 | Freshwater Sediment | LALALVLCLGFAVAITSGVLGGPSDIETRLRASEPVNLEP* |
Ga0105102_105295993 | 3300009165 | Freshwater Sediment | ALVVCLALAIAITSGAFGGPSDLEMRLRASEPLNLEP* |
Ga0105102_108663342 | 3300009165 | Freshwater Sediment | TNLFLALALVALLGIAVAVTSGAFGGPSDIETRLRASEPVNLQK* |
Ga0105104_101916011 | 3300009168 | Freshwater Sediment | GMNIRDLFLALALVALLGLAVAITSGKLGGPSDLEMRVRASEPLNLKN* |
Ga0105097_100540194 | 3300009169 | Freshwater Sediment | LKASDLFLALALVVLLGFAIAVTSGKLGGPSDLEMRVRASEPL |
Ga0105097_100560993 | 3300009169 | Freshwater Sediment | MKASNLFLCLALLALIGIAIALTSGKLGGPSDLEMRVRASEPLNL* |
Ga0105097_102253793 | 3300009169 | Freshwater Sediment | MKITDLVLCLALLALLGFAIAITSGAFGGPSDIETRVRASEPLNQ* |
Ga0105097_102547474 | 3300009169 | Freshwater Sediment | MIRETFLALALLALLGFAIAITSGSFGGPSDIEMRIRASEP |
Ga0105097_102882492 | 3300009169 | Freshwater Sediment | MKITDLFLCLALLALLGFAIAITSGVLGGPSDLEMRIRASEPLNQ* |
Ga0105097_104169472 | 3300009169 | Freshwater Sediment | MKASDLFLFLALLALLALLGLAVAVTSGAFGGPSDLEMRIRASEPLNQ* |
Ga0105097_104178532 | 3300009169 | Freshwater Sediment | MKTSDLFLALALLALLGFAIAVTSGALGGPSDIETRIRASEPFTR* |
Ga0105096_100947774 | 3300009170 | Freshwater Sediment | MNRDLSLALALVALLALGIAVTSGAFGGPSDIETRLRASEPVNLEPLNQ* |
Ga0129333_109405462 | 3300010354 | Freshwater To Marine Saline Gradient | MTFRDLFLCIALVVCLGLAIAVTSGVLGGPSDLEMRMRASEPVRLQK* |
Ga0129333_117508352 | 3300010354 | Freshwater To Marine Saline Gradient | MKLSDLFLSLALLALLGLAVAITSGAFSGPSDIEMRVRASEPVSLKH* |
Ga0153801_10853572 | 3300012017 | Freshwater | MKASDLFLSLALLALLGIAIAVTSGTFGGPSDIETRLRASEPLNLKP* |
Ga0164293_100155444 | 3300013004 | Freshwater | MIRDLFLAIALVLCLALAIAVTSGTLGGPSDLEMRIRASEPLNL* |
Ga0164292_106530653 | 3300013005 | Freshwater | MKASNLFLSLALLALLGFAIAVTSGKLGGPSDLEMRVRASEPLNLEP* |
Ga0177922_102082334 | 3300013372 | Freshwater | MKASDLFLALALVLCLGVAIAVTSGVLGGPSDLEMRVRASEPLNLEP* |
Ga0177922_106716761 | 3300013372 | Freshwater | MKASDLFLSLALLALLALGIAITSGALGGPSDIEMRMRASEPLNLK |
Ga0177922_112753243 | 3300013372 | Freshwater | MKAFDLFLCLALLALLSLAVAVTSGVLGGPSDIETRVRASEPLNLEP* |
Ga0181344_12382851 | 3300017754 | Freshwater Lake | LFLAIAWLACLGLAIAVTSGKFGGPSDIELFQRASEPFAR |
Ga0181346_10146898 | 3300017780 | Freshwater Lake | MIRETFLSLALLALLGLAVAITSGTFGGLSDLEMRKRASEPVNLDN |
Ga0211733_102707984 | 3300020160 | Freshwater | MTARDLCLALALVALLALAIAIQGGAWGPSDLELFQRAAEPFNL |
Ga0208052_1001668 | 3300020490 | Freshwater | MIRDLSLALALLVLLGFAVAITSGVLGGPSDLEMRVRASEPVNL |
Ga0208829_1043564 | 3300020491 | Freshwater | MIRDLFLALALVALLGLAIAVTSGCFGDPSDIETRLRASEPLNL |
Ga0208364_10233082 | 3300020533 | Freshwater | MKLSDLFLAIALLACLGIAVAVTNGTFGGPSDIETRLRASEPLNLEP |
Ga0208364_10317241 | 3300020533 | Freshwater | MIRDLFLALALLALLGLAVAVTSGKLGGPSDIEMRKRASEPFIR |
Ga0208600_100001413 | 3300020550 | Freshwater | MKLSNLFLCLALLALLALAIAITSGCFGGPSDIETRLRASEPVSLQK |
Ga0208600_10573961 | 3300020550 | Freshwater | TPSHGKAGSMIRDLFLSIALLALIGFAIAVTSGAFGGPSDLEMRVRASEPLNL |
Ga0208855_10286992 | 3300020553 | Freshwater | RDLFLALALVLCLGFAVAVTSGTFGGPSDLEMRLRASEPVNLEP |
Ga0209704_12114191 | 3300027693 | Freshwater Sediment | LVLCLGFAVAITSGVLGGPSDIETRLRASEPVNLEP |
Ga0209704_12522561 | 3300027693 | Freshwater Sediment | ALVVCLALAIAITSGAFGGPSDLEMRLRASEPLNLEP |
Ga0209492_10084415 | 3300027721 | Freshwater Sediment | MKASNLFLCLALLALIGIAIALTSGKLGGPSDLEMRVRASEPLNL |
Ga0209492_10505042 | 3300027721 | Freshwater Sediment | MKITDLFLCLALLALLGFAIAITSGVLGGPSDLEMRIRASEPLNQ |
Ga0209492_11192661 | 3300027721 | Freshwater Sediment | MPAAKGKGGDLKAFDLFLSLALLALLGFAVAVTSGALGGPSDIEMRIRASEPLNL |
Ga0209253_105990781 | 3300027900 | Freshwater Lake Sediment | GKGRGMIRETFLAIALVLCLGFAIAVTSGTFGGPSDIETRMRASEPVSLQK |
Ga0209079_102932201 | 3300027972 | Freshwater Sediment | LKASDIFLALALVALLGFAIAITSGVLGGPSDIEMRVRASEPLNRLK |
Ga0315291_101442772 | 3300031707 | Sediment | MIRDLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLSLQK |
Ga0315291_103612951 | 3300031707 | Sediment | MIRDLFLSLALLVLLALGLAITSGTFGGPSDIEMRVRASEPLSLQK |
Ga0315293_101357594 | 3300031746 | Sediment | MIRDLFLALALVALLALAIAVTSGAFGGPSDIETRVRASEPLNLEN |
Ga0315288_102791062 | 3300031772 | Sediment | MIRDLFLSLALLVLLALGLAITSGAFGGPSDLEMRLRASEPLSLQK |
Ga0315288_103191945 | 3300031772 | Sediment | MIIRDLFLALALVALLALGIAITSGAFGGPSDLEMRLRASEPLSLQK |
Ga0315285_101895036 | 3300031885 | Sediment | MSIRDLFLSLALLVLLALAIAVTSGAFGGPSDLEMRVRASEPLSLQK |
Ga0315285_103524643 | 3300031885 | Sediment | HLFLALALVALLALAIAVTSGAFGGPSDIETRVRASEPLNLEN |
Ga0315285_107526941 | 3300031885 | Sediment | AYQGRVAFNGKDGGMSIRDLFLSLALLVLLALGIAITSGAFGGPSDLEMRLRASEPLSLQ |
Ga0315285_108506091 | 3300031885 | Sediment | FLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLNLEK |
Ga0315285_108746831 | 3300031885 | Sediment | MIRDLFLALALVLCLALGIAITSGTFGGPSDIETRVRASEPLSLQK |
Ga0315294_112450863 | 3300031952 | Sediment | MIRDLFLSLALLVLLALAIAVTSGAFGGPGDIEMRVRASEPLS |
Ga0315274_103967835 | 3300031999 | Sediment | MIRHLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLSLQK |
Ga0315274_105408543 | 3300031999 | Sediment | MIRHLFLALALVALLGFAIAVTSGVLGGPSDIEMRMRASEPTSIQK |
Ga0315274_107153743 | 3300031999 | Sediment | RKGRGMIRDLFLALALVALLALAIAVTSGAFGGPSDIETRVRASEPLNLEN |
Ga0315274_114023521 | 3300031999 | Sediment | MIRDLFLSLALLVLLALAIAVTSGAFGGPNDIEMRV |
Ga0315274_116132213 | 3300031999 | Sediment | VALLALAIAVTSGAFGGPSDIEMRVRASEPLNLEK |
Ga0315274_117626962 | 3300031999 | Sediment | FLSLALLVLLALAIAVTSGAFGGPSDIEMRVRASEPLSLQK |
Ga0315274_119863802 | 3300031999 | Sediment | MSIRDLFLSLALLVLLALAIAVTSGAFGGPSDLEMRVRASEPLSIQK |
Ga0315274_120072732 | 3300031999 | Sediment | MSIRDLFLSLALLVLLALGIAITSGAFGGPSDLEMRLRASEPLSLQK |
Ga0315289_111991381 | 3300032046 | Sediment | ALALLLCLALGIAITSGTFGGPSDIETRVRASEPLSLQK |
Ga0315289_114524981 | 3300032046 | Sediment | ARKGRGMIRDLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLSLQK |
Ga0315284_101973979 | 3300032053 | Sediment | GMIRDLFLALALVALLALAIAVTSGAFGGPSDLEMRLRASEPLSLQK |
Ga0315286_106605932 | 3300032342 | Sediment | MIRDLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPLNLEK |
Ga0315286_108970551 | 3300032342 | Sediment | RGMIRDLFLALALVALLALAIAVTSGAFGGPSDIETRVRASEPLNLEN |
Ga0315275_108362494 | 3300032401 | Sediment | RDLFLSLALLVLLALGIAITSGAFGGPSDLEMRLRASEPLSLQK |
Ga0315273_101506352 | 3300032516 | Sediment | MIIRDLFLALALVALLALAIAVTSGAFGGPSDIEMRVRASEPASLQK |
Ga0316625_1018573951 | 3300033418 | Soil | MKNLFLSLALLALLGLAVAITGGCFGGPSDLEMRMRASEPLNLKN |
Ga0334992_0003979_5344_5487 | 3300033992 | Freshwater | MKASNLFLSLALLALLGFAIAVTSGKLGGPSDLEMRVRASEPLNLEP |
Ga0334992_0009864_4731_4871 | 3300033992 | Freshwater | MIRDLFLSLALVALLALAIALTSGAFGGLSDLEMRMRASEPVNLEP |
Ga0334992_0025835_874_1008 | 3300033992 | Freshwater | MIRDLFLALAWLACLGFAIAVTSGVFGGPSDLEMRIRASEPLNL |
Ga0334992_0059635_649_789 | 3300033992 | Freshwater | MIRDLFLTLALVLCLGLAIAVTSGCFGGPSDIETRLRASEPLNLEP |
Ga0334992_0217668_82_216 | 3300033992 | Freshwater | MIRDLFLAIALVLCLGIAIAVTSGTFGGPSDLEMRVRASEPLNL |
Ga0334992_0387675_202_345 | 3300033992 | Freshwater | MTLRDLFLSLALLALLGFAIAITSGAFGGPSDIEMRIRASEPVNLKN |
Ga0334994_0006624_3324_3464 | 3300033993 | Freshwater | MIRNLFLSLALLALLGLAIAITSGTFGGPSDIETRLRSSEPLSLEP |
Ga0334994_0009151_3679_3819 | 3300033993 | Freshwater | MIRDLSLAIALVASIALGVAVTSGAFGGPSDVEMRIRASEPLNLQK |
Ga0334994_0034473_820_960 | 3300033993 | Freshwater | MSRETFLSIALVVCFALGIAVTSGKLGGPSDLEMRVRASEPVNLEP |
Ga0334994_0045553_996_1139 | 3300033993 | Freshwater | MTFRDLFLSLALVALIGIAVAVTSGTFGGPSDLEMRMRASEPLKLQK |
Ga0334994_0127065_608_751 | 3300033993 | Freshwater | MKASDLFLALALVALLGIAVAVTSGAFGGPSDVEMRIRASEPLNLEP |
Ga0334994_0467909_440_574 | 3300033993 | Freshwater | MIRDLFLAIALVALLALAIALTSGAFGGPSDLETRVRASEPFAR |
Ga0334996_0205388_646_789 | 3300033994 | Freshwater | MTLRDLFLSLALLALLGFAIAITSGVFGGPSDIEMRIRASEPVNLKN |
Ga0334996_0347906_350_490 | 3300033994 | Freshwater | MIRETFLALALLALLGFAIAITSGAFGGPSDIETRLRASEPLNLEP |
Ga0335003_0051177_938_1078 | 3300033995 | Freshwater | MIRDLFLSLALLALLGFAIAVTSGKLGGPSDLEMRVRASEPVKLQK |
Ga0334979_0006157_5560_5694 | 3300033996 | Freshwater | MIRDLFLAIALVLCLALAIAVTSGTLGGPSDLEMRIRASEPLNL |
Ga0334986_0120822_157_300 | 3300034012 | Freshwater | MKASDLFLALALVALLALAIAVTSGKLGGPSDLEMRVRASEPLNLEP |
Ga0334991_0055916_2_121 | 3300034013 | Freshwater | MKASDLFLALALVALLALAIAVTSGKLGGPSDLEMRVRAS |
Ga0334985_0008567_5507_5644 | 3300034018 | Freshwater | MIRDLFLALALVALLGIAIAICGGAWGPSDLEMRVRASEPLNLQK |
Ga0334987_0004351_2766_2909 | 3300034061 | Freshwater | LKAFDLFLSLALLALLGFAIAITSGALGGPSDLEMRIRASEPLNLEP |
Ga0334987_0025134_2382_2519 | 3300034061 | Freshwater | LKISDIFLTLALVALLGLAIAITSGTFGGPSDIEMRVRASEPFTR |
Ga0334987_0060106_1529_1672 | 3300034061 | Freshwater | LKASNLFLSLALLALLGFAIAVTSGKLGGPSDIEMRIRASEPVNLEP |
Ga0334987_0134587_1284_1424 | 3300034061 | Freshwater | MIRETFLALALVALLGLAIAITSGSFGGPSDIEMRIRASEPLNLEP |
Ga0334987_0138124_439_582 | 3300034061 | Freshwater | MKASDLFLCLALFALLGFAVAVTSGAFGGPSDLEMRVRASEPLNLEP |
Ga0334987_0142216_218_358 | 3300034061 | Freshwater | MIRDLSLALALLVLLGFAVAVTSGTFGGPSDIETRVRASEPLNLEP |
Ga0334987_0144568_351_494 | 3300034061 | Freshwater | MKLHDLFLCLAWLALFGLAVAVTSGAFGGPSDIEMRVRASEPLNLEP |
Ga0334987_0158802_908_1051 | 3300034061 | Freshwater | MKITDLFLSLALLACLGLAIAITSGKLGGPSDLEMRMRASEPLNLEP |
Ga0334987_0374927_705_842 | 3300034061 | Freshwater | MKITDLFLSLALVALLGFAVAVTSGTFGGPSDLEMRVRASEPLNL |
Ga0334987_0480833_553_690 | 3300034061 | Freshwater | MKITDLFLSVALVLCLGVAIAVTSGKLGGPSDLEMRMRASEPFTR |
Ga0334995_0093829_1399_1533 | 3300034062 | Freshwater | MIRDLFLSIALLALIGFAIAVTSGAFGGPSDLEMRVRASEPLNL |
Ga0334995_0159497_1006_1149 | 3300034062 | Freshwater | MKITDLFLSVALLACLALAIAVTSGKLGGPSDLGMRVRASEPVRLQK |
Ga0335001_0001417_1908_2051 | 3300034064 | Freshwater | MKASDFFLALALVALLGIAIAVTSGAFGGPSDLEMRIRASEPLSLQK |
Ga0335001_0015324_1681_1821 | 3300034064 | Freshwater | MIRDLFLALALVALLGLAIAVTSGMFGGPSDIETRVRASEPLNLEP |
Ga0335001_0022670_3567_3692 | 3300034064 | Freshwater | FLALALVALLGFAIAVTSGAFGGPSDLEMRVRASEPLNLEP |
Ga0335019_0450741_3_122 | 3300034066 | Freshwater | ALALVALLALAIAVTSGKLGGPSDLEMRVRASEPLNLEP |
Ga0335020_0477058_487_594 | 3300034082 | Freshwater | LALLGFAIAVTSGKLGGPSDLEMRVRASEPVKLQK |
Ga0335010_0053108_2586_2723 | 3300034092 | Freshwater | MKASDLFLSVALLALLGFAVAVTSGVFGGPSDIEMRVRASEPFSR |
Ga0335010_0378987_2_157 | 3300034092 | Freshwater | TWKGGGMTLRDLFLAIALVLCLGIAVAVTSGKLGGPSDIEMRARASEPFAR |
Ga0335010_0488941_149_292 | 3300034092 | Freshwater | MKASDLFLALALVALLGIAVAVTSGAFGGPSDVEMRIRASEPLNLQK |
Ga0335012_0388039_145_285 | 3300034093 | Freshwater | MIRDLSLALALVLCLGFAVAVTSGTFGGPSDLETRLRASEPLNLEH |
Ga0335022_0453735_460_597 | 3300034095 | Freshwater | MKASDLFLALALVALLGLAIAITSGVLGGPSDIETRVRASEPFAR |
Ga0335027_0002865_4521_4661 | 3300034101 | Freshwater | MIRDLFLSLALLACLGLAIAITSGAFGGPSDIEMRVRASESLNLEP |
Ga0335029_0592007_84_227 | 3300034102 | Freshwater | LKAFDLYLSLALLALLGFAIAVTSGKLGGPSDIEMRIRASEPVNLKN |
Ga0335031_0020780_3338_3478 | 3300034104 | Freshwater | MIRETFLSLALLALLGLAIAITSGTFGGPSDIETRLRASEPLNLKN |
Ga0335031_0233195_3_122 | 3300034104 | Freshwater | MTFRDLFLALALVALLGIAIAICGGAWGPSDLEMRVRASE |
Ga0335031_0379619_443_586 | 3300034104 | Freshwater | LKTSDFFLTLALLALLGLAIAVTSGALGGPSDIEMRVRASEPLNLKN |
Ga0335031_0549768_369_509 | 3300034104 | Freshwater | MIRDLFLAIALVLCLGIAIAVTSGTFGGPSDLEMRVRASEPLNLEP |
Ga0335031_0727913_2_127 | 3300034104 | Freshwater | MKASNLFLSLALLALLGFAIAVTSGKLGGPSDLEMRVRASEP |
Ga0335035_0188288_162_302 | 3300034105 | Freshwater | MIRDLFLAVALVALIGFAIAVTSGTFGGPSDIEMRIRASEPLNLKY |
Ga0335036_0001650_14997_15134 | 3300034106 | Freshwater | MKASNLFLSLALLALLGFAIAVTSGKLGGPSDLEMRMRASEPFTR |
Ga0335036_0001717_4615_4758 | 3300034106 | Freshwater | MKLSNLFLALALVLCLALAIAVTSGAFGGPSDIETRVRASEPLNLQK |
Ga0335036_0337889_760_900 | 3300034106 | Freshwater | MIRDLFLALALVLCLGFAIAVTSGAFDGPSDIEMRMRASEPLNLEP |
Ga0335036_0547422_89_232 | 3300034106 | Freshwater | MKASNLFLFLALLALLGFAIAITSGALGGPSDIETRVRASEPLNLEP |
Ga0335036_0650333_75_209 | 3300034106 | Freshwater | MIRETFLSLALLALLGLAIAVTSGAFGGPSDLEMRVRASEPFTR |
Ga0335050_0049528_408_545 | 3300034108 | Freshwater | VKNYLLFFALVLCLGLAIAVTSGCFGGPSDIEMRVRASEPVNLKN |
Ga0335063_0578888_194_334 | 3300034111 | Freshwater | MIRDLFLCLALLALLGLAIAVTSGKLGGPSDLEMRVRASEPLRLQK |
Ga0335033_0028200_3032_3166 | 3300034117 | Freshwater | MIRETFLALALLALLGFAIAVTSGTFGGPSDIETRMRASEPFTR |
Ga0335054_0308213_1_105 | 3300034119 | Freshwater | MIRDLFLSLALLALLGFAVAVTSGAFGGPSDLEMR |
Ga0335056_0380662_551_691 | 3300034120 | Freshwater | MTFRDLFLALALVALLGIAIAICGGAWGPSDLEMRVRASEPLNLQK |
Ga0335058_0015734_2103_2240 | 3300034121 | Freshwater | MKDLFLCLALLALLGFAVAVTSGTFGGPSDIEMRMRASEPLNLEP |
Ga0335058_0064078_62_211 | 3300034121 | Freshwater | MIRDLFLSLALLALLALLGFAIAVTSGAFGGPSDLEMRMRASEPLNLEP |
Ga0335058_0367775_627_767 | 3300034121 | Freshwater | MIRETFLALALLALLGIAVAVTSGTFGGPSDLEMRMRASEPLNLEP |
Ga0335058_0801775_381_512 | 3300034121 | Freshwater | DLFLSLALLALLGIAVAVTSGTFGGPSDLEMRVRASEPVNLKP |
Ga0335060_0040649_1076_1210 | 3300034122 | Freshwater | MIRDLFLSLALLALLGFAVAVTSGAFGGPSDLEMRMRASEPLNL |
Ga0335060_0046101_2_139 | 3300034122 | Freshwater | MKITDLFLSLALLACLGLAIAITSGKLGGPSDLEMRMRASEPLNLE |
Ga0335052_0150121_781_921 | 3300034279 | Freshwater | MIRETFLAVALVLCLGLAIAVTSGTFGGPSDLEMRMRASEPLSLEP |
Ga0335052_0155804_1189_1329 | 3300034279 | Freshwater | MIRDLFLALALVALLALAITITSGAFGGLSDLEMRMRASEPLNLEP |
Ga0335052_0275835_15_149 | 3300034279 | Freshwater | MIRDLFLALALVALLALAITITSGAFGGLSDLEMRMRASEPLNL |
Ga0335052_0363581_3_113 | 3300034279 | Freshwater | MIRDLFLALALVALLALAITITSGAFGGLSDLEMRMR |
Ga0334997_0269829_179_313 | 3300034280 | Freshwater | MIRETFLAVALVALLGLAIAVTSGCFGDPSDIETRLRASEPLNL |
Ga0335007_0000976_16589_16732 | 3300034283 | Freshwater | MTLRDLFLALALVVLLGFAVAVTSGKLGGPSDIEMRVRASEPVNLKN |
Ga0335007_0017164_2774_2917 | 3300034283 | Freshwater | MKITDLFLSVALLACLALAIAITSGKLGGPSDLGMRVRASEPVRLQK |
Ga0335007_0086989_1_138 | 3300034283 | Freshwater | MKAFDLFLAIALVLCLGIAIAVTSGTFGGPSDLEMRVRASEPLNLE |
Ga0335048_0047686_1592_1732 | 3300034356 | Freshwater | MIRDLFLALALVALLGIAVAVTSGAFGGPSDLEMRMRASEPLNLEP |
⦗Top⦘ |