NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040443

Metagenome / Metatranscriptome Family F040443

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040443
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 65 residues
Representative Sequence MKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS
Number of Associated Samples 115
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 71.43 %
% of genes near scaffold ends (potentially truncated) 27.33 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (85.714 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(60.870 % of family members)
Environment Ontology (ENVO) Unclassified
(83.230 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(72.671 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.35%    Coil/Unstructured: 70.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF10536PMD 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.71 %
UnclassifiedrootN/A14.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_100803325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum850Open in IMG/M
3300005335|Ga0070666_10276234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1193Open in IMG/M
3300005347|Ga0070668_101759170Not Available570Open in IMG/M
3300005347|Ga0070668_101977086Not Available537Open in IMG/M
3300005355|Ga0070671_100342978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1274Open in IMG/M
3300005618|Ga0068864_100675114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1007Open in IMG/M
3300005841|Ga0068863_100858958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum906Open in IMG/M
3300005842|Ga0068858_100561350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1105Open in IMG/M
3300005843|Ga0068860_101271394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300005843|Ga0068860_101501369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300009092|Ga0105250_10379043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300009553|Ga0105249_12383268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300009973|Ga0105136_104758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum742Open in IMG/M
3300009980|Ga0105135_101298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1231Open in IMG/M
3300009981|Ga0105133_102306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1037Open in IMG/M
3300009989|Ga0105131_121350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300009990|Ga0105132_122095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
3300009992|Ga0105120_1004898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1145Open in IMG/M
3300009992|Ga0105120_1006823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1032Open in IMG/M
3300009992|Ga0105120_1044445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300009992|Ga0105120_1044852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300009994|Ga0105126_1014411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum798Open in IMG/M
3300009995|Ga0105139_1123895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300010371|Ga0134125_12697160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300010397|Ga0134124_11767925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300010399|Ga0134127_11988309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300010400|Ga0134122_11895526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300010401|Ga0134121_11453176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum699Open in IMG/M
3300014326|Ga0157380_11889264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300014968|Ga0157379_10549892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1074Open in IMG/M
3300015280|Ga0182100_1035928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015280|Ga0182100_1078403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015284|Ga0182101_1041478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300015290|Ga0182105_1045452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300015301|Ga0182184_1096667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015306|Ga0182180_1018822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum903Open in IMG/M
3300015309|Ga0182098_1127961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300015309|Ga0182098_1128128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015311|Ga0182182_1065419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum630Open in IMG/M
3300015311|Ga0182182_1078516Not Available592Open in IMG/M
3300015311|Ga0182182_1120631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015311|Ga0182182_1122347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300015312|Ga0182168_1018875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1001Open in IMG/M
3300015312|Ga0182168_1105222Not Available558Open in IMG/M
3300015312|Ga0182168_1114615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015313|Ga0182164_1020579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum975Open in IMG/M
3300015313|Ga0182164_1073856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum639Open in IMG/M
3300015313|Ga0182164_1096342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300015315|Ga0182120_1090017Not Available597Open in IMG/M
3300015315|Ga0182120_1091264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015316|Ga0182121_1058669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300015316|Ga0182121_1071204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum672Open in IMG/M
3300015318|Ga0182181_1099470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015319|Ga0182130_1007803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1249Open in IMG/M
3300015319|Ga0182130_1068319Not Available650Open in IMG/M
3300015320|Ga0182165_1129994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015324|Ga0182134_1059269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300015326|Ga0182166_1098384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015326|Ga0182166_1103985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300015326|Ga0182166_1143132Not Available505Open in IMG/M
3300015327|Ga0182114_1098086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300015328|Ga0182153_1086348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300015328|Ga0182153_1104778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300015329|Ga0182135_1100755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015330|Ga0182152_1012752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1191Open in IMG/M
3300015330|Ga0182152_1102124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300015331|Ga0182131_1030712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum912Open in IMG/M
3300015331|Ga0182131_1048567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum783Open in IMG/M
3300015331|Ga0182131_1070799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum686Open in IMG/M
3300015331|Ga0182131_1109715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300015331|Ga0182131_1117571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015332|Ga0182117_1023857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1061Open in IMG/M
3300015332|Ga0182117_1051302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum816Open in IMG/M
3300015332|Ga0182117_1107821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300015332|Ga0182117_1169274Not Available502Open in IMG/M
3300015333|Ga0182147_1159505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015334|Ga0182132_1052351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum800Open in IMG/M
3300015334|Ga0182132_1114463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015335|Ga0182116_1122744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300015338|Ga0182137_1108200Not Available626Open in IMG/M
3300015340|Ga0182133_1070999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum760Open in IMG/M
3300015340|Ga0182133_1150262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015340|Ga0182133_1169472Not Available531Open in IMG/M
3300015349|Ga0182185_1246044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015350|Ga0182163_1156386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300015353|Ga0182179_1253306Not Available568Open in IMG/M
3300015353|Ga0182179_1280236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015354|Ga0182167_1262231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300015354|Ga0182167_1288145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015354|Ga0182167_1329167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300017408|Ga0182197_1149468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300017412|Ga0182199_1167341Not Available545Open in IMG/M
3300017412|Ga0182199_1169254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300017412|Ga0182199_1201521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300017414|Ga0182195_1012890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1359Open in IMG/M
3300017414|Ga0182195_1124959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
3300017414|Ga0182195_1195549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300017422|Ga0182201_1104751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300017432|Ga0182196_1066330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300017432|Ga0182196_1100334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300017432|Ga0182196_1136754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300017439|Ga0182200_1051509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum751Open in IMG/M
3300017439|Ga0182200_1130841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300017440|Ga0182214_1024271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1179Open in IMG/M
3300017445|Ga0182198_1164846Not Available547Open in IMG/M
3300017447|Ga0182215_1065267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum786Open in IMG/M
3300017447|Ga0182215_1104135Not Available634Open in IMG/M
3300017692|Ga0182210_1105629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300017693|Ga0182216_1221795Not Available504Open in IMG/M
3300017792|Ga0163161_11619431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300020031|Ga0182119_101699Not Available766Open in IMG/M
3300020223|Ga0182118_103090Not Available796Open in IMG/M
3300025903|Ga0207680_10902811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300025923|Ga0207681_11489039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300025925|Ga0207650_10632252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum902Open in IMG/M
3300025931|Ga0207644_10657337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum873Open in IMG/M
3300026088|Ga0207641_11852687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300026088|Ga0207641_12516185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300028049|Ga0268322_1032277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300028050|Ga0268328_1062833Not Available528Open in IMG/M
3300028052|Ga0268300_1010573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300028054|Ga0268306_1018875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300028058|Ga0268332_1015871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum868Open in IMG/M
3300028058|Ga0268332_1075573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300028061|Ga0268314_1018600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum732Open in IMG/M
3300028063|Ga0268350_1053679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300028064|Ga0268340_1007712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1100Open in IMG/M
3300028139|Ga0268355_1009786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028140|Ga0268334_1014438Not Available555Open in IMG/M
3300028142|Ga0268347_1014508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300028149|Ga0268353_106026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum837Open in IMG/M
3300028150|Ga0268343_1017711Not Available525Open in IMG/M
3300028151|Ga0268308_1005608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum888Open in IMG/M
3300028256|Ga0268304_1001065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1178Open in IMG/M
3300028262|Ga0268310_1015187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum755Open in IMG/M
3300028381|Ga0268264_12129243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300028464|Ga0268302_103625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300028468|Ga0268317_1002786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300028470|Ga0268307_1002245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1000Open in IMG/M
3300028471|Ga0268323_1003393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum852Open in IMG/M
3300028474|Ga0268331_1009660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum698Open in IMG/M
3300028477|Ga0268309_1001946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum977Open in IMG/M
3300028527|Ga0268335_1007166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum669Open in IMG/M
3300028529|Ga0268311_1013820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
3300032465|Ga0214493_1146514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300032465|Ga0214493_1154588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300032466|Ga0214503_1070255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1070Open in IMG/M
3300032469|Ga0214491_1095177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum717Open in IMG/M
3300032490|Ga0214495_1153949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300032502|Ga0214490_1112453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300032502|Ga0214490_1157086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300032551|Ga0321339_1008232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1862Open in IMG/M
3300032591|Ga0214484_1052220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum864Open in IMG/M
3300032689|Ga0214497_1124180Not Available546Open in IMG/M
3300032698|Ga0214485_1098418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300032761|Ga0314733_1084985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300032790|Ga0314731_1072797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300032823|Ga0314723_1038476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum913Open in IMG/M
3300032914|Ga0314750_1137886Not Available568Open in IMG/M
3300033534|Ga0314757_1117538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
3300033538|Ga0314755_1169875Not Available554Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere60.87%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere15.53%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020223Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028063Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028149Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028527Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032790Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10080332513300005331Switchgrass RhizosphereLIKVTCSEQEVMIGSAVADPVGFKVTTGASTMSACSSCTSVRAFEVSVAPVSAS*
Ga0070666_1027623423300005335Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSRMSSVASWK*
Ga0070668_10175917023300005347Switchgrass RhizosphereKSAHKVTCSEQEVMIGSSAAGPVGLEVTTGASIMSASSSCTSVRALEISVAPVSAS*
Ga0070668_10197708613300005347Switchgrass RhizosphereLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSIRAFEVSVTPVSAS*
Ga0070671_10034297813300005355Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFDVSVSGMSSVASWK*
Ga0068864_10067511413300005618Switchgrass RhizosphereLEQGAFMKLSAGSELVLIKVTYSEQEVMIGLGVADPVGLEVTTGASTMSTYSSCTSVREFEVLVTPVSAS*
Ga0068863_10085895823300005841Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADLVGLEVTTGASTVLACSSCISIRVFEVSVAPVSAS*
Ga0068858_10056135023300005842Switchgrass RhizosphereMKLSAGSELVLIKVTYSEQEVMIGLGVADPVGLEVTTGASTMSTYSSCTSVRAFEVSVTPVSAS*
Ga0068860_10127139433300005843Switchgrass RhizosphereMKLSTGSELVLIKVTYSEQEVMIDSGAADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS*
Ga0068860_10150136923300005843Switchgrass RhizosphereMKLSAGSELVLIKVTYSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSGMSSVACWK*
Ga0105250_1037904313300009092Switchgrass RhizosphereMKLEQGAFMKLSAGSELVLIKVTCFEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSIRAFEVSVTPVSAS*
Ga0105249_1238326813300009553Switchgrass RhizosphereLKLEQGAFMKLSASSELVLIKVTCSEQEVMIGSGVADLVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS*
Ga0105136_10475823300009973Switchgrass AssociatedLELEQDAFIKLSAESELVLMKVTCSEQEVMIGSDVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS*
Ga0105135_10129823300009980Switchgrass AssociatedLELEQDAFIKLSAESELVLMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS*
Ga0105133_10230623300009981Switchgrass AssociatedMHLWGYRLVQNWFCKVTCSEKGVMIGSSVADPVGLEVTTGASTVLACSSCTSVRVFEVSVTPVSAS*
Ga0105131_12135013300009989Switchgrass AssociatedMKLSAGLELVLVKVTCSEQEVMIGSGVADPVGLKVTTGASTVLACLSCTSVRAFEVSVAPVSAS*
Ga0105132_12209523300009990Switchgrass AssociatedMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTIGASTVLACSSCTSVRVFEVSVAPV*
Ga0105120_100489823300009992Switchgrass AssociatedMKLWAGSKLVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVTAFKVSVAPVSTS*
Ga0105120_100682323300009992Switchgrass AssociatedMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFDVSVAPVSAS*
Ga0105120_104444513300009992Switchgrass AssociatedLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS*
Ga0105120_104485223300009992Switchgrass AssociatedLELEQYAFIKLSAESELVLMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS*
Ga0105126_101441123300009994Switchgrass AssociatedMKLLAGSELVLIKVTCSEREVMIGSGVTDPDGLEVTTGVSTMSACSSYTSVRVLEVSVAPVSAS*
Ga0105139_112389523300009995Switchgrass AssociatedMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS*
Ga0134125_1269716013300010371Terrestrial SoilIKVTYSEQEVMIGLGVADPVGLEVTTGASTMSTYSSCTSIRAFEVSVTPVSAS*
Ga0134124_1176792513300010397Terrestrial SoilLVLIKVTCSEQEVMIGSSVADPVGLEVTTGASTMLAYSSCTSVSAFEVSVAPVSAS*
Ga0134127_1198830913300010399Terrestrial SoilMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS*
Ga0134122_1189552623300010400Terrestrial SoilMKLSAGSELVLIKVTCSEQEVMISSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS*
Ga0134121_1145317613300010401Terrestrial SoilMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSIRAFEVSVAPVSAS*
Ga0157380_1188926423300014326Switchgrass RhizosphereMKLSAGSELVLIKVTYSEQEVMIGLGVADPVGLEVTTGASTMSPYSSCTSVRAFEVSVTPVSAS*
Ga0157379_1054989213300014968Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS*
Ga0182100_103592823300015280Switchgrass PhyllosphereMKLSAGSKLVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCISVRVFEVSVASVSAS*
Ga0182100_107840313300015280Switchgrass PhyllosphereVKLSAGSELVLIKVTCSEQEEMISSGVADPVGLKVTTGASTVLACLSCTSVRVFEVSVAPVSTS*
Ga0182101_104147813300015284Switchgrass PhyllosphereKALWTYLKLEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFEVSVAPVLAL*
Ga0182105_104545213300015290Switchgrass PhyllosphereMKLSAGSELVLIKVTCFEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVLV
Ga0182184_109666723300015301Switchgrass PhyllosphereLVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLAYLSCTSVRVFEVSVASV*
Ga0182180_101882213300015306Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSTSWTMTSCCAGLLVSRMSSVASWK*
Ga0182098_112796113300015309Switchgrass PhyllosphereMKLSVGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS*
Ga0182098_112812813300015309Switchgrass PhyllosphereMKLSADSELVLLKVTCSEQEVMVGSGVADPVGLEVATGASTELACSSCASVRAFEVSVSRMSSVAS*
Ga0182182_106541913300015311Switchgrass PhyllosphereLELEQGAFIKLSAESELVLMKVTYSKQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS*
Ga0182182_107851613300015311Switchgrass PhyllosphereQDAFMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACTSCTSVRVFEVSVAPVSAS*
Ga0182182_112063113300015311Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCASVRAFEVSVLRMSSVAS*
Ga0182182_112234713300015311Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS*
Ga0182168_101887513300015312Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCSSVRAFEVSVSGMSSVASWK*
Ga0182168_110522213300015312Switchgrass PhyllosphereLKLEQGAFMKLSAGSELAYKVTCSEQGGMIGSSVAYLVGLEVTTGTSIMSACSSCTSARVLEVLVAPVSAS*
Ga0182168_111461513300015312Switchgrass PhyllosphereMKLSTGSELVLIKVTCSELEVMIGSGVADPVGLEVATGASTVLTCSSCTSVRAFEVSVSGTSSDASWK*
Ga0182164_102057913300015313Switchgrass PhyllosphereMKLSAGSETVTYSEQEVMIGSGVADPVGLEVTTRASTVLACLSCISVRVFEVSVAPVSTS
Ga0182164_107385623300015313Switchgrass PhyllosphereMKLSAGSELVFIKVTCSEQEVLIGSGVADPVGLEVTTGASTVIACSSCTSVRVFGVSVAPVLAS*
Ga0182164_109634213300015313Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEKEVMIDSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS*
Ga0182120_109001713300015315Switchgrass PhyllosphereMKLEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVITGASTELACSSCTSVRAFEVSVAPVSAS*
Ga0182120_109126413300015315Switchgrass PhyllosphereMKLSAGSELAHKVTCSEKGVMIGSCVADPVGLEVTTGALTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182121_105866923300015316Switchgrass PhyllosphereMKLSAGSELVLIKVICSEQEVMIGSGVADPVGFEVTIGASTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182121_107120413300015316Switchgrass PhyllosphereLELEQDAFIKLSAESELVPMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182181_109947013300015318Switchgrass PhyllosphereMKLEQDTFMKLSASSELVLIKVTCSEQEVMIGSGEADPDGLEVTTGASTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182130_100780323300015319Switchgrass PhyllosphereMKLSAGSELILIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSIRAFEVSVTPVSAS*
Ga0182130_106831913300015319Switchgrass PhyllosphereLAHKVTCSEQEVMIGLSAADLVGLEVTTRASIMSACSSCTSVRVLEVSVAPASAS*
Ga0182165_112999423300015320Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACLSCTSVRAFEVSVSRMSSAVSWK*
Ga0182134_105926913300015324Switchgrass PhyllosphereMKLSAGLKLVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLAYSLCTSVRVFKVSVAPVSAS
Ga0182166_109838423300015326Switchgrass PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSTSWTMTSCCAGLLVSRMSSVASWK*
Ga0182166_110398513300015326Switchgrass PhyllosphereEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLAYSSCTSVRAFEVSVSGMSSVAS*
Ga0182166_114313213300015326Switchgrass PhyllosphereADSEMVLMKVTCSEQEVMVGSGVADLVGLEVAIGASTVLACSSCTSVRAFEVSVSRMSSVAS*
Ga0182114_109808623300015327Switchgrass PhyllosphereLELEQDAFIKLSAESELVLMKVTYSKQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS*
Ga0182153_108634813300015328Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSDVADPVGLEVTTGASTMSACSSCTSVRAFEVSISRMSSVAS*
Ga0182153_110477813300015328Switchgrass PhyllosphereMKLSAGSELAYKVTCSEQGGMIGSSVADLVGLEVTTGTSIMSACSSCTSVRVFKVSVAPVSTS*
Ga0182135_110075513300015329Switchgrass PhyllosphereSAGSKSAHQVTCAEQEVMIGSSVADLVGLEVTTGASIISACSSCTSVRVLEVSVAPASAS
Ga0182152_101275223300015330Switchgrass PhyllosphereLKLEQGAFMKLSAGSELVLIKVTCSEQEVMISSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS*
Ga0182152_110212413300015330Switchgrass PhyllosphereMKLSTDSELVLLKATCSEQEVMVGSGVADPFGLEVATGASTVLACSSCTSVRAFEVSVSRMSSVAS*
Ga0182131_103071223300015331Switchgrass PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLAYSLCTSVRVFKVSVAPVSAS*
Ga0182131_104856723300015331Switchgrass PhyllosphereMKLSAGSELAYKVTCSEQGGMIGSSVADLVGLEVTTGTSIMSACSSCTSIRVLEVSVAPASAS*
Ga0182131_107079913300015331Switchgrass PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVIPVSAS*
Ga0182131_110971513300015331Switchgrass PhyllosphereMKLEQGAFMKLSAGSKSAHQVTCAEQEVMIGSSVADLVGLEVTTGASIISACSSCTSVRVLEVSVAPVSAS*
Ga0182131_111757113300015331Switchgrass PhyllosphereWTYLKLEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS*
Ga0182117_102385723300015332Switchgrass PhyllosphereMKLSADSETVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSGMSSVASWK*
Ga0182117_105130223300015332Switchgrass PhyllosphereMKLSAGSELVLMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVLVSTS*
Ga0182117_110782113300015332Switchgrass PhyllosphereMKLSVGLKLVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS*
Ga0182117_116927423300015332Switchgrass PhyllosphereMKLSAGSKLVLIKVTCSEQEVMIGSSVADPVGLEVTTGASTMLACSSCTSVRAFEVSVAPVSAS*
Ga0182147_115950513300015333Switchgrass PhyllosphereVLIKVTCSEQEVMIGSGEADPDGLEVTTGASTVLACSSCTSVRAFEVSVSGVSSVAS*
Ga0182132_105235113300015334Switchgrass PhyllosphereMKLSTGSELVLIKVTCSEKGVMIGSSVADPVGFEVTIGASTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182132_111446313300015334Switchgrass PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS*
Ga0182116_112274413300015335Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFKVSVAPVSTS*
Ga0182137_110820013300015338Switchgrass PhyllosphereTVLIKVTCSEQEVMIGLGVADPVGLEVTTEASTVLACSSCTSVRVFEVSVAPVSAS*
Ga0182133_107099913300015340Switchgrass PhyllosphereMKLSAGSELAYKVTCSEQGGMIGSSVADLVGLEVTTGTSIVSACSSCTSVRVLEVSVAPASAS*
Ga0182133_115026213300015340Switchgrass PhyllosphereMKLSADSELVLLKVTYSEQEVMVGSGVADPVGLEVTTGASTMLACSSCTSVRAFEVSVSRMSSVAS*
Ga0182133_116947213300015340Switchgrass PhyllosphereSAHKVTFSEREGMIGLSAAGPVGLEVTLGASNMSACSSCTSVRALEVSVAPVLAS*
Ga0182185_124604423300015349Switchgrass PhyllosphereMKLLAGSKLVLIKVTRSAQEVMIGSSVTDPVGLEVTTGASTMSACSPCTSVRAFKVSVAPVSTS*
Ga0182163_115638613300015350Switchgrass PhyllosphereMKLERDAFMKLSVGFELVLIKVTCSEQEVMIGPGVADPVGLEVATGASTVLACSSCTSVRAFEVSVSRMSSVAS*
Ga0182179_125330613300015353Switchgrass PhyllosphereTYLKLEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVITGASTMSTCSSCISIRAFEVSVTPVSAS*
Ga0182179_128023623300015353Switchgrass PhyllosphereMKLSAGSELVLIKVTYSEQEVMIGSGVADPVGLEVTTWASTVLACSSCTSFRVFEVSAAPVSAS*
Ga0182167_126223123300015354Switchgrass PhyllosphereLEQGAFMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS*
Ga0182167_128814523300015354Switchgrass PhyllosphereMKLERDAFMKLSVGFELVLIKVTCSEQEVMIGPGVADPVGLEVATGASTVLACSSCTSVRAFEVSVSRMSSVANWK*
Ga0182167_132916713300015354Switchgrass PhyllosphereMKLSADSETVLMKVTCFEQEVMIGSGVADPVGLEVATEASTVLAYSSCTSIRAFEVSVSGVSSVAS*
Ga0182197_114946823300017408Switchgrass PhyllosphereSKLVLIKVTSSEKEVMIGSGVADPIGLEVTIGTSTMSACSSCTSVRAFEVSVAPVSAS
Ga0182199_116734123300017412Switchgrass PhyllosphereVKLSAGSELAYKVTCSEQGGMIGSSVADLVGLEVTTGTSIMSACLSCTSIRVLEVSVAPASAS
Ga0182199_116925413300017412Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFEVSVAPVLAL
Ga0182199_120152113300017412Switchgrass PhyllosphereMKLSADSELVLLKVTCSEQEVMIGSGVADPVRLEVTTGASIVLAYSSCTSVRVFEVSVAPVSAS
Ga0182195_101289013300017414Switchgrass PhyllosphereMKLSAGSELVLIKVTCSGQEVMIGSGIADPVGLKVTTGASTMSACSSCTSVRAFEVSVAPVSAS
Ga0182195_112495913300017414Switchgrass PhyllosphereMKLSADSETVLMKVTCSEQEVMIGSGVADPVGLEVATGASTVLACSSCTSGRAFEVSVSGISSAASWE
Ga0182195_119554923300017414Switchgrass PhyllosphereMKLSAGSELVLIKVTYSEQEVVIGLGVADPVGLEVTTGASTMSTYSSCTSIRAFEVSVTPVSAS
Ga0182201_110475113300017422Switchgrass PhyllosphereNIKALWTYLKLERDAFMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS
Ga0182196_106633013300017432Switchgrass PhyllosphereKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS
Ga0182196_110033413300017432Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSA
Ga0182196_113675413300017432Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEEMISSGVADPVGLKVTTGASTVLACLSCTSVRVFEVSVAPVSTS
Ga0182200_105150913300017439Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCASVRVFEVSVAPVSAS
Ga0182200_113084123300017439Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS
Ga0182214_102427123300017440Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS
Ga0182198_116484613300017445Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVSRMSSVAS
Ga0182215_106526713300017447Switchgrass PhyllosphereMNLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVLVAPVSAS
Ga0182215_110413513300017447Switchgrass PhyllosphereLWTYLKLEQDAFMKLLAGSELVLIKVTCSEQEVMIGSSVADPVGLEVTTGVSTVLAYSLCTSVRVFKVSVAPVSAS
Ga0182210_110562913300017692Switchgrass PhyllosphereMKLSAGSELVLIKVTYSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFEVSVAPVSTS
Ga0182216_122179513300017693Switchgrass PhyllosphereVKLSASSELVLIKVTYSEQEVMIGLGVADPVGLEVTTGASTMSTYSSCTSVREFEVLVTPVSAS
Ga0163161_1161943113300017792Switchgrass RhizosphereMKLSADSELVLLKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEGPVSGMSSVAS
Ga0182119_10169913300020031Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS
Ga0182118_10309023300020223Switchgrass PhyllosphereMKLPAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSAYSSCTSVRAFEVSVALVSAS
Ga0207680_1090281113300025903Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSRMSSVAS
Ga0207681_1148903913300025923Switchgrass RhizosphereMKLLAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSIRAFEVSVAPVSAS
Ga0207650_1063225223300025925Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTEASTMSACSSCTSVRAFEVSVAPVSAS
Ga0207644_1065733713300025931Switchgrass RhizosphereNISAGSETVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS
Ga0207641_1185268723300026088Switchgrass RhizosphereMKLSAGSELVLIKVTYSEQEVMISSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSGMSSVASWK
Ga0207641_1251618513300026088Switchgrass RhizosphereMKLSTGSELVLIKVTYSEQEVMIGSGVADPVGLEVTIGASTVLACSSCTSVRVFEVSVAPVSAS
Ga0268322_103227713300028049PhyllosphereMKLSADSETVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFEVSVAPVSAS
Ga0268328_106283313300028050PhyllosphereMKLSAGSELVLIKVTCSEKEVMIDSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0268300_101057323300028052PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMLACSSCTSVRVFEVSVAPVSAS
Ga0268306_101887513300028054PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVIPVSAS
Ga0268332_101587123300028058PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLKVTTGASTMLACSSCTSVRAFEVSVAPVSAS
Ga0268332_107557313300028058PhyllosphereMKLSAGSKLVLIKVTCSEQEVMIGSSVTDPVGLEVTTGASTMSACSPCTSVRAFKVSVAPVSTS
Ga0268314_101860023300028061PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLVCSSCTSVRAFEVTVSGMSAVASWK
Ga0268350_105367913300028063PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSRMSSVANWK
Ga0268340_100771213300028064PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVAGPVGLEVTTGASTMSTCSSCTSIRAFEVSVTPMSAS
Ga0268355_100978613300028139PhyllosphereIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSSCSSCTSVRAFEVSVAPVSAS
Ga0268334_101443813300028140PhyllosphereSAHKVTYSEREVMIGSSAADPVGLEVTTGALIMSACSPCISVRALEVSVAPVSAS
Ga0268347_101450823300028142PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0268353_10602613300028149PhyllosphereKLSAGSELVLIKVTCFEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0268343_101771113300028150PhyllosphereMKLSASSELVLIKVTCSEQEVVIGSGVADPVGLEVTIGASTMSTCSSCTSIRAFEVSVTPVSAS
Ga0268308_100560813300028151PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS
Ga0268304_100106523300028256PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRVFEVSVAPVSTS
Ga0268310_101518713300028262PhyllosphereMKLSAGSELVLIKVTCSEKEVMIDSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVLVTPVSAS
Ga0268264_1212924313300028381Switchgrass RhizosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSVRAFEVSVSGMSSVASWK
Ga0268302_10362523300028464PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVANPVGLEVTTGASTMSTCSSCTSVRAFEVSVAPVSAS
Ga0268317_100278613300028468PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0268307_100224513300028470PhyllosphereKVTCSEQEVMIGSGVANPVGLEVTTGASTMSACSSCTSVRAFEVSVAPVSAS
Ga0268323_100339323300028471PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRAFEVLVAPVSAS
Ga0268331_100966013300028474PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTVLACSSCTSFRVFEVSAAPVSAS
Ga0268309_100194623300028477PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSAYSSCTSVRAFEVSVAPVSAS
Ga0268335_100716613300028527PhyllosphereREDAFMKLSAGSETVLIKVTCSEQEVMIGSGVADPVGLKVTTWASIVLACSSCTSVRAFEVSVSRMSSVAS
Ga0268311_101382023300028529PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLACSSCTSVRVFKVSVAPVSAS
Ga0214493_114651413300032465Switchgrass PhyllosphereSADSETVLIKVTCSEQEVMIGSGVADPVGLEVATGASTVLACSSCTSIRAFEVSVSRMSSAAS
Ga0214493_115458823300032465Switchgrass PhyllosphereMSKPWTQLKLEQGAFIKLSAGSELVLIKVTCSEQEVMISSGVAGPVGLEVTTGASTMSTCSSCTSVRAFEVSVIPVSAS
Ga0214503_107025523300032466Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADLVGLEVTTGASTMSTCSSCTSVRAFEVSVAPVSAS
Ga0214491_109517713300032469Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSACSSCTSVRALEVSVALVSAS
Ga0214495_115394913300032490Switchgrass PhyllosphereRTYLKLERDAFMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVATGASTVLACSSCTSIRAFEVSVSRMSSAAS
Ga0214490_111245313300032502Switchgrass PhyllosphereMKLSAGSETVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSMLACSSCTSVRAFEVSVSRMSSVAS
Ga0214490_115708623300032502Switchgrass PhyllosphereERDAFMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0321339_100823213300032551Switchgrass PhyllosphereSSDSETVIIKVTCSVQEVMIGSGVADPVGLVVATGASTVLACSSCTSIRAFEVSVSRMSSAAS
Ga0214484_105222023300032591Switchgrass PhyllosphereLELEQDGFIKLSAESELVLMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS
Ga0214497_112418013300032689Switchgrass PhyllosphereEQDAFMKLSAGSETVLVKVTCSEQEVMIGSGVADPVGLEVTTGASTMSTCSSCTSVRAFEVSVTPVSAS
Ga0214485_109841813300032698Switchgrass PhyllosphereMKLSAESELVLMKVTCSEQEVMIGSGVADPVGLEVTTRASTVLACLPCISVRVSEVSVVPVSTS
Ga0314733_108498513300032761Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEQEVMIGSGVADPVGLEVTTRVSMLACSSCTSVRAFEVSVSGMSSVASWK
Ga0314731_107279713300032790Switchgrass PhyllosphereMKLSAGLELVLIKVTCSEQEVMIGSGVADPVGLEVTTGVSTVLAYSLCTSVRVFKVSVAPVSAS
Ga0314723_103847623300032823Switchgrass PhyllosphereMKLSADSETVLIKVTCSEQEVMIGSGVADPVGLEVATGASTVLACSSCTSVRAFEVSVSRMSSAAS
Ga0314750_113788613300032914Switchgrass PhyllosphereMMKISWERSPLMGLSAGLKSAHKVTCSEQEVMIGSSVADPVGLEVTTGASTMSACSSCTSVRVLEVSVAP
Ga0314757_111753813300033534Switchgrass PhyllosphereMKLSAGSELVLIKVTCSEKEVMIGSGVADPVGLEVTTEASTVLACSSCTSVRVFEVSVAPVSA
Ga0314755_116987513300033538Switchgrass PhyllosphereMKLSVGSELVFIKVTCSEKEVLISSGVADPIGLEVTTGASTALACSSCTSVRAFEVSVAPVLAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.