Basic Information | |
---|---|
Family ID | F040586 |
Family Type | Metagenome |
Number of Sequences | 161 |
Average Sequence Length | 42 residues |
Representative Sequence | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 40.99 % |
% of genes near scaffold ends (potentially truncated) | 29.81 % |
% of genes from short scaffolds (< 2000 bps) | 72.05 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (62.112 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.634 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.385 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.112 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.27% β-sheet: 0.00% Coil/Unstructured: 70.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF00959 | Phage_lysozyme | 16.15 |
PF00182 | Glyco_hydro_19 | 10.56 |
PF00462 | Glutaredoxin | 8.70 |
PF00271 | Helicase_C | 6.83 |
PF08291 | Peptidase_M15_3 | 4.35 |
PF11351 | GTA_holin_3TM | 3.73 |
PF04851 | ResIII | 2.48 |
PF11134 | Phage_stabilise | 1.86 |
PF03237 | Terminase_6N | 1.24 |
PF09374 | PG_binding_3 | 1.24 |
PF00145 | DNA_methylase | 0.62 |
PF12708 | Pectate_lyase_3 | 0.62 |
PF00583 | Acetyltransf_1 | 0.62 |
PF00166 | Cpn10 | 0.62 |
PF16510 | P22_portal | 0.62 |
PF00476 | DNA_pol_A | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 10.56 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 10.56 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.62 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.16 % |
Unclassified | root | N/A | 24.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002278|B570J29590_110276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300002835|B570J40625_100356279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1447 | Open in IMG/M |
3300003393|JGI25909J50240_1017776 | All Organisms → Viruses → Predicted Viral | 1662 | Open in IMG/M |
3300004151|Ga0066602_10096453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
3300004241|Ga0066604_10416507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300005528|Ga0068872_10281730 | Not Available | 926 | Open in IMG/M |
3300005581|Ga0049081_10000654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13147 | Open in IMG/M |
3300005581|Ga0049081_10320458 | Not Available | 530 | Open in IMG/M |
3300005582|Ga0049080_10055568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
3300005582|Ga0049080_10154788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300005662|Ga0078894_10420728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300006037|Ga0075465_10139607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300006641|Ga0075471_10644588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300006802|Ga0070749_10073077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2055 | Open in IMG/M |
3300006802|Ga0070749_10132489 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
3300006875|Ga0075473_10454487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
3300006920|Ga0070748_1314697 | Not Available | 555 | Open in IMG/M |
3300007544|Ga0102861_1239819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300007622|Ga0102863_1071029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
3300007636|Ga0102856_1003180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2089 | Open in IMG/M |
3300007708|Ga0102859_1078973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300007734|Ga0104986_1737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27097 | Open in IMG/M |
3300007735|Ga0104988_10568 | Not Available | 18009 | Open in IMG/M |
3300007973|Ga0105746_1017416 | Not Available | 2104 | Open in IMG/M |
3300007973|Ga0105746_1032258 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
3300007973|Ga0105746_1102540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300007974|Ga0105747_1129255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300007974|Ga0105747_1157963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300007974|Ga0105747_1187519 | Not Available | 679 | Open in IMG/M |
3300008055|Ga0108970_11598358 | Not Available | 1981 | Open in IMG/M |
3300008107|Ga0114340_1018348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3329 | Open in IMG/M |
3300008110|Ga0114343_1001392 | Not Available | 14692 | Open in IMG/M |
3300008113|Ga0114346_1074721 | Not Available | 1615 | Open in IMG/M |
3300008120|Ga0114355_1142715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300008266|Ga0114363_1213092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300008267|Ga0114364_1009635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5398 | Open in IMG/M |
3300008267|Ga0114364_1196932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300008450|Ga0114880_1042851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1955 | Open in IMG/M |
3300008450|Ga0114880_1087620 | Not Available | 1230 | Open in IMG/M |
3300009068|Ga0114973_10000797 | Not Available | 23694 | Open in IMG/M |
3300009068|Ga0114973_10009577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6329 | Open in IMG/M |
3300009085|Ga0105103_10540554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300009152|Ga0114980_10071998 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
3300009152|Ga0114980_10401626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300009158|Ga0114977_10000815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20642 | Open in IMG/M |
3300009158|Ga0114977_10021772 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
3300009158|Ga0114977_10154013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1367 | Open in IMG/M |
3300009158|Ga0114977_10569379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009159|Ga0114978_10187096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
3300009159|Ga0114978_10482711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300009164|Ga0114975_10292574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
3300009164|Ga0114975_10684344 | Not Available | 543 | Open in IMG/M |
3300009165|Ga0105102_10115917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
3300009183|Ga0114974_10706087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300009184|Ga0114976_10472955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300009184|Ga0114976_10553617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300010885|Ga0133913_11491189 | All Organisms → Viruses → Predicted Viral | 1714 | Open in IMG/M |
3300010885|Ga0133913_12446931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300010885|Ga0133913_12748417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
3300010966|Ga0137675_1000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7876 | Open in IMG/M |
3300010966|Ga0137675_1013300 | Not Available | 656 | Open in IMG/M |
3300010970|Ga0137575_10000165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13572 | Open in IMG/M |
3300011184|Ga0136709_1038516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300011334|Ga0153697_1149 | Not Available | 24688 | Open in IMG/M |
3300011336|Ga0153703_1050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38472 | Open in IMG/M |
3300011336|Ga0153703_1105 | Not Available | 30854 | Open in IMG/M |
3300011336|Ga0153703_1141 | Not Available | 26242 | Open in IMG/M |
3300011337|Ga0153702_1283 | Not Available | 18144 | Open in IMG/M |
3300012017|Ga0153801_1041298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300012352|Ga0157138_1026400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300013004|Ga0164293_10425536 | Not Available | 889 | Open in IMG/M |
3300013004|Ga0164293_10756306 | Not Available | 619 | Open in IMG/M |
3300013005|Ga0164292_10498578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300013005|Ga0164292_10826230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300013372|Ga0177922_10043202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300015050|Ga0181338_1054211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300017716|Ga0181350_1128834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300017747|Ga0181352_1024579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
3300017747|Ga0181352_1044923 | Not Available | 1298 | Open in IMG/M |
3300017747|Ga0181352_1167837 | Not Available | 574 | Open in IMG/M |
3300017754|Ga0181344_1036320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1496 | Open in IMG/M |
3300017754|Ga0181344_1062252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300017761|Ga0181356_1218252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300017784|Ga0181348_1137288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300017784|Ga0181348_1163389 | Not Available | 824 | Open in IMG/M |
3300017785|Ga0181355_1066010 | Not Available | 1524 | Open in IMG/M |
3300017785|Ga0181355_1336045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 559 | Open in IMG/M |
3300019784|Ga0181359_1089423 | Not Available | 1143 | Open in IMG/M |
3300019784|Ga0181359_1123038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300019784|Ga0181359_1152368 | Not Available | 791 | Open in IMG/M |
3300020141|Ga0211732_1115561 | Not Available | 6024 | Open in IMG/M |
3300020151|Ga0211736_10933381 | Not Available | 833 | Open in IMG/M |
3300020159|Ga0211734_11300741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300020172|Ga0211729_10123469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2495 | Open in IMG/M |
3300020172|Ga0211729_10906646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300021349|Ga0194052_1218637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300021438|Ga0213920_1004801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5145 | Open in IMG/M |
3300021956|Ga0213922_1000475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19266 | Open in IMG/M |
3300021961|Ga0222714_10082271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2094 | Open in IMG/M |
3300021961|Ga0222714_10133306 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
3300021962|Ga0222713_10499763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300022179|Ga0181353_1046453 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
3300022190|Ga0181354_1088904 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
3300022407|Ga0181351_1000353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12731 | Open in IMG/M |
3300022407|Ga0181351_1050399 | Not Available | 1739 | Open in IMG/M |
3300022407|Ga0181351_1064396 | Not Available | 1500 | Open in IMG/M |
3300022407|Ga0181351_1065995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1476 | Open in IMG/M |
3300025732|Ga0208784_1242501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
3300025896|Ga0208916_10094854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1258 | Open in IMG/M |
3300027213|Ga0208555_1065415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300027365|Ga0209300_1011352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2368 | Open in IMG/M |
3300027608|Ga0208974_1067858 | Not Available | 994 | Open in IMG/M |
3300027659|Ga0208975_1000176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34441 | Open in IMG/M |
3300027733|Ga0209297_1000355 | All Organisms → cellular organisms → Bacteria | 29915 | Open in IMG/M |
3300027734|Ga0209087_1000415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 27400 | Open in IMG/M |
3300027734|Ga0209087_1017130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3602 | Open in IMG/M |
3300027756|Ga0209444_10050156 | Not Available | 1888 | Open in IMG/M |
3300027764|Ga0209134_10184021 | Not Available | 719 | Open in IMG/M |
3300027782|Ga0209500_10274569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300027782|Ga0209500_10379807 | Not Available | 574 | Open in IMG/M |
3300027782|Ga0209500_10393739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300027785|Ga0209246_10137658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300027785|Ga0209246_10395318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300027798|Ga0209353_10281306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300027808|Ga0209354_10407932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300027900|Ga0209253_10132185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2030 | Open in IMG/M |
3300027900|Ga0209253_10647044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300027969|Ga0209191_1258110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300027973|Ga0209298_10213883 | Not Available | 782 | Open in IMG/M |
3300027973|Ga0209298_10291804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300028025|Ga0247723_1000613 | Not Available | 23758 | Open in IMG/M |
3300028025|Ga0247723_1009559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3870 | Open in IMG/M |
3300028025|Ga0247723_1013667 | Not Available | 2991 | Open in IMG/M |
3300031746|Ga0315293_10954188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
3300031758|Ga0315907_10291066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
3300031758|Ga0315907_11169849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300031784|Ga0315899_10030907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5648 | Open in IMG/M |
3300031963|Ga0315901_10062267 | Not Available | 3593 | Open in IMG/M |
3300031999|Ga0315274_10227643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2286 | Open in IMG/M |
3300032092|Ga0315905_10082910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3242 | Open in IMG/M |
3300032401|Ga0315275_10638470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
3300033233|Ga0334722_10995831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300033487|Ga0316630_11244329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300033995|Ga0335003_0196470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300033996|Ga0334979_0005245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9105 | Open in IMG/M |
3300034012|Ga0334986_0001540 | Not Available | 19633 | Open in IMG/M |
3300034012|Ga0334986_0230722 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300034013|Ga0334991_0210118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300034022|Ga0335005_0122419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1677 | Open in IMG/M |
3300034050|Ga0335023_0391610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300034061|Ga0334987_0141519 | Not Available | 1775 | Open in IMG/M |
3300034061|Ga0334987_0189950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1457 | Open in IMG/M |
3300034066|Ga0335019_0166399 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
3300034082|Ga0335020_0017522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4127 | Open in IMG/M |
3300034082|Ga0335020_0189255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300034102|Ga0335029_0119148 | Not Available | 1842 | Open in IMG/M |
3300034104|Ga0335031_0342552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300034106|Ga0335036_0065577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2735 | Open in IMG/M |
3300034106|Ga0335036_0642363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300034119|Ga0335054_0061257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2322 | Open in IMG/M |
3300034356|Ga0335048_0224471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.63% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.59% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.97% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.35% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.73% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.73% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.11% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.11% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.48% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.86% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.86% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.24% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.24% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.62% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.62% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
3300004241 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021349 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6m | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29590_1102761 | 3300002278 | Freshwater | IFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
B570J40625_1003562793 | 3300002835 | Freshwater | MIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
JGI25909J50240_10177765 | 3300003393 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
Ga0066602_100964532 | 3300004151 | Freshwater | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKREIND* |
Ga0066604_104165072 | 3300004241 | Freshwater | MRLSDRHMMILKELGGIEWLREHLDKKAKMPAKYYRLELDAPSKREIND* |
Ga0068872_102817304 | 3300005528 | Freshwater Lake | WMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0049081_100006546 | 3300005581 | Freshwater Lentic | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND* |
Ga0049081_103204582 | 3300005581 | Freshwater Lentic | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND* |
Ga0049080_100555683 | 3300005582 | Freshwater Lentic | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND* |
Ga0049080_101547884 | 3300005582 | Freshwater Lentic | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
Ga0078894_104207282 | 3300005662 | Freshwater Lake | MMIFQELGGIDWLRKHLDKSAKMPAKYYRLELDAPSKKEIND* |
Ga0075465_101396071 | 3300006037 | Aqueous | MSDRHWMILQELGGAEWLRNQLDKKAKMPAKYYRREIDAPSKKEIND* |
Ga0075471_106445881 | 3300006641 | Aqueous | MIFRELGGIEWLRKHLDKSAKMPAKYYRLELDAPSKKEIND* |
Ga0070749_100730777 | 3300006802 | Aqueous | MIFQELGGIEWLRKHLDKNAKMPAKYYRLELDAPSKKEIND* |
Ga0070749_101324894 | 3300006802 | Aqueous | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
Ga0075473_104544873 | 3300006875 | Aqueous | LTDRHMMIFRELGGIEWLRKHLDKSAKMPAKYYRLELDAPSKKEIND* |
Ga0070748_13146972 | 3300006920 | Aqueous | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND* |
Ga0102861_12398191 | 3300007544 | Estuarine | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSK |
Ga0102863_10710293 | 3300007622 | Estuarine | MSDRHWIILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND* |
Ga0102856_10031801 | 3300007636 | Estuarine | GIDWLRKQLDKNAKMPAKYYRLELDAPSKKEIND* |
Ga0102859_10789731 | 3300007708 | Estuarine | LSDRHVMILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEIND* |
Ga0104986_173719 | 3300007734 | Freshwater | MILQELGGAEWLRKQLDKKAKMPAKYYRRELDAPSKKETND* |
Ga0104988_105683 | 3300007735 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEAND* |
Ga0105746_10174164 | 3300007973 | Estuary Water | MSDRHWLILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEAND* |
Ga0105746_10322584 | 3300007973 | Estuary Water | MILQELGGAEWLRKQLDKNAKMPAKYYRCELDAPSKKEVND* |
Ga0105746_11025403 | 3300007973 | Estuary Water | ELGGAEWLRKELDKKAKMPAKYYRREVDAPSKKEIND* |
Ga0105747_11292553 | 3300007974 | Estuary Water | MILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEIND* |
Ga0105747_11579633 | 3300007974 | Estuary Water | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVNDKPKRLA |
Ga0105747_11875193 | 3300007974 | Estuary Water | MILQDLGGAEWLRKQLDKNAKMPAKYYRCELDAPSKKEVND* |
Ga0108970_115983583 | 3300008055 | Estuary | MILQELGGAEWLRKQLDKNAKMPTKYYRRELDAPSKKEVND* |
Ga0114340_10183486 | 3300008107 | Freshwater, Plankton | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND* |
Ga0114343_10013925 | 3300008110 | Freshwater, Plankton | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0114346_10747213 | 3300008113 | Freshwater, Plankton | MILQERGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0114355_11427151 | 3300008120 | Freshwater, Plankton | MILQELGGAEWLRKQLDKKAKMPAKYYRRELDAPSKKEVND* |
Ga0114363_12130922 | 3300008266 | Freshwater, Plankton | MSDRHWLILKELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND* |
Ga0114364_10096358 | 3300008267 | Freshwater, Plankton | MSDRHWLILKELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEPND* |
Ga0114364_11969322 | 3300008267 | Freshwater, Plankton | MILQELGGAEWLRKQLDKNAKMPAKYYRHELDAPSKKETND* |
Ga0114880_10428513 | 3300008450 | Freshwater Lake | MILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEVND* |
Ga0114880_10876201 | 3300008450 | Freshwater Lake | MSDRHWLILKELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0114973_1000079736 | 3300009068 | Freshwater Lake | MILQELGGAEWLRNYLDKNAKMPAKYYRRELDAPSKKEVND* |
Ga0114973_100095775 | 3300009068 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPAKYYSTFLKKETND* |
Ga0105103_105405542 | 3300009085 | Freshwater Sediment | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDSPSKKEPND* |
Ga0114980_100719982 | 3300009152 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLETDAPSKKEIND* |
Ga0114980_104016262 | 3300009152 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPVKYYRRELDAPSKKETND* |
Ga0114977_1000081513 | 3300009158 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPAKYYRREMDAPSKKEIND* |
Ga0114977_100217728 | 3300009158 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLETDAPSKK |
Ga0114977_101540131 | 3300009158 | Freshwater Lake | DRHMMIFQELGGIDWLRKQLDKNAKMPAKYYRLETDAPSKKEIND* |
Ga0114977_105693791 | 3300009158 | Freshwater Lake | ELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND* |
Ga0114978_101870963 | 3300009159 | Freshwater Lake | MILQELGGAEWLRNQLDKKAKMPAKYYRREIDAPSKKEIND* |
Ga0114978_104827113 | 3300009159 | Freshwater Lake | IFQELGGIDWLRKQLDKNAKMPVKYYRLELDAPSKKEIND* |
Ga0114975_102925742 | 3300009164 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEVND* |
Ga0114975_106843442 | 3300009164 | Freshwater Lake | MILQELGGAEWLRKQLDKKAKMPAKYYSTFLKKETND* |
Ga0105102_101159172 | 3300009165 | Freshwater Sediment | MIMQELGGAEWLRNYLDKNAKMPAKYYRLELDAPSKKETND* |
Ga0114974_107060872 | 3300009183 | Freshwater Lake | MMIFQELGGIDWLRKHLDKNAKMPAKYYRLETDAPSKKETND* |
Ga0114976_104729552 | 3300009184 | Freshwater Lake | MMIFQEIGGIDWLRKHLDKSAKMPAKYYRLELDAPSKKETND* |
Ga0114976_105536172 | 3300009184 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPAKYYRFETDAPSKKEIND* |
Ga0133913_114911894 | 3300010885 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPVKYYRLELDAPSKKEIND* |
Ga0133913_124469314 | 3300010885 | Freshwater Lake | LSDRHMLVFKELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND* |
Ga0133913_127484173 | 3300010885 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPVKYYSTFLKKETND* |
Ga0137675_100010410 | 3300010966 | Pond Fresh Water | MMIFKELGGIDWLRKHLDKNAKMPAKYYRLELDAPSKREIND* |
Ga0137675_10133001 | 3300010966 | Pond Fresh Water | IRLTDRHMMIFKELGGIDWLRKHLDKNARMPAKYYRLELDAPSKREIND* |
Ga0137575_1000016514 | 3300010970 | Pond Fresh Water | MMIFKELGGIDWLRKHLDKNARMPAKYYRLELDAPSKREIND* |
Ga0136709_10385163 | 3300011184 | Freshwater | WMIMQELGGAEWLRNYLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0153697_11498 | 3300011334 | Freshwater | MSDRHWMILQELGGAEWLRKELDKKAKMPMKYYRRELDAPSKKEVND* |
Ga0153703_105018 | 3300011336 | Freshwater | MILQELGGAEWLRKELDKKAKMPMKYYRRELDAPSKKEVND* |
Ga0153703_110529 | 3300011336 | Freshwater | MSDRHWRILQELGGAEWLRKQLDKKAKMPAKYYRRELDAPSKKEVND* |
Ga0153703_114116 | 3300011336 | Freshwater | MIFKELGGADWLRKQLDKHAKMPAKYYRRELDAPSKKETND* |
Ga0153702_12837 | 3300011337 | Freshwater | MIFKELGGADWLRKQLDKHAKMPAKYYRRELDAP* |
Ga0153801_10412982 | 3300012017 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND* |
Ga0157138_10264001 | 3300012352 | Freshwater | LTDRHMMIFQELGGIDWLRKHLDKSAKMPAKYYRLELDAPSKKEIND* |
Ga0164293_104255363 | 3300013004 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRLETDAPSKKETND* |
Ga0164293_107563061 | 3300013004 | Freshwater | MMIFQELGGIDWLRKHLDKSAKMPVKYYRLELDAPSKKEIND* |
Ga0164292_104985782 | 3300013005 | Freshwater | RHMMIFQELGGIDWLRKHLDKSAKMPAKYYRLELDAPSKKEVND* |
Ga0164292_108262302 | 3300013005 | Freshwater | GGIDWLRKHLDKSAKMPVKYYRLELDAPSKKEIND* |
Ga0177922_100432023 | 3300013372 | Freshwater | MILQELGGAEWLRKQLDKNAKMPVKYYRRELDAPSKKEIND* |
Ga0181338_10542111 | 3300015050 | Freshwater Lake | MIMQELGGAEWLRNYLDKNAKMPAKYYRLELDAPSKKESND* |
Ga0181350_11288341 | 3300017716 | Freshwater Lake | LGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0181352_10245794 | 3300017747 | Freshwater Lake | MSDRHWMILQELGGAEWLRKQLDKNAKMPVKYYRRELDAPSKKEVND |
Ga0181352_10449234 | 3300017747 | Freshwater Lake | MIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPS |
Ga0181352_11678371 | 3300017747 | Freshwater Lake | LGGIDWLRKHLDKSAKMPAKYYRREMDAPSKREVND |
Ga0181344_10363204 | 3300017754 | Freshwater Lake | MMIFQELGGIAWLRKQLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0181344_10622521 | 3300017754 | Freshwater Lake | LTDRHMMIFQELGSIDWLRKHLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0181356_12182521 | 3300017761 | Freshwater Lake | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSK |
Ga0181348_11372882 | 3300017784 | Freshwater Lake | MIMQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0181348_11633891 | 3300017784 | Freshwater Lake | MILQELGGAEWLRKQFDKNAKMPAKYYRRELDAPSKKEVND |
Ga0181355_10660101 | 3300017785 | Freshwater Lake | RHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0181355_13360451 | 3300017785 | Freshwater Lake | MSDRHWLILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKESND |
Ga0181359_10894232 | 3300019784 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0181359_11230382 | 3300019784 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND |
Ga0181359_11523683 | 3300019784 | Freshwater Lake | SDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND |
Ga0211732_11155619 | 3300020141 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND |
Ga0211736_109333812 | 3300020151 | Freshwater | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0211734_113007413 | 3300020159 | Freshwater | MSDRHWMILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEVND |
Ga0211729_101234695 | 3300020172 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEVDD |
Ga0211729_109066462 | 3300020172 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0194052_12186372 | 3300021349 | Anoxic Zone Freshwater | MILQELGGAEWLRNQLDKKAKMPAKYYRREIDAPSKKEIND |
Ga0213920_10048018 | 3300021438 | Freshwater | MSDKQWIIFNQLGGSEWLRKTLDKKAPMPAKYYRLEIDAPSKKEIND |
Ga0213922_100047528 | 3300021956 | Freshwater | MSDRHWMILQELGGAEWLRNQLDKKAKMPAKYYRREIDAPSKKEIND |
Ga0222714_100822712 | 3300021961 | Estuarine Water | MILQELGGAEWLRKQLDKKAKMPAKYYRRELDAPSKKEVND |
Ga0222714_101333061 | 3300021961 | Estuarine Water | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEV |
Ga0222713_104997631 | 3300021962 | Estuarine Water | MIMQELGGAEWLRKQLDKKAKMPAKYYRRELDAPSKKEVND |
Ga0181353_10464532 | 3300022179 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPVKYYRRELDAPSKKEVND |
Ga0181354_10889045 | 3300022190 | Freshwater Lake | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELD |
Ga0181351_10003532 | 3300022407 | Freshwater Lake | MMIFQELGGIDWLRKQLDKSAKMPAKYYIPLSKKETND |
Ga0181351_10503992 | 3300022407 | Freshwater Lake | MRLSDRHMMIFKELGGIKWLREHLDKKAKMPTKYYRLEMDAPSKREIND |
Ga0181351_10643964 | 3300022407 | Freshwater Lake | MIMQELGGAEWLRNYLDKNAKMPAKYYRLELDAPSKKESND |
Ga0181351_10659953 | 3300022407 | Freshwater Lake | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0208784_12425011 | 3300025732 | Aqueous | RLTDRHMMIFRELGGIEWLRKHLDKSAKMPAKYYRLELDAPSKKEIND |
Ga0208916_100948544 | 3300025896 | Aqueous | VRMSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0208555_10654151 | 3300027213 | Estuarine | IRLSDRHVMILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEIND |
Ga0209300_10113523 | 3300027365 | Deep Subsurface | MMIFQELGGIEWLRKQLDKNAKMPTKYYRLELDAPSKKEIND |
Ga0208974_10678581 | 3300027608 | Freshwater Lentic | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSK |
Ga0208975_100017616 | 3300027659 | Freshwater Lentic | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKETND |
Ga0209297_100035529 | 3300027733 | Freshwater Lake | MMIFQELGGIDWLRKQLDKNAKMPAKYYRREMDAPSKKEIND |
Ga0209087_100041514 | 3300027734 | Freshwater Lake | MIFQELGGIDWLRKQLDKNAKMPAKYYRREMDAPSKKEIND |
Ga0209087_10171302 | 3300027734 | Freshwater Lake | MMIFQELGGIDWLRKQLDKSAKMPAKYYRLETDAPSKKETND |
Ga0209444_100501563 | 3300027756 | Freshwater Lake | MIMQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0209134_101840213 | 3300027764 | Freshwater Lake | MIFQELGGIDWLRKHLDKNAKMPAKYYRLELDAPSKKE |
Ga0209500_102745691 | 3300027782 | Freshwater Lake | ELGGIDWLRKQLDKNAKMPVKYYRLELDAPSKKEIND |
Ga0209500_103798071 | 3300027782 | Freshwater Lake | ELGGAEWLRNQLDKKAKMPAKYYRREIDAPSKKEIND |
Ga0209500_103937391 | 3300027782 | Freshwater Lake | MILQELGGAEWLRKQLDKNAKMPVKYYRRELDAPSKKETND |
Ga0209246_101376583 | 3300027785 | Freshwater Lake | RQVRMSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0209246_103953183 | 3300027785 | Freshwater Lake | SDRHWMILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEVND |
Ga0209353_102813061 | 3300027798 | Freshwater Lake | RMSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0209354_104079323 | 3300027808 | Freshwater Lake | RMSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND |
Ga0209253_101321857 | 3300027900 | Freshwater Lake Sediment | QELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0209253_106470443 | 3300027900 | Freshwater Lake Sediment | VFKELGGIDWLRKQLDKNAKMPAKYYKRELDAPSKKEIND |
Ga0209191_12581103 | 3300027969 | Freshwater Lake | MMIFKELGGIDWLRSHLDKKARMPAKYYRLELDAPSKRETND |
Ga0209298_102138833 | 3300027973 | Freshwater Lake | RQIRLTDRHMMIFQELGGIDWLRKQLDKNAKMPAKYYRLETDAPSKKEIND |
Ga0209298_102918042 | 3300027973 | Freshwater Lake | RLTDRHMMIFQELGGIDWLRKQLDKNAKMPAKYYRREMDAPSKKEIND |
Ga0247723_100061321 | 3300028025 | Deep Subsurface Sediment | MILQELGGAEWLRNILDKKAKMPAKYYRRELDAPSKKEAND |
Ga0247723_10095596 | 3300028025 | Deep Subsurface Sediment | MMIFQELGGIEWLRKHLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0247723_10136675 | 3300028025 | Deep Subsurface Sediment | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKEIND |
Ga0315293_109541883 | 3300031746 | Sediment | WMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEAND |
Ga0315907_102910665 | 3300031758 | Freshwater | MILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKESND |
Ga0315907_111698491 | 3300031758 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAP |
Ga0315899_100309076 | 3300031784 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0315901_100622673 | 3300031963 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNAKMPAKYYRHELDAPSKKETND |
Ga0315274_102276433 | 3300031999 | Sediment | MIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKETND |
Ga0315905_100829105 | 3300032092 | Freshwater | MILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEVND |
Ga0315275_106384703 | 3300032401 | Sediment | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLEMDAPSKKETND |
Ga0334722_109958313 | 3300033233 | Sediment | MMILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKEIND |
Ga0316630_112443292 | 3300033487 | Soil | MRLSDRHMMILKELGGIEWLREHLDKKAKMPAKYYRLELDAPSKR |
Ga0335003_0196470_841_966 | 3300033995 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRLELDAPSKKETSD |
Ga0334979_0005245_6958_7083 | 3300033996 | Freshwater | MILQELGGAEWLRKELDKKAKMPAKYYRRELDAPSKKEIND |
Ga0334986_0001540_14002_14127 | 3300034012 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRRELDAPSKKELND |
Ga0334986_0230722_894_1016 | 3300034012 | Freshwater | MMIFQELGGIDWLRKQLDKNAKMPAKYYRLELDAPSKKEIN |
Ga0334991_0210118_662_787 | 3300034013 | Freshwater | MIMQELGGAEWLRKYLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0335005_0122419_1540_1665 | 3300034022 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRREVDAPSKKEVND |
Ga0335023_0391610_329_460 | 3300034050 | Freshwater | MSDRHWMILQELGGAEWLRKQLDKNTKMPAKYYIAPSKKESND |
Ga0334987_0141519_13_138 | 3300034061 | Freshwater | MILQELGGAEWLRNILDKKAKMPAKYYRRELDAPSKKEVND |
Ga0334987_0189950_173_298 | 3300034061 | Freshwater | MILQELGGAEWLRNILDKKAKMPAKYYRRELDAPSKKETND |
Ga0335019_0166399_168_293 | 3300034066 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRMEADAPSKKEVND |
Ga0335020_0017522_2366_2491 | 3300034082 | Freshwater | MILQELGGAEWLRNILDKKAKMPAKYYRLELDAPSKKETND |
Ga0335020_0189255_249_365 | 3300034082 | Freshwater | MMIFQELGGIDWLRKHLDKSAKMPAKYYILPSKKETND |
Ga0335029_0119148_931_1059 | 3300034102 | Freshwater | MMIFQELGGIDWLRKQLDKSAKMPAKYYRLELDAPSKKETND |
Ga0335031_0342552_75_200 | 3300034104 | Freshwater | MILQELGGAEWLRKHLDKNAKMPAKYYRRELDAPSKKEVND |
Ga0335036_0065577_15_143 | 3300034106 | Freshwater | MMIFQELGGIDWLRKQLDKSAKMPAKYYRFELDAPSKKEIND |
Ga0335036_0642363_100_225 | 3300034106 | Freshwater | MILQELGGAEWLRNYLDKNAKMPAKYYRRELDAPSKKETND |
Ga0335054_0061257_1298_1423 | 3300034119 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRMEIDAPSKREPND |
Ga0335048_0224471_537_662 | 3300034356 | Freshwater | MILQELGGAEWLRKQLDKNAKMPAKYYRMEVDAPSKRETND |
⦗Top⦘ |