Metagenome Family F040429

Basic Information
Family ID	F040429
Family Type	Metagenome
Number of Sequences	161
Average Sequence Length	36 residues
Representative Sequence	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Number of Associated Samples	12
Number of Associated Scaffolds	161

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	10.56 %
% of genes near scaffold ends (potentially truncated)	85.71 %
% of genes from short scaffolds (< 2000 bps)	62.73 %
Associated GOLD sequencing projects	10
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Unclassified (62.112 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut (100.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.88% β-sheet: 0.00% Coil/Unstructured: 53.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 161 Family Scaffolds
PF03148	Tektin	0.62
PF06456	Arfaptin	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
All Organisms	root	All Organisms	37.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
cellular organisms	root	All Organisms → cellular organisms	37.27 %
Viruses	superkingdom	All Organisms → Viruses	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	37.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	31.68 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	4.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	26.71 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	26.71 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	4.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	26.71 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	25.47 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	4.35 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	1.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	25.47 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	4.35 %
Hemichordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata	0.62 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	25.47 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	4.35 %
Enteropneusta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta	0.62 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	25.47 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4.35 %
Harrimaniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae	0.62 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	24.22 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	4.35 %
Saccoglossus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus	0.62 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.62 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	24.22 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	4.35 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	0.62 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	24.22 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	4.35 %
Araneae	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae	0.62 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	22.98 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	4.35 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.62 %
Araneomorphae	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	22.98 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	4.35 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.62 %
Entelegynae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	22.98 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	4.35 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.62 %
Orbiculariae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	22.98 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	4.35 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.62 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	16.15 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	4.35 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	0.62 %
Araneidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	14.91 %
Sterculioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae	4.35 %
Araneus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus	0.62 %
Osteoglossocephala	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala	0.62 %
Phasmatodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	14.91 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Timematodea	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea	0.62 %
Osteoglossomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	12.42 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Blaberoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea	1.24 %
Timematoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	10.56 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Ectobiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae	1.24 %
Timematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Kalotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae	5.59 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	4.97 %
Blattellinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae	1.24 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Cryptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae	5.59 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	4.97 %
Blattella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella	1.24 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Cryptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes	5.59 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	4.97 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	1.24 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.11 %
Cryptotermes secundus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	5.59 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	4.35 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	4.97 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	1.24 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.62 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.62 %
Araneus ventricosus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	0.62 %
Saccoglossus kowalevskii	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	0.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002450\|JGI24695J34938_10281139	Not Available	714	Open in IMG/M
3300002507\|JGI24697J35500_10740732	Not Available	667	Open in IMG/M
3300002507\|JGI24697J35500_10871420	Not Available	778	Open in IMG/M
3300002507\|JGI24697J35500_10951540	Not Available	871	Open in IMG/M
3300002507\|JGI24697J35500_11163448	Not Available	1414	Open in IMG/M
3300002509\|JGI24699J35502_10874968	Not Available	997	Open in IMG/M
3300002509\|JGI24699J35502_10970166	Not Available	1233	Open in IMG/M
3300002552\|JGI24694J35173_10117714	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Hemichordata → Enteropneusta → Harrimaniidae → Saccoglossus → Saccoglossus kowalevskii	1285	Open in IMG/M
3300002552\|JGI24694J35173_10486168	Not Available	686	Open in IMG/M
3300002552\|JGI24694J35173_10662792	Not Available	589	Open in IMG/M
3300009784\|Ga0123357_10036177	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6719	Open in IMG/M
3300009784\|Ga0123357_10046109	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	5912	Open in IMG/M
3300009784\|Ga0123357_10054363	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	5398	Open in IMG/M
3300009784\|Ga0123357_10066413	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4811	Open in IMG/M
3300009784\|Ga0123357_10083048	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	4205	Open in IMG/M
3300009784\|Ga0123357_10128321	Not Available	3168	Open in IMG/M
3300009784\|Ga0123357_10128770	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	3160	Open in IMG/M
3300009784\|Ga0123357_10146987	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	2875	Open in IMG/M
3300009784\|Ga0123357_10184373	Not Available	2426	Open in IMG/M
3300009784\|Ga0123357_10226497	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Araneidae → Araneus → Araneus ventricosus	2060	Open in IMG/M
3300009784\|Ga0123357_10255646	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1863	Open in IMG/M
3300009784\|Ga0123357_10289120	Not Available	1678	Open in IMG/M
3300009784\|Ga0123357_10297184	Not Available	1638	Open in IMG/M
3300009784\|Ga0123357_10308592	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1584	Open in IMG/M
3300009784\|Ga0123357_10313625	Not Available	1562	Open in IMG/M
3300009784\|Ga0123357_10322806	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1522	Open in IMG/M
3300009784\|Ga0123357_10346326	All Organisms → Viruses → Predicted Viral	1429	Open in IMG/M
3300009784\|Ga0123357_10366156	Not Available	1358	Open in IMG/M
3300009784\|Ga0123357_10377938	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1319	Open in IMG/M
3300009784\|Ga0123357_10423056	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1186	Open in IMG/M
3300009784\|Ga0123357_10485816	Not Available	1039	Open in IMG/M
3300009784\|Ga0123357_10492605	Not Available	1025	Open in IMG/M
3300009784\|Ga0123357_10603275	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	841	Open in IMG/M
3300009784\|Ga0123357_10642026	Not Available	791	Open in IMG/M
3300009784\|Ga0123357_10680374	All Organisms → cellular organisms → Eukaryota → Opisthokonta	747	Open in IMG/M
3300009784\|Ga0123357_10718085	Not Available	709	Open in IMG/M
3300009784\|Ga0123357_10790444	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	645	Open in IMG/M
3300009784\|Ga0123357_10901509	Not Available	571	Open in IMG/M
3300009784\|Ga0123357_10906138	Not Available	568	Open in IMG/M
3300009784\|Ga0123357_10964360	Not Available	537	Open in IMG/M
3300009784\|Ga0123357_10976555	Not Available	531	Open in IMG/M
3300009826\|Ga0123355_10072780	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	5511	Open in IMG/M
3300009826\|Ga0123355_10085421	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	5022	Open in IMG/M
3300009826\|Ga0123355_10115629	All Organisms → cellular organisms → Eukaryota	4177	Open in IMG/M
3300009826\|Ga0123355_10138811	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3726	Open in IMG/M
3300009826\|Ga0123355_10169800	Not Available	3263	Open in IMG/M
3300009826\|Ga0123355_10180292	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3136	Open in IMG/M
3300009826\|Ga0123355_10188055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	3049	Open in IMG/M
3300009826\|Ga0123355_10193203	Not Available	2992	Open in IMG/M
3300009826\|Ga0123355_10250086	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2497	Open in IMG/M
3300009826\|Ga0123355_10296522	Not Available	2210	Open in IMG/M
3300009826\|Ga0123355_10296978	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2208	Open in IMG/M
3300009826\|Ga0123355_10305428	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2163	Open in IMG/M
3300009826\|Ga0123355_10446801	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1632	Open in IMG/M
3300009826\|Ga0123355_10515802	Not Available	1465	Open in IMG/M
3300009826\|Ga0123355_10669214	Not Available	1204	Open in IMG/M
3300009826\|Ga0123355_10778020	Not Available	1074	Open in IMG/M
3300009826\|Ga0123355_11156179	Not Available	797	Open in IMG/M
3300009826\|Ga0123355_11281204	Not Available	738	Open in IMG/M
3300009826\|Ga0123355_11523736	Not Available	650	Open in IMG/M
3300009826\|Ga0123355_11736997	Not Available	592	Open in IMG/M
3300009826\|Ga0123355_11768916	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	585	Open in IMG/M
3300009826\|Ga0123355_11993041	Not Available	539	Open in IMG/M
3300009826\|Ga0123355_12114517	Not Available	517	Open in IMG/M
3300010049\|Ga0123356_10999912	Not Available	1006	Open in IMG/M
3300010049\|Ga0123356_11254566	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	906	Open in IMG/M
3300010049\|Ga0123356_11372808	Not Available	868	Open in IMG/M
3300010049\|Ga0123356_11697635	Not Available	783	Open in IMG/M
3300010049\|Ga0123356_11758178	Not Available	770	Open in IMG/M
3300010049\|Ga0123356_11796405	Not Available	762	Open in IMG/M
3300010049\|Ga0123356_11923980	Not Available	737	Open in IMG/M
3300010049\|Ga0123356_12424763	Not Available	656	Open in IMG/M
3300010049\|Ga0123356_13804102	Not Available	521	Open in IMG/M
3300010162\|Ga0131853_10012903	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	15313	Open in IMG/M
3300010162\|Ga0131853_10016010	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	13697	Open in IMG/M
3300010162\|Ga0131853_10035627	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8767	Open in IMG/M
3300010162\|Ga0131853_10055123	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6623	Open in IMG/M
3300010162\|Ga0131853_10058473	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	6365	Open in IMG/M
3300010162\|Ga0131853_10070072	Not Available	5609	Open in IMG/M
3300010162\|Ga0131853_10106549	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	4092	Open in IMG/M
3300010162\|Ga0131853_10116774	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	3804	Open in IMG/M
3300010162\|Ga0131853_10130924	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	3465	Open in IMG/M
3300010162\|Ga0131853_10132735	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	3425	Open in IMG/M
3300010162\|Ga0131853_10132784	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	3424	Open in IMG/M
3300010162\|Ga0131853_10208172	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2327	Open in IMG/M
3300010162\|Ga0131853_10458352	Not Available	1180	Open in IMG/M
3300010162\|Ga0131853_10594857	Not Available	955	Open in IMG/M
3300010162\|Ga0131853_10683915	Not Available	855	Open in IMG/M
3300010162\|Ga0131853_11141180	All Organisms → cellular organisms → Eukaryota → Opisthokonta	588	Open in IMG/M
3300010162\|Ga0131853_11186953	Not Available	572	Open in IMG/M
3300010167\|Ga0123353_10013893	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	11571	Open in IMG/M
3300010167\|Ga0123353_10022445	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	9518	Open in IMG/M
3300010167\|Ga0123353_10039246	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	7451	Open in IMG/M
3300010167\|Ga0123353_10047136	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	6852	Open in IMG/M
3300010167\|Ga0123353_10128167	Not Available	4075	Open in IMG/M
3300010167\|Ga0123353_10184893	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	3296	Open in IMG/M
3300010167\|Ga0123353_10189122	Not Available	3252	Open in IMG/M
3300010167\|Ga0123353_10219149	Not Available	2977	Open in IMG/M
3300010167\|Ga0123353_10410339	Not Available	2011	Open in IMG/M
3300010167\|Ga0123353_10416859	Not Available	1991	Open in IMG/M
3300010167\|Ga0123353_10528484	Not Available	1709	Open in IMG/M
3300010167\|Ga0123353_10577619	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	1614	Open in IMG/M
3300010167\|Ga0123353_10597076	Not Available	1579	Open in IMG/M
3300010167\|Ga0123353_10640555	Not Available	1507	Open in IMG/M
3300010167\|Ga0123353_10715132	Not Available	1402	Open in IMG/M
3300010167\|Ga0123353_10936728	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1174	Open in IMG/M
3300010167\|Ga0123353_11308900	Not Available	940	Open in IMG/M
3300010167\|Ga0123353_11315927	Not Available	937	Open in IMG/M
3300010167\|Ga0123353_11481474	Not Available	866	Open in IMG/M
3300010167\|Ga0123353_11525111	Not Available	849	Open in IMG/M
3300010167\|Ga0123353_12073781	Not Available	693	Open in IMG/M
3300010167\|Ga0123353_12487025	Not Available	616	Open in IMG/M
3300010167\|Ga0123353_13314214	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	513	Open in IMG/M
3300010167\|Ga0123353_13319493	Not Available	513	Open in IMG/M
3300010369\|Ga0136643_10006312	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	16949	Open in IMG/M
3300010369\|Ga0136643_10035765	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	7417	Open in IMG/M
3300010369\|Ga0136643_10045414	Not Available	6435	Open in IMG/M
3300010369\|Ga0136643_10057075	Not Available	5559	Open in IMG/M
3300010369\|Ga0136643_10080297	Not Available	4392	Open in IMG/M
3300010369\|Ga0136643_10081187	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	4359	Open in IMG/M
3300010369\|Ga0136643_10126575	Not Available	3084	Open in IMG/M
3300010369\|Ga0136643_10174364	Not Available	2332	Open in IMG/M
3300010369\|Ga0136643_10183823	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	2219	Open in IMG/M
3300010369\|Ga0136643_10215452	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	1910	Open in IMG/M
3300010369\|Ga0136643_10339779	Not Available	1212	Open in IMG/M
3300010369\|Ga0136643_10364126	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1130	Open in IMG/M
3300010369\|Ga0136643_10406631	Not Available	1011	Open in IMG/M
3300010369\|Ga0136643_10475970	Not Available	865	Open in IMG/M
3300010369\|Ga0136643_10521289	Not Available	793	Open in IMG/M
3300010369\|Ga0136643_10662516	Not Available	639	Open in IMG/M
3300010369\|Ga0136643_10767509	Not Available	568	Open in IMG/M
3300010882\|Ga0123354_10022394	All Organisms → cellular organisms → Eukaryota	9962	Open in IMG/M
3300010882\|Ga0123354_10049794	Not Available	6349	Open in IMG/M
3300010882\|Ga0123354_10069536	Not Available	5104	Open in IMG/M
3300010882\|Ga0123354_10116304	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	3489	Open in IMG/M
3300010882\|Ga0123354_10126454	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3261	Open in IMG/M
3300010882\|Ga0123354_10162878	Not Available	2637	Open in IMG/M
3300010882\|Ga0123354_10276713	Not Available	1639	Open in IMG/M
3300010882\|Ga0123354_10290128	Not Available	1570	Open in IMG/M
3300010882\|Ga0123354_10320780	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	1430	Open in IMG/M
3300010882\|Ga0123354_10460535	Not Available	1022	Open in IMG/M
3300027864\|Ga0209755_10054420	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4059	Open in IMG/M
3300027864\|Ga0209755_10155246	Not Available	2310	Open in IMG/M
3300027864\|Ga0209755_10348091	Not Available	1411	Open in IMG/M
3300027864\|Ga0209755_10506659	Not Available	1086	Open in IMG/M
3300027864\|Ga0209755_10507567	Not Available	1085	Open in IMG/M
3300027864\|Ga0209755_10531495	Not Available	1049	Open in IMG/M
3300027864\|Ga0209755_10553004	Not Available	1019	Open in IMG/M
3300027864\|Ga0209755_10555205	Not Available	1016	Open in IMG/M
3300027864\|Ga0209755_10586863	Not Available	975	Open in IMG/M
3300027864\|Ga0209755_10692826	Not Available	857	Open in IMG/M
3300027864\|Ga0209755_10711781	Not Available	838	Open in IMG/M
3300027864\|Ga0209755_10763462	Not Available	790	Open in IMG/M
3300027864\|Ga0209755_10770650	Not Available	784	Open in IMG/M
3300027864\|Ga0209755_10773695	Not Available	781	Open in IMG/M
3300027864\|Ga0209755_10863286	Not Available	710	Open in IMG/M
3300027864\|Ga0209755_10887128	Not Available	693	Open in IMG/M
3300027864\|Ga0209755_10969146	Not Available	640	Open in IMG/M
3300027864\|Ga0209755_11061276	Not Available	587	Open in IMG/M
3300027864\|Ga0209755_11125431	Not Available	554	Open in IMG/M
3300027864\|Ga0209755_11128048	Not Available	553	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F040429

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002450	Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3	Host-Associated	Open in IMG/M
3300002507	Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1	Host-Associated	Open in IMG/M
3300002509	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4	Host-Associated	Open in IMG/M
3300002552	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1	Host-Associated	Open in IMG/M
3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Host-Associated	Open in IMG/M
3300010369	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)	Host-Associated	Open in IMG/M
3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Host-Associated	Open in IMG/M
3300027864	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes)	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24695J34938_102811392	3300002450	Termite Gut	LRNFHEYVFYSGNILWRKIFVNVSKNSDPDVGLRKLQYATKFH*
JGI24697J35500_107407322	3300002507	Termite Gut	IFYSGNILRRIIFVNVSKSSDPDVGLRKLKYAIRFHYSSD*
JGI24697J35500_108714202	3300002507	Termite Gut	MFYSGNILRRKTFVNVSKNIDPDAALRKLQHATRFHESSD*
JGI24697J35500_109515403	3300002507	Termite Gut	EPKIFYSGNILRRKIFVNVSKNSDPDAGLGKLQYATRFH*
JGI24697J35500_111634481	3300002507	Termite Gut	MKKMFSGGNILRRKIFVNVSKNSDPDVGLRKLQYGTRFH*
JGI24699J35502_108749681	3300002509	Termite Gut	NFHEKMFYGGNVLRRKIFVNVSKNSDPDAGVRELQYATRFH*
JGI24699J35502_109701661	3300002509	Termite Gut	MFYTGNIPRRKIFVNVSKSSDPDVDMRKLQYATRFHLSSD*
JGI24694J35173_101177141	3300002552	Termite Gut	MFYSGNILRRKIFVIVSKNSDPDVGLRKLQYATKIHYSSD*
JGI24694J35173_104861681	3300002552	Termite Gut	MFYSGNILRGKIFVNVSKNSEPDVGLRKLQYGYKISLVQ*
JGI24694J35173_106627922	3300002552	Termite Gut	MFYGGNILKRKIFVNVSKNSDPDAGLRKLQYATRFPYSSD*
Ga0123357_100361772	3300009784	Termite Gut	MFYSGNILRIKIFVNVSKNSDLDVGLRKLQYAVRFHESSD*
Ga0123357_100461091	3300009784	Termite Gut	MFYSGNILRRIIFVNVSKNSDPDVGLRKLSCVARFY*
Ga0123357_100543634	3300009784	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123357_100664134	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLENAARIH*
Ga0123357_100830484	3300009784	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFL*
Ga0123357_101283212	3300009784	Termite Gut	YSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123357_101287704	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYAARFH
Ga0123357_101469871	3300009784	Termite Gut	MYYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123357_101843731	3300009784	Termite Gut	SGNILRRKIFVNVSKNSEPDVGLRKLQYATRFHYSSD*
Ga0123357_102264972	3300009784	Termite Gut	MFYSGNILRRIIFVNVLKNSDPDVGLRKLQYATDF
Ga0123357_102556461	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYVTRFH
Ga0123357_102891201	3300009784	Termite Gut	MFYSGNILRRIIFVNVSKNSDPDVGLRKLQYATRF
Ga0123357_102971841	3300009784	Termite Gut	IFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATGFH*
Ga0123357_103085921	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLKYATRFH
Ga0123357_103136251	3300009784	Termite Gut	MFYGGNVPRRIIFVNVSKNSDPDVGLRKLKYATRLH*
Ga0123357_103228061	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYVTRFH*
Ga0123357_103463263	3300009784	Termite Gut	YSGNILRRKIFMNVSKNSDPDVGLRKLQYATKFH*
Ga0123357_103661561	3300009784	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYVTRFHLSSD*
Ga0123357_103779381	3300009784	Termite Gut	MFYSGNIQRRKIFVNVSKNSDPDVGLRKLQYATIFH
Ga0123357_104230561	3300009784	Termite Gut	MFHSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123357_104858162	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKSSDPDVGLRKLQYATRFH
Ga0123357_104926051	3300009784	Termite Gut	MFCSGNVMSGKIFVNALKNSDPDVDLRKGKYAARFH*
Ga0123357_106032751	3300009784	Termite Gut	MLYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0123357_106420261	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKISDPDVGLRKLQYATRFH*
Ga0123357_106803742	3300009784	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLKYAARFH*
Ga0123357_107180851	3300009784	Termite Gut	YSGNIMGRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123357_107904441	3300009784	Termite Gut	NFHEQMFYSGNILRRKIFVNVSKNSDPDVDLRKLQYATRFH*
Ga0123357_109015091	3300009784	Termite Gut	VFYIGNILRRKIFVNVSKNSDPDVGLRKLQYATRLIT
Ga0123357_109061381	3300009784	Termite Gut	YSGNILRRKIFVNVSKNSDPDVGLRKLKYATRFH*
Ga0123357_109643601	3300009784	Termite Gut	MFYSGNILKRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0123357_109765551	3300009784	Termite Gut	MFYSGNILRRIIFVNVSKNSDPDVGLRKLQYATRFH
Ga0123355_100727807	3300009826	Termite Gut	VCVVFYSGNILWRKIFVNVSENSDPDVGLRELQYATRFH*
Ga0123355_100854211	3300009826	Termite Gut	MFYGGNVLRRTIFVNASKNSDPNVGLRKLKYATRFH*
Ga0123355_101156291	3300009826	Termite Gut	MFYSGNILRRKIFVNVSKSSDPDVGLRKLQYAPRFHY
Ga0123355_101388111	3300009826	Termite Gut	MFYIGNILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123355_101698001	3300009826	Termite Gut	MFSSGNILRRKIFVNVSKNSDPDVGLRKLQYATIFH*
Ga0123355_101802923	3300009826	Termite Gut	MVYSGSVLRRKIFVNVSKNSDPDVGLRKLQYATRLH*
Ga0123355_101880551	3300009826	Termite Gut	MFYSGNVLRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123355_101932033	3300009826	Termite Gut	MFYSGNILKTKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123355_102500861	3300009826	Termite Gut	NFHEKIFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFHKSSD*
Ga0123355_102965222	3300009826	Termite Gut	MFCSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0123355_102969784	3300009826	Termite Gut	EKMFYGGNILRRKIFVNVLKNSDPDVGLRKLQYATRFY*
Ga0123355_103054282	3300009826	Termite Gut	FYSGNILRRIIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123355_104468011	3300009826	Termite Gut	MFYSGNILRRIIFMNVSKNSDPDVGLRKLQYATRFH
Ga0123355_105158021	3300009826	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYVTRFHL
Ga0123355_106692141	3300009826	Termite Gut	HSGNILRRKIFVNVSKNSDPDVGQRKLQYATRFH*
Ga0123355_107780201	3300009826	Termite Gut	MFYIGNIVRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123355_111561791	3300009826	Termite Gut	MFYSGNILRRRIFVNVSKNSDPDVGLRKLQYATRF
Ga0123355_112812041	3300009826	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDIGLRKLQYATRFH*
Ga0123355_115237361	3300009826	Termite Gut	FYSGNILRRKIFVNVSKNSDPDAGLRKLQYATRFH*
Ga0123355_117369971	3300009826	Termite Gut	MFYSGNILRRIIFVNVSKSSDPDVGLRKLQYATRF
Ga0123355_117689161	3300009826	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDAGLRKLQYATRFH
Ga0123355_119930411	3300009826	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYAARFH*
Ga0123355_121145171	3300009826	Termite Gut	YSGNILRRKIFVNVSINSDPDVGLRKLKYATIFH*
Ga0123356_109999121	3300010049	Termite Gut	MFYSGDILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123356_112545661	3300010049	Termite Gut	MFYSGNILRRKVFVNVSKNSDPDVGLRKLQYATRF
Ga0123356_113728081	3300010049	Termite Gut	MFYSGNILRGKIFVIVSKNSDPDVGLRKLQYAARF
Ga0123356_116976351	3300010049	Termite Gut	FYSGNIPRRKIFVNVSKNSDPDFGVRKLQYATRFH*
Ga0123356_117581781	3300010049	Termite Gut	MFYSGNILRRKIFVNVSKNSDQDVGLRKLQYATRFH
Ga0123356_117964051	3300010049	Termite Gut	MFYSGDILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123356_119239801	3300010049	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYAARFH*
Ga0123356_124247631	3300010049	Termite Gut	MFYSGNIMGRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0123356_138041021	3300010049	Termite Gut	YSGNILRRKIFVNVSKNSDPYVGLRKLQYATRFH*
Ga0131853_1001290311	3300010162	Termite Gut	MFYGGNILRRKIFVNVSKISDPDAGLRELKYATRFY*
Ga0131853_100160101	3300010162	Termite Gut	MFYNGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0131853_100356271	3300010162	Termite Gut	MFYSGNIPRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0131853_100551233	3300010162	Termite Gut	MFYSGDVLRRIIFVHMSKNSDPDVGMRKLKYATRFH*
Ga0131853_100584736	3300010162	Termite Gut	MFYCGNILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0131853_100700723	3300010162	Termite Gut	MLYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0131853_101065491	3300010162	Termite Gut	MFYSGNILRRKTFVNVSKNSDPDVGLRKLQYATRFH
Ga0131853_101167741	3300010162	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFHYSSD*
Ga0131853_101309241	3300010162	Termite Gut	YSGNILRRKIFVNVSKNSDPDVGLSKLQYATRFH*
Ga0131853_101327351	3300010162	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLMKLQYATRFH*
Ga0131853_101327842	3300010162	Termite Gut	MFYSGNILRRKIFMNVSKNSDPDVGLRKLQYATRF
Ga0131853_102081721	3300010162	Termite Gut	YSGNILRRKIFVNMSKNSDPDVGLRKLQYATRFH*
Ga0131853_104583521	3300010162	Termite Gut	MFYSGNILRRKIFANVSKNSDPDVGLRKLQYATRFH
Ga0131853_105948571	3300010162	Termite Gut	FYSGNILRRKIFVNVSKSSDPDVGLRKLQYATRFH*
Ga0131853_106839151	3300010162	Termite Gut	MFYSGNILRRKIFVNVSKYSDPDIGLRKLQYATRFH*
Ga0131853_111411801	3300010162	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDFGLRKLQYATIF
Ga0131853_111869531	3300010162	Termite Gut	MFYSGNILRRKIFVNVSKNSDPYVGLRKLQYATRF
Ga0123353_100138931	3300010167	Termite Gut	MFYSGNILRRKIFVNVPKNSDPDVGLRKLQYATRF
Ga0123353_100224451	3300010167	Termite Gut	MFYCGNILRRKIFVNVSENSDPDVGLRKLQYATIY
Ga0123353_100392461	3300010167	Termite Gut	MFYSGNILKRKIFVNVSKNSDPDVGLRKLKYATRF
Ga0123353_100471361	3300010167	Termite Gut	MFYIGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123353_101281671	3300010167	Termite Gut	MFYSGNILRRKIFVNVSKNSDPYVGLRKLQYATRFH*
Ga0123353_101848936	3300010167	Termite Gut	MNKYFYSGNILRRIIFVNVSKNSDPDVGLRKLQYATRF
Ga0123353_101891221	3300010167	Termite Gut	MFYSGNILRRKTFVNVSKNSDPDVGLRKLQYATTFH
Ga0123353_102191491	3300010167	Termite Gut	MFYSGNILGRKIFVNLSKNSDPDVGLRKLQYATRFH
Ga0123353_104103392	3300010167	Termite Gut	YEQIFYSGNILRRKIFVNVSKNSDPDVGLRKLQYSTRFH*
Ga0123353_104168591	3300010167	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLSKLQYATRF
Ga0123353_105284844	3300010167	Termite Gut	FYSGNILKRKIFVKVSKNSDPDVGVRKLQYATRFH*
Ga0123353_105776192	3300010167	Termite Gut	FYSGNILRRKILVNVSKNSDPDVGLRKLQYATRFV*
Ga0123353_105970761	3300010167	Termite Gut	MFYSGNILRSKIFINVLKNSDPDVGLRKLQYATRFH*
Ga0123353_106405552	3300010167	Termite Gut	MFYSGNILRRKIFVNVSRNSDPDAGLRKLQYATRFH
Ga0123353_107151321	3300010167	Termite Gut	MFYSGNILRRKIFVNVSKSSDPDVGLRKLQYATRF
Ga0123353_109367282	3300010167	Termite Gut	MFYSGNIPRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123353_113089001	3300010167	Termite Gut	YGGNILRRKIFVNVSKKSDPDVGLRKLQYATRFH*
Ga0123353_113159271	3300010167	Termite Gut	YSGNILRRKIFMNVSKNSDPDVGLRKLQYATRFHKYSD*
Ga0123353_114814742	3300010167	Termite Gut	MFYSENILRRKIFVNVSKNSDPDVGLRKLKYAAKFN*
Ga0123353_115251111	3300010167	Termite Gut	MFYSGNILRGKIFVNVSKNSDPDVGLRKLQYATRF
Ga0123353_120737811	3300010167	Termite Gut	FYSGNILRGRIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0123353_124870251	3300010167	Termite Gut	MFYSGNILRRKMFVNVSKNSDPDVGLRKLQYATRF
Ga0123353_133142142	3300010167	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKVQYATRFH
Ga0123353_133194931	3300010167	Termite Gut	MNKFFFYSGNILRRKIFVNVSKNSDPDVGLRKLQYAT
Ga0136643_100063121	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATIF
Ga0136643_100357655	3300010369	Termite Gut	MFYSGNILKRKIFVNVTKDSDPDVGLRKPKNATRSN
Ga0136643_100454141	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLKYATRF
Ga0136643_100570759	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKKSDPDVDLRKLQYATRF
Ga0136643_100802971	3300010369	Termite Gut	IFHSGNILRRKIFVNVSKNSDPDAGLRKLQYATRFHYSSD*
Ga0136643_100811871	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLSKLQYATRFH*
Ga0136643_101265753	3300010369	Termite Gut	MFYGGNILRRKIFVNVLKNSGPDVGLRKLQYATRFH*
Ga0136643_101743641	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKISDPDVGLRKLKYATRFN*
Ga0136643_101838231	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKNSEPDVGLRKLQYATRFH
Ga0136643_102154521	3300010369	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVDLRKLQYATRF
Ga0136643_103397793	3300010369	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQYATKFH*
Ga0136643_103641261	3300010369	Termite Gut	FYSGNILRRKIFVNVSKNSNPDADLRKLQYATRFH*
Ga0136643_104066311	3300010369	Termite Gut	MFYSGNILGRKIFVNVSKNSDPDVGLRKLQYATRFYE
Ga0136643_104759701	3300010369	Termite Gut	YSGNILRRKIFVNVSKNSDPDVGLRKLEYATRFH*
Ga0136643_105212891	3300010369	Termite Gut	MFYSGNILGRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0136643_106625161	3300010369	Termite Gut	LYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH*
Ga0136643_107675091	3300010369	Termite Gut	FYSGNILRRKIFMNVSKNSDPDVGLRKLQYATRFH*
Ga0123354_100223941	3300010882	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVDLRKLQYATRFH
Ga0123354_100497943	3300010882	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATGF
Ga0123354_100695363	3300010882	Termite Gut	MFYNGNILRRTIFVNVSKNSDPDVGLRKLKYAARFH*
Ga0123354_101163041	3300010882	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYGTRF
Ga0123354_101264544	3300010882	Termite Gut	FYSGNILRRKIFVNVSKNTDPDVGLRKLQYATRFH*
Ga0123354_101628781	3300010882	Termite Gut	MFYSGNIPRRKIFVNVSKNSDPDVGVRKLKYATRFH*
Ga0123354_102767131	3300010882	Termite Gut	MFHSGNILRRKIFVNVSKNSDPDVALRKLQNATRF
Ga0123354_102901281	3300010882	Termite Gut	MFYSGNIPRRKIFVNVSKISDPDVGLRKLQYSKRFH*
Ga0123354_103207802	3300010882	Termite Gut	FYSGNILRRKILVNVSKNSDPDVGLRKLQYATRFL*
Ga0123354_104605351	3300010882	Termite Gut	MFYSGYILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0209755_100544208	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0209755_101552461	3300027864	Termite Gut	MFYSGNILSRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0209755_103480911	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSHPDVGLRKLQYATRFL
Ga0209755_105066591	3300027864	Termite Gut	KYSGNILRRKIFVNVSKKNSDPDVGLRKLQYATRFH
Ga0209755_105075671	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDAGLRKLRYATKF
Ga0209755_105314951	3300027864	Termite Gut	NILRKKIFVNVSNNSDPDVGLRKLQYATRFHLSSD
Ga0209755_105530041	3300027864	Termite Gut	IFYDGNIRRSIIFVNVSKSSDPDVGLRKLQYATRFH
Ga0209755_105552051	3300027864	Termite Gut	MFYTGNILRRKIFVNVSKNSDPDVGLRKLQYATRF
Ga0209755_105868631	3300027864	Termite Gut	YIIIINIILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0209755_106928261	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDSDAGLRKLQYATIF
Ga0209755_107117811	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLSKLQYATRFH
Ga0209755_107634621	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDSDAGLRKLQYATRFH
Ga0209755_107706501	3300027864	Termite Gut	MFYTGNILRRKIFVNVSKNSDPDVGVRKLQCATIFH
Ga0209755_107736951	3300027864	Termite Gut	MFYIGNILRRKIFVNVSKNSDPDAGLKKLQYATRFH
Ga0209755_108632861	3300027864	Termite Gut	YMIYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0209755_108871281	3300027864	Termite Gut	FYSGNILRRKIFVNVSKNSDPPDVGLRKLQNATRFH
Ga0209755_109691461	3300027864	Termite Gut	MFYSGNILRRKIFVNVSKNSDPDVGLRKLQYATRFH
Ga0209755_110612762	3300027864	Termite Gut	MFYSGNVLRRKIFVNVSKNSDPDVDLRKLKYATRFY
Ga0209755_111254311	3300027864	Termite Gut	FYSGNILRRKIFVNVSKNSDPDVGLRKLQHATRFH
Ga0209755_111280481	3300027864	Termite Gut	MFYGGNILRRKIFVNVSRNSDPDVGLRKLKYATGFH

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign