Basic Information | |
---|---|
Family ID | F040588 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 46 residues |
Representative Sequence | GYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 1.24 % |
% of genes near scaffold ends (potentially truncated) | 98.14 % |
% of genes from short scaffolds (< 2000 bps) | 92.55 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.596 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.950 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.565 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.870 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF01930 | Cas_Cas4 | 17.39 |
PF12705 | PDDEXK_1 | 15.53 |
PF12728 | HTH_17 | 9.32 |
PF03796 | DnaB_C | 3.11 |
PF07659 | DUF1599 | 0.62 |
PF01807 | zf-CHC2 | 0.62 |
PF02467 | Whib | 0.62 |
PF13252 | DUF4043 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 17.39 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 3.11 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 3.11 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.99 % |
Unclassified | root | N/A | 18.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_108814658 | Not Available | 515 | Open in IMG/M |
3300002408|B570J29032_109684737 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300002835|B570J40625_100756815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
3300002835|B570J40625_101196144 | Not Available | 637 | Open in IMG/M |
3300005517|Ga0070374_10310020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300005517|Ga0070374_10462944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300005528|Ga0068872_10407084 | Not Available | 740 | Open in IMG/M |
3300005662|Ga0078894_10548018 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300005805|Ga0079957_1256803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300006641|Ga0075471_10102048 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
3300006805|Ga0075464_10494945 | Not Available | 748 | Open in IMG/M |
3300007516|Ga0105050_10791959 | Not Available | 541 | Open in IMG/M |
3300007670|Ga0102862_1017402 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
3300008055|Ga0108970_11451461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300008107|Ga0114340_1105612 | Not Available | 1117 | Open in IMG/M |
3300008107|Ga0114340_1165480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300008107|Ga0114340_1241959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300008114|Ga0114347_1258082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300008116|Ga0114350_1010205 | Not Available | 5867 | Open in IMG/M |
3300008120|Ga0114355_1075787 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
3300008120|Ga0114355_1152393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300008122|Ga0114359_1199051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300008262|Ga0114337_1002072 | Not Available | 40553 | Open in IMG/M |
3300008448|Ga0114876_1108282 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
3300008450|Ga0114880_1101404 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
3300008450|Ga0114880_1170850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300009081|Ga0105098_10362437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300009152|Ga0114980_10564350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300009155|Ga0114968_10251481 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
3300009158|Ga0114977_10645424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300009169|Ga0105097_10734137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300009180|Ga0114979_10100895 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
3300009180|Ga0114979_10848294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300009180|Ga0114979_10870578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300009181|Ga0114969_10224196 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300009183|Ga0114974_10208931 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300009183|Ga0114974_10396628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300009183|Ga0114974_10432140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300009184|Ga0114976_10537245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300009684|Ga0114958_10534238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300010158|Ga0114960_10099967 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
3300011009|Ga0129318_10239158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300012013|Ga0153805_1040976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300012729|Ga0157625_1049289 | All Organisms → Viruses → Predicted Viral | 2467 | Open in IMG/M |
3300012731|Ga0157616_1285392 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
3300012931|Ga0153915_13226259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300013004|Ga0164293_10636062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300013005|Ga0164292_10727040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300013006|Ga0164294_10440337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300017701|Ga0181364_1025411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300017716|Ga0181350_1027109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
3300017716|Ga0181350_1060838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300017716|Ga0181350_1107231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300017722|Ga0181347_1145242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300017722|Ga0181347_1157232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300017723|Ga0181362_1064332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300017736|Ga0181365_1057920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300017754|Ga0181344_1156837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300017774|Ga0181358_1197610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300017774|Ga0181358_1219387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300017774|Ga0181358_1234056 | Not Available | 585 | Open in IMG/M |
3300017777|Ga0181357_1228647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300017777|Ga0181357_1254526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300017777|Ga0181357_1337940 | Not Available | 503 | Open in IMG/M |
3300017778|Ga0181349_1308426 | Not Available | 511 | Open in IMG/M |
3300017780|Ga0181346_1163251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300017780|Ga0181346_1170179 | Not Available | 803 | Open in IMG/M |
3300017784|Ga0181348_1002791 | Not Available | 7764 | Open in IMG/M |
3300017784|Ga0181348_1064945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
3300017784|Ga0181348_1283194 | Not Available | 561 | Open in IMG/M |
3300017785|Ga0181355_1056060 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
3300017785|Ga0181355_1259000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300017785|Ga0181355_1377886 | Not Available | 516 | Open in IMG/M |
3300019784|Ga0181359_1083580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
3300019784|Ga0181359_1119053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300019784|Ga0181359_1130383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300019784|Ga0181359_1152141 | Not Available | 792 | Open in IMG/M |
3300020205|Ga0211731_10147142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300020205|Ga0211731_10381497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300021962|Ga0222713_10193818 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
3300021962|Ga0222713_10580239 | Not Available | 657 | Open in IMG/M |
3300022190|Ga0181354_1166213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300022407|Ga0181351_1130484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
3300022407|Ga0181351_1143564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300022407|Ga0181351_1157061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300022407|Ga0181351_1182923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300022407|Ga0181351_1202992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300022407|Ga0181351_1204126 | Not Available | 657 | Open in IMG/M |
3300022407|Ga0181351_1245786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300022752|Ga0214917_10334580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300023174|Ga0214921_10102000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
3300023184|Ga0214919_10515023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300027679|Ga0209769_1178594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300027734|Ga0209087_1035741 | All Organisms → Viruses → Predicted Viral | 2351 | Open in IMG/M |
3300027754|Ga0209596_1357632 | Not Available | 561 | Open in IMG/M |
3300027759|Ga0209296_1210560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300027759|Ga0209296_1250450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300027759|Ga0209296_1375253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027782|Ga0209500_10373888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300027782|Ga0209500_10422563 | Not Available | 531 | Open in IMG/M |
3300027785|Ga0209246_10258060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300027797|Ga0209107_10379518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300027808|Ga0209354_10023529 | All Organisms → Viruses → Predicted Viral | 2457 | Open in IMG/M |
3300027808|Ga0209354_10262495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300027816|Ga0209990_10036357 | All Organisms → Viruses → Predicted Viral | 2599 | Open in IMG/M |
3300027963|Ga0209400_1240157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300028025|Ga0247723_1004733 | Not Available | 6323 | Open in IMG/M |
3300028025|Ga0247723_1097384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300028025|Ga0247723_1125947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1060667 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
3300031707|Ga0315291_10890486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300031758|Ga0315907_11114071 | Not Available | 560 | Open in IMG/M |
3300031834|Ga0315290_11040019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300031857|Ga0315909_10780131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300031857|Ga0315909_10852573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300031873|Ga0315297_11157089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300031951|Ga0315904_10828437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300031963|Ga0315901_10140781 | All Organisms → Viruses → Predicted Viral | 2167 | Open in IMG/M |
3300031963|Ga0315901_10348555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300031963|Ga0315901_10400486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300031963|Ga0315901_10486604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300031963|Ga0315901_10908743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300031999|Ga0315274_11742088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300032050|Ga0315906_10803842 | Not Available | 737 | Open in IMG/M |
3300032053|Ga0315284_11442258 | Not Available | 735 | Open in IMG/M |
3300032116|Ga0315903_10435174 | Not Available | 1057 | Open in IMG/M |
3300032116|Ga0315903_10477818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
3300032116|Ga0315903_11004729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300032177|Ga0315276_12386046 | Not Available | 532 | Open in IMG/M |
3300032516|Ga0315273_12065065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300033233|Ga0334722_10402634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300033233|Ga0334722_10490766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300033980|Ga0334981_0172049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300033981|Ga0334982_0075609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
3300033981|Ga0334982_0097250 | All Organisms → Viruses → Predicted Viral | 1556 | Open in IMG/M |
3300033981|Ga0334982_0486371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300034012|Ga0334986_0034506 | All Organisms → Viruses → Predicted Viral | 3316 | Open in IMG/M |
3300034020|Ga0335002_0126593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1692 | Open in IMG/M |
3300034061|Ga0334987_0673430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300034061|Ga0334987_0824284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300034062|Ga0334995_0195279 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
3300034062|Ga0334995_0614767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300034066|Ga0335019_0475154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300034066|Ga0335019_0788215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300034068|Ga0334990_0159043 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
3300034068|Ga0334990_0347400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300034092|Ga0335010_0501513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300034104|Ga0335031_0215429 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
3300034106|Ga0335036_0191074 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
3300034106|Ga0335036_0370811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300034106|Ga0335036_0582271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300034106|Ga0335036_0873416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300034118|Ga0335053_0362369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300034119|Ga0335054_0345683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300034119|Ga0335054_0443733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300034119|Ga0335054_0444779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300034120|Ga0335056_0497907 | Not Available | 642 | Open in IMG/M |
3300034122|Ga0335060_0313239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300034168|Ga0335061_0534975 | Not Available | 594 | Open in IMG/M |
3300034200|Ga0335065_0495554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300034284|Ga0335013_0468427 | Not Available | 760 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 23.60% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.04% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.07% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.59% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.59% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.86% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.24% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.24% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.24% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.62% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.62% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.62% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.62% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.62% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.62% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1088146581 | 3300002408 | Freshwater | SIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF* |
B570J29032_1096847371 | 3300002408 | Freshwater | GYLYSIVKPDMELAYAKRHARKAVEIASVLDSNTGKPLQLVVQERM* |
B570J40625_1007568151 | 3300002835 | Freshwater | ALGYLYSIVKPDMELAYAKRHARKAVEIASVLDSNTGKPIQLVVQERM* |
B570J40625_1011961441 | 3300002835 | Freshwater | KPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0070374_103100201 | 3300005517 | Freshwater Lake | LALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERM* |
Ga0070374_104629444 | 3300005517 | Freshwater Lake | KPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF* |
Ga0068872_104070841 | 3300005528 | Freshwater Lake | MELAYAKRHARKAVEIASVLDANTGKPLQLVVQERL* |
Ga0078894_105480185 | 3300005662 | Freshwater Lake | CKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERF* |
Ga0079957_12568031 | 3300005805 | Lake | GQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF* |
Ga0075471_101020484 | 3300006641 | Aqueous | GSGGQLALGYLYSIVKPDMDLTYAKRHARRAVEIASVLDANTNKPLQLVVQERF* |
Ga0075464_104949453 | 3300006805 | Aqueous | GSGGQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDSNTGKPIQLVVQERM* |
Ga0105050_107919591 | 3300007516 | Freshwater | PDISLDYAKRYGRKAVEIASVLDSNTGKPLQLVVQERF* |
Ga0102862_10174021 | 3300007670 | Estuarine | ALGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTNKPLQLVVQERF* |
Ga0108970_114514613 | 3300008055 | Estuary | QFALGYLASIVKPDIELAYAKRHARRAVDIASVLDANTGKPLQLVVQERL* |
Ga0114340_11056123 | 3300008107 | Freshwater, Plankton | LGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114340_11654801 | 3300008107 | Freshwater, Plankton | NVELDYAKRHARKAVEIASVLDSNTNKPLQLVVQERM* |
Ga0114340_12419591 | 3300008107 | Freshwater, Plankton | LGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERM* |
Ga0114347_12580823 | 3300008114 | Freshwater, Plankton | SGGQFALGYLSSIIKPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114350_101020510 | 3300008116 | Freshwater, Plankton | MELEYAKRHARKAVEIASVLDANTGKPLQLVVQERI* |
Ga0114355_10757873 | 3300008120 | Freshwater, Plankton | LYSIGKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERM* |
Ga0114355_11523933 | 3300008120 | Freshwater, Plankton | FALGYLSSIIKPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114359_11990511 | 3300008122 | Freshwater, Plankton | YLYSAIKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERL* |
Ga0114337_100207216 | 3300008262 | Freshwater, Plankton | MVVSIIYLDSDIQANLELADAKRLARKAVEIASVLDVNTGKPLQLVVQERTIF* |
Ga0114876_11082821 | 3300008448 | Freshwater Lake | DMELAYAKRHARKAVEIASVLDSNTGKPLQLVIQERM* |
Ga0114880_11014041 | 3300008450 | Freshwater Lake | GVQTDLELDEAKRLARKAVEIASVLDVNTGKPLQMMVQERLV* |
Ga0114880_11708501 | 3300008450 | Freshwater Lake | LSSIIKPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0105098_103624371 | 3300009081 | Freshwater Sediment | KPDMELDYAKRHARKAVEIASVLDANTGKPIQLVVQERL* |
Ga0114980_105643503 | 3300009152 | Freshwater Lake | GGQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF* |
Ga0114968_102514814 | 3300009155 | Freshwater Lake | GYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF* |
Ga0114977_106454243 | 3300009158 | Freshwater Lake | LALGYLYSIRKPIMGLDYLKRHARRAVEIASVLDSNTGKPLQLVVQEKL* |
Ga0105097_107341373 | 3300009169 | Freshwater Sediment | YSARKPDMDLAYAKRHARKAVEIASMLDANTGKPIQLVVQERF* |
Ga0114979_101008955 | 3300009180 | Freshwater Lake | VAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114979_108482941 | 3300009180 | Freshwater Lake | YLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF* |
Ga0114979_108705781 | 3300009180 | Freshwater Lake | LYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114969_102241961 | 3300009181 | Freshwater Lake | KPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF* |
Ga0114974_102089313 | 3300009183 | Freshwater Lake | LALGYLYSIVKPDIDLAYAKRHARRAVEIASVLDANTGKPLQLVVQERF* |
Ga0114974_103966283 | 3300009183 | Freshwater Lake | LGYLYSAIKPDVDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERF* |
Ga0114974_104321403 | 3300009183 | Freshwater Lake | LGYLYSAIKPDVDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0114976_105372451 | 3300009184 | Freshwater Lake | LYSICKPDMDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERF* |
Ga0114958_105342383 | 3300009684 | Freshwater Lake | SGGQFALGYLYSICQPDMELAYATKHTRKAVEIASVLDSNTSKPLQLVVQERG* |
Ga0114960_100999671 | 3300010158 | Freshwater Lake | GGQLALGYQYSICKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0129318_102391581 | 3300011009 | Freshwater To Marine Saline Gradient | KPDMDLTYAKRHARRAVEIASVLDANTGKPLQLVVQERM* |
Ga0153805_10409761 | 3300012013 | Surface Ice | ALGYLYSAIKPDVDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0157625_10492895 | 3300012729 | Freshwater | CKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0157616_12853921 | 3300012731 | Freshwater | PDMELAYAKRHARKAVEIASVLDSNTGKPIQLVIQERM* |
Ga0153915_132262591 | 3300012931 | Freshwater Wetlands | LALGYLYSICKPDMELAYAKRHVRKAVEIASVLDANTGKPLQLVVQERF* |
Ga0164293_106360622 | 3300013004 | Freshwater | ALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM* |
Ga0164292_107270401 | 3300013005 | Freshwater | LALGYLYSICKPDMELAYAKRHARKAVEIASVLDSNTGKPLQLVVQERM* |
Ga0164294_104403371 | 3300013006 | Freshwater | SAIKPDIDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERL* |
Ga0181364_10254113 | 3300017701 | Freshwater Lake | QLALGYLYSIRKPIMDLDYIKRHARRAVEIASVLDSNTGKPLQLVVQEKL |
Ga0181350_10271094 | 3300017716 | Freshwater Lake | GSGGQLALGYLYSVCKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0181350_10608381 | 3300017716 | Freshwater Lake | GQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERM |
Ga0181350_11072313 | 3300017716 | Freshwater Lake | GYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181347_11452421 | 3300017722 | Freshwater Lake | PDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0181347_11572324 | 3300017722 | Freshwater Lake | YSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181362_10643321 | 3300017723 | Freshwater Lake | YLYSIVKPDMELDYAKRHARKAVEIASVLDANTGKPIQLVIQERL |
Ga0181365_10579203 | 3300017736 | Freshwater Lake | YSIVKPDMDLAYSKRHARKAVEIASVLDANTNKPLQLVVQERM |
Ga0181344_11568371 | 3300017754 | Freshwater Lake | QFALGYLASVVKPDVDVAYAKRHARRAVDIASVLDANTGKPIQLVVQERF |
Ga0181358_11976104 | 3300017774 | Freshwater Lake | DLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0181358_12193873 | 3300017774 | Freshwater Lake | CKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181358_12340561 | 3300017774 | Freshwater Lake | IGSGGQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0181357_12286474 | 3300017777 | Freshwater Lake | ALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181357_12545261 | 3300017777 | Freshwater Lake | KEGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERM |
Ga0181357_13379403 | 3300017777 | Freshwater Lake | SGGQLALGYLYSACKPNMDVAYAKRHARKAVEIASVLDANTGKPIQLVVQERF |
Ga0181349_13084262 | 3300017778 | Freshwater Lake | SACKPNMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181346_11632511 | 3300017780 | Freshwater Lake | VRKNDVEIGYAKRHARIAVEIASVLDSNTGKPLQFVVQERF |
Ga0181346_11701791 | 3300017780 | Freshwater Lake | LALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181348_10027911 | 3300017784 | Freshwater Lake | LALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0181348_10649454 | 3300017784 | Freshwater Lake | GQLALGYLYSVCKPNMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181348_12831941 | 3300017784 | Freshwater Lake | IRKPDMELDYAKRHARKAVEIASVLDTNTSKPLQFAVQERI |
Ga0181355_10560605 | 3300017785 | Freshwater Lake | SGGQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0181355_12590001 | 3300017785 | Freshwater Lake | GGQLALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181355_13778862 | 3300017785 | Freshwater Lake | LGYLYSACKPNMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181359_10835801 | 3300019784 | Freshwater Lake | LGYLYSIRKPIMDLDYIKRHARRAVEIASVLDSNTGKPLQLVVQEKL |
Ga0181359_11190533 | 3300019784 | Freshwater Lake | QLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERM |
Ga0181359_11303834 | 3300019784 | Freshwater Lake | RKPDMDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181359_11521415 | 3300019784 | Freshwater Lake | LGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0211731_101471424 | 3300020205 | Freshwater | YLYSIVKPDMDLTYAKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0211731_103814974 | 3300020205 | Freshwater | SGGQLALGYLYSIVKPDMDLTYAKRHARKAVEIASVLDANTGKPLQLVVQERL |
Ga0222713_101938184 | 3300021962 | Estuarine Water | LGYLASIVKPDMELAFAKRHARRAVDIASVLDANTGKPLQLVVQERF |
Ga0222713_105802394 | 3300021962 | Estuarine Water | QFALGYLASIVKPDMELAFAKRHARRAVDIASVLDANTGKPLQLVVQERF |
Ga0181354_11662131 | 3300022190 | Freshwater Lake | KGQLALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_11304845 | 3300022407 | Freshwater Lake | GGQLALGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_11435641 | 3300022407 | Freshwater Lake | DDMDLAYSKRHARKAVEIASVLDANTNKPLQLVVQERF |
Ga0181351_11570611 | 3300022407 | Freshwater Lake | ALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_11829231 | 3300022407 | Freshwater Lake | SGGQLALGYLYSIVKPDMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_12029922 | 3300022407 | Freshwater Lake | DVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_12041261 | 3300022407 | Freshwater Lake | LGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0181351_12457862 | 3300022407 | Freshwater Lake | IGSGGQLALGYLYSVIKPNVDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0214917_103345803 | 3300022752 | Freshwater | GSGGQLALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0214921_101020004 | 3300023174 | Freshwater | MTELELDEAKRLARKAVEIASVLDVNTGKPLQLVVQERTIF |
Ga0214919_105150234 | 3300023184 | Freshwater | IGSGGQFALGYLASIFKPDIELAYAKRHARRAVEIASVLDANTGKPLQLVVQERL |
Ga0209769_11785943 | 3300027679 | Freshwater Lake | LYSIVKPDMELDYAKRHARKAVEIASVLDANTGKPIQLVIQERL |
Ga0209087_10357411 | 3300027734 | Freshwater Lake | IDLAYAKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0209596_13576321 | 3300027754 | Freshwater Lake | YLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0209296_12105604 | 3300027759 | Freshwater Lake | ALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0209296_12504501 | 3300027759 | Freshwater Lake | KPDVDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0209296_13752531 | 3300027759 | Freshwater Lake | SICKPDMELDYAKRHARKAVEIASVLDANTGKPIQLVVQERF |
Ga0209500_103738883 | 3300027782 | Freshwater Lake | ALGYLYSIVKPDMDLAYSKRHAHKAVEIASVLDANTNKPLQLVVQERF |
Ga0209500_104225631 | 3300027782 | Freshwater Lake | VKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0209246_102580601 | 3300027785 | Freshwater Lake | SIVKPDMDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0209107_103795181 | 3300027797 | Freshwater And Sediment | KPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0209354_100235291 | 3300027808 | Freshwater Lake | ALGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTNKPLQLVVQERM |
Ga0209354_102624953 | 3300027808 | Freshwater Lake | YSICKPNMDVAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0209990_100363571 | 3300027816 | Freshwater Lake | SGGQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERL |
Ga0209400_12401571 | 3300027963 | Freshwater Lake | LPVLICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0247723_100473317 | 3300028025 | Deep Subsurface Sediment | GQLALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0247723_10973843 | 3300028025 | Deep Subsurface Sediment | GSGGQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0247723_11259471 | 3300028025 | Deep Subsurface Sediment | IGSGGQFALGYLTSVVKPNIDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
(restricted) Ga0247844_10606675 | 3300028571 | Freshwater | YSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERF |
Ga0315291_108904861 | 3300031707 | Sediment | QLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERF |
Ga0315907_111140713 | 3300031758 | Freshwater | SVIKPDVDLAYAKRHARKAVEIASVLDSNTNKPLQLVVQERM |
Ga0315290_110400191 | 3300031834 | Sediment | SIRKPIMDLDYLKRHARRAVEIASVLDSNTGKPLQLVVQEKL |
Ga0315909_107801311 | 3300031857 | Freshwater | TDLELEDAKRLARKAVEIASVLDVNTGKPLQLVVQERMI |
Ga0315909_108525733 | 3300031857 | Freshwater | KPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0315297_111570893 | 3300031873 | Sediment | YSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERL |
Ga0315904_108284372 | 3300031951 | Freshwater | GSGGQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERL |
Ga0315901_101407811 | 3300031963 | Freshwater | GQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERM |
Ga0315901_103485551 | 3300031963 | Freshwater | GSGGQLALGYLYSVIKPDVDLAYAKRHARKAVEIASVLDSNTNKPLQLVVQERM |
Ga0315901_104004861 | 3300031963 | Freshwater | GGQLALGYLYSAIKPDIDLAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0315901_104866041 | 3300031963 | Freshwater | GGQLALGYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERL |
Ga0315901_109087433 | 3300031963 | Freshwater | GQFALGYLSSIIKPNMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0315274_117420881 | 3300031999 | Sediment | GYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0315906_108038421 | 3300032050 | Freshwater | CKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERI |
Ga0315284_114422581 | 3300032053 | Sediment | ALGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0315903_104351741 | 3300032116 | Freshwater | ELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0315903_104778182 | 3300032116 | Freshwater | GQLALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERM |
Ga0315903_110047291 | 3300032116 | Freshwater | ALGYLSSIIKPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0315276_123860461 | 3300032177 | Sediment | LYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0315273_120650651 | 3300032516 | Sediment | QLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0334722_104026341 | 3300033233 | Sediment | SGGQLALGYLYSIVKPDMDLAYSKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0334722_104907661 | 3300033233 | Sediment | SIRKPDMELDYAKRHARKAVEIASVLDTNTSKPLQFAVQERI |
Ga0334981_0172049_2_142 | 3300033980 | Freshwater | GYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0334982_0075609_1_138 | 3300033981 | Freshwater | YLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0334982_0097250_1412_1555 | 3300033981 | Freshwater | LGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0334982_0486371_388_546 | 3300033981 | Freshwater | GGQLALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0334986_0034506_1_135 | 3300034012 | Freshwater | LYSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERM |
Ga0335002_0126593_1557_1691 | 3300034020 | Freshwater | LYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERF |
Ga0334987_0673430_479_595 | 3300034061 | Freshwater | PDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERL |
Ga0334987_0824284_3_161 | 3300034061 | Freshwater | GGQLALGYLYSIVKPDMDLAFAKRHARKAVEIASVLDANTNKPLQLVVQERL |
Ga0334995_0195279_3_161 | 3300034062 | Freshwater | GGQLALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERL |
Ga0334995_0614767_1_150 | 3300034062 | Freshwater | LALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0335019_0475154_2_157 | 3300034066 | Freshwater | GQFALGYMYSIVKPDMELAYAKRHARKAVEIASVLDANTGNPLQLVVQERM |
Ga0335019_0788215_3_143 | 3300034066 | Freshwater | GYLYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERL |
Ga0334990_0159043_3_113 | 3300034068 | Freshwater | MDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0334990_0347400_649_801 | 3300034068 | Freshwater | QLALGYLYSIRKPIMDLDYLKRHARRAVEIASVLDSNTGKPLQLVVQEKL |
Ga0335010_0501513_477_638 | 3300034092 | Freshwater | SGGQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTNKPLQLVVQERM |
Ga0335031_0215429_1131_1292 | 3300034104 | Freshwater | SGGQFALGYLSSIIKPDMELEYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0335036_0191074_1_108 | 3300034106 | Freshwater | DLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0335036_0370811_3_149 | 3300034106 | Freshwater | ALGYLYSAIKPNVDLAYAKRHARKAVEIASVLDSNTNKPLQLVVQERM |
Ga0335036_0582271_538_681 | 3300034106 | Freshwater | LGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPIQLVVQERL |
Ga0335036_0873416_390_512 | 3300034106 | Freshwater | QTELELDEAKRLARKAVEIASVLDVNTGKPLQLVVQERTI |
Ga0335053_0362369_761_889 | 3300034118 | Freshwater | SIVKPDMELAYAKRHARKAVEIASVLDSNTGKPIQLVVQERM |
Ga0335054_0345683_3_152 | 3300034119 | Freshwater | LALGYLYSICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLAVQERF |
Ga0335054_0443733_607_732 | 3300034119 | Freshwater | ICKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0335054_0444779_613_732 | 3300034119 | Freshwater | KPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERL |
Ga0335056_0497907_522_641 | 3300034120 | Freshwater | KPDMELTYAKRHARKAVEIASVLDSNTGKPLQLVVQERM |
Ga0335060_0313239_737_853 | 3300034122 | Freshwater | PDMELAFAKRHARRAVDIASVLDANTGKPLQLVVQERF |
Ga0335061_0534975_3_161 | 3300034168 | Freshwater | GGQLALGYLYSIVKPDMDLAYSKRHARRAVEIASVLDANTGKPLQLVVQERF |
Ga0335065_0495554_3_131 | 3300034200 | Freshwater | SIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
Ga0335013_0468427_624_758 | 3300034284 | Freshwater | LYSIVKPDMELAYAKRHARKAVEIASVLDANTGKPLQLVVQERM |
⦗Top⦘ |