 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F040616 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 38.51 % |
| % of genes from short scaffolds (< 2000 bps) | 76.40 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.671 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.795 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.248 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.82% β-sheet: 0.00% Coil/Unstructured: 93.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF01541 | GIY-YIG | 1.86 |
| PF13563 | 2_5_RNA_ligase2 | 1.24 |
| PF13871 | Helicase_C_4 | 1.24 |
| PF00271 | Helicase_C | 0.62 |
| PF13489 | Methyltransf_23 | 0.62 |
| PF16861 | Carbam_trans_C | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.67 % |
| All Organisms | root | All Organisms | 27.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.18% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.32% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.83% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.59% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.59% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.73% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.11% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.48% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.24% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.62% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.62% |
| Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.62% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_12728070 | 2035265000 | Freshwater | MIDPEDIAYEDRVSGDASSYTGNGSGEDDLADYNQNEAGDYCNE |
| RCM26_12036651 | 3300001849 | Marine Plankton | MNDYDDIGYEDSVSSDTGETYDGWPGDGSGTDDLADYNA |
| metazooDRAFT_12894272 | 3300002206 | Lake | MNDYEDVCYEDSVSSETDDYQSHGWPGDGSGEDDLADYNQNEADDYRHE |
| B570J29032_1092487921 | 3300002408 | Freshwater | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDY |
| B570J40625_1000979243 | 3300002835 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE* |
| JGI25908J49247_100915141 | 3300003277 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYCNE* |
| JGI25910J50241_100682384 | 3300003388 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYSNE* |
| JGI25909J50240_10101055 | 3300003393 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYSNE* |
| Ga0066182_100944723 | 3300004125 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYCNE* |
| Ga0068876_100922865 | 3300005527 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0049081_100723364 | 3300005581 | Freshwater Lentic | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE* |
| Ga0049080_101163472 | 3300005582 | Freshwater Lentic | MDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0049085_101812383 | 3300005583 | Freshwater Lentic | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEA |
| Ga0049084_101089691 | 3300005585 | Freshwater Lentic | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE* |
| Ga0077109_10552371 | 3300005645 | Brackish Water | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE* |
| Ga0078894_100617157 | 3300005662 | Freshwater Lake | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0078894_111467311 | 3300005662 | Freshwater Lake | NNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEADDYYAE* |
| Ga0078894_113799663 | 3300005662 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNANEAGDYYAE* |
| Ga0079957_10302769 | 3300005805 | Lake | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEADDYYNE* |
| Ga0079957_10377436 | 3300005805 | Lake | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNANEASDYSNE* |
| Ga0079957_12499243 | 3300005805 | Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYSNE* |
| Ga0075470_100134617 | 3300006030 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYY |
| Ga0075470_101024294 | 3300006030 | Aqueous | NNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYGE* |
| Ga0070744_102429063 | 3300006484 | Estuarine | DPEDIAYEDRASGDANSYTGNGSGEDDLADYNQNEADDYTNE* |
| Ga0075471_100798805 | 3300006641 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNE |
| Ga0075471_102306222 | 3300006641 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE* |
| Ga0075471_106615501 | 3300006641 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNESGDYYNE* |
| Ga0070749_102206443 | 3300006802 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYAE* |
| Ga0075473_102276392 | 3300006875 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYGE* |
| Ga0099848_12415542 | 3300007541 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE* |
| Ga0102861_10627524 | 3300007544 | Estuarine | MIDPEDISYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE* |
| Ga0102875_10554955 | 3300007547 | Estuarine | NMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE* |
| Ga0102913_10292524 | 3300007560 | Estuarine | MIDPEDISYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE* |
| Ga0102896_10411427 | 3300007618 | Estuarine | YEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYCNE* |
| Ga0102865_10142166 | 3300007639 | Estuarine | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAYDYTNE* |
| Ga0102862_10587055 | 3300007670 | Estuarine | EDRISGDADSYTGNGSGEDDLADYNQNEADDYTNE* |
| Ga0104986_16295 | 3300007734 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEASDYYNE* |
| Ga0105749_10370672 | 3300007864 | Estuary Water | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEA |
| Ga0105746_100250510 | 3300007973 | Estuary Water | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAYDY |
| Ga0105746_10045696 | 3300007973 | Estuary Water | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYSNE* |
| Ga0105746_13543401 | 3300007973 | Estuary Water | EDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYSNE* |
| Ga0105748_103990463 | 3300007992 | Estuary Water | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDYCNE* |
| Ga0102893_11092464 | 3300008052 | Estuarine | LINNNMIDPEDIAYEDRVSGDAVSYTGNGSGEVDLADYNQNEAGDYCNE* |
| Ga0108970_113156914 | 3300008055 | Estuary | MDPEDIAYEDRVSGDAYSYTGDGSGEDDLADYNANEAGDYCNE* |
| Ga0114340_10156073 | 3300008107 | Freshwater, Plankton | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFADYNQNEADDYYNE* |
| Ga0114340_10454086 | 3300008107 | Freshwater, Plankton | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0114340_11699412 | 3300008107 | Freshwater, Plankton | MDPEDIAYEDSVSSNTAGWPGDGSGEDDFQDYNQNEAGDYYAE* |
| Ga0114343_100272012 | 3300008110 | Freshwater, Plankton | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE* |
| Ga0114343_10791663 | 3300008110 | Freshwater, Plankton | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNANEAGDYYAE* |
| Ga0114343_10825135 | 3300008110 | Freshwater, Plankton | NNNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0114347_10810752 | 3300008114 | Freshwater, Plankton | MDPEDIAYEDSVSSDTAGWPGVGSGEDDFQDYNANEAGDYYAE* |
| Ga0114351_12713311 | 3300008117 | Freshwater, Plankton | EDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE* |
| Ga0114355_11018085 | 3300008120 | Freshwater, Plankton | EDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYGE* |
| Ga0114355_11408554 | 3300008120 | Freshwater, Plankton | DSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE* |
| Ga0114336_13404212 | 3300008261 | Freshwater, Plankton | MIDPEDIVYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE* |
| Ga0114337_12719453 | 3300008262 | Freshwater, Plankton | MDPEDIAYEDSVSSNTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0114363_11843083 | 3300008266 | Freshwater, Plankton | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNANEAGDYYAE* |
| Ga0114364_11959612 | 3300008267 | Freshwater, Plankton | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYSNE* |
| Ga0114973_106910271 | 3300009068 | Freshwater Lake | NNNMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE* |
| Ga0105103_103150283 | 3300009085 | Freshwater Sediment | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDYYAE* |
| Ga0114980_102204942 | 3300009152 | Freshwater Lake | MIDPEDIAFEDRVSGDADSYTGNGSGEDDLADYNQNEADDYCNE* |
| Ga0114968_103888712 | 3300009155 | Freshwater Lake | MIDPEDISYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYSNE* |
| Ga0105104_101359784 | 3300009168 | Freshwater Sediment | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDFADYNANEAGDYYAE* |
| Ga0114974_101185132 | 3300009183 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNANEAGDYSNE* |
| Ga0114976_103402164 | 3300009184 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTN |
| Ga0129333_108787391 | 3300010354 | Freshwater To Marine Saline Gradient | NNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE* |
| Ga0129333_109382213 | 3300010354 | Freshwater To Marine Saline Gradient | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYGE* |
| Ga0129333_109827521 | 3300010354 | Freshwater To Marine Saline Gradient | MDPEDIAYEDSFSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE* |
| Ga0129333_113536072 | 3300010354 | Freshwater To Marine Saline Gradient | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYCNE* |
| Ga0129336_103380401 | 3300010370 | Freshwater To Marine Saline Gradient | NNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE* |
| Ga0129336_103502764 | 3300010370 | Freshwater To Marine Saline Gradient | YEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYGE* |
| Ga0151620_10257862 | 3300011268 | Freshwater | MIDPEDIAYEDRISGDADSYTGNGSGEDDLADYNQNEASDYCNE* |
| Ga0153697_119536 | 3300011334 | Freshwater | MIDPEDIAYEDRVSGDASSYTGNGSGEDDFQDYNQNEAGDYYNE* |
| Ga0153703_132337 | 3300011336 | Freshwater | MIDPEDIAYEDRVSGDASSYTGNGSGEDDLADYGNNEAWEDYRDE* |
| Ga0119955_10433533 | 3300012006 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGGY* |
| Ga0164294_100683886 | 3300013006 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEVGDYTNE* |
| (restricted) Ga0172367_101838522 | 3300013126 | Freshwater | MDPEDIAYEDSASSDTAGWPGDGSGEDDLADYNQNEASDYYNE* |
| Ga0181343_10037581 | 3300017766 | Freshwater Lake | EDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0181343_10543985 | 3300017766 | Freshwater Lake | EDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0181343_11098361 | 3300017766 | Freshwater Lake | PEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEADDYYAE |
| Ga0181601_107082162 | 3300018041 | Salt Marsh | MDPEDIAYEDRVSGDAYSYTGDGSGEDDFADYNQNEASDYSNE |
| Ga0187843_100555096 | 3300019093 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEASDYSNE |
| Ga0181359_10164303 | 3300019784 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYCNE |
| Ga0181359_10280825 | 3300019784 | Freshwater Lake | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0181359_11093902 | 3300019784 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYGE |
| Ga0181359_12048423 | 3300019784 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYCNE |
| Ga0194113_100328471 | 3300020074 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYRD |
| Ga0194111_100647052 | 3300020083 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGVDDFADYNQNEADDYRD |
| Ga0211732_15992393 | 3300020141 | Freshwater | LNNNNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0211736_105984961 | 3300020151 | Freshwater | DIAYEDRVSGDASSYTGNGSGEDDLADYNQNEVGDYCNE |
| Ga0194131_100816046 | 3300020193 | Freshwater Lake | NNNKHMDPEDIAYEDSVSSDTAGWPGDGSGVDDFADYNQNEADDYRD |
| Ga0194128_101820744 | 3300020197 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNE |
| Ga0208201_1029454 | 3300020480 | Freshwater | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDYYAE |
| Ga0208234_10146723 | 3300020515 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0208722_10492343 | 3300020537 | Freshwater | PEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE |
| Ga0194133_1001278623 | 3300021091 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDY |
| Ga0222714_100219371 | 3300021961 | Estuarine Water | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0222714_102074894 | 3300021961 | Estuarine Water | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNESGDYSNE |
| Ga0222713_100175666 | 3300021962 | Estuarine Water | MIDPEDIAYEDRISGDADSYTGNGSGEDDLADYNQNEASDYCNE |
| Ga0222713_103593831 | 3300021962 | Estuarine Water | MDPEDIAYEDSVSGDAYSYTGDGSGEDDLADYNQNEAGDYCNE |
| Ga0222713_105102361 | 3300021962 | Estuarine Water | NNMIDPEDISYEDRVSGDADSYTGYGSGEDDLADYNQNEADDYCNE |
| Ga0222712_100301788 | 3300021963 | Estuarine Water | MIDPEDISYEDRVSGDADSYTGYGSGEDDLADYNQNEADDYCNE |
| Ga0181353_10112465 | 3300022179 | Freshwater Lake | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEADDYYAE |
| Ga0181353_10244235 | 3300022179 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNANEAGDYYAE |
| Ga0181351_11926914 | 3300022407 | Freshwater Lake | AYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE |
| Ga0181351_12002543 | 3300022407 | Freshwater Lake | EDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0214921_100428796 | 3300023174 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEVGDYTNE |
| Ga0214919_100671224 | 3300023184 | Freshwater | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDYCNE |
| Ga0214919_102925495 | 3300023184 | Freshwater | NMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE |
| Ga0214919_103518031 | 3300023184 | Freshwater | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYNQNEAGDYSNE |
| Ga0244776_101590726 | 3300024348 | Estuarine | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE |
| Ga0255236_11444182 | 3300024563 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0208546_10381473 | 3300025585 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYGE |
| Ga0208161_10504326 | 3300025646 | Aqueous | LNNNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE |
| Ga0208783_104106422 | 3300025872 | Aqueous | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNESGDYYNE |
| Ga0255090_10070717 | 3300027123 | Freshwater | MDPEDIAYEDSFSSDTAGWPGDGSGEDDFADYNQNEAGDYYAE |
| Ga0255067_10202292 | 3300027129 | Freshwater | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFADYNQNEADDYYNE |
| Ga0255110_10732493 | 3300027132 | Freshwater | NNNNMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE |
| Ga0255069_10012296 | 3300027134 | Freshwater | EDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0255065_10105921 | 3300027142 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQ |
| Ga0255114_10548111 | 3300027145 | Freshwater | YEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE |
| Ga0208555_10331253 | 3300027213 | Estuarine | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAYDYTNE |
| Ga0255087_10753913 | 3300027337 | Freshwater | NNNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYAE |
| Ga0255125_10856051 | 3300027534 | Freshwater | NMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYSNE |
| Ga0208974_11739781 | 3300027608 | Freshwater Lentic | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAG |
| Ga0208974_11854352 | 3300027608 | Freshwater Lentic | MDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0209553_10293604 | 3300027688 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDGGEDDLADYNQNEAGDYSNE |
| Ga0209597_13098083 | 3300027746 | Freshwater Lake | EDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE |
| Ga0209596_12784853 | 3300027754 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDY |
| Ga0209444_100842001 | 3300027756 | Freshwater Lake | YEDRVSGDADSYTGNGSGEDDLADYNQNEADDYCNE |
| Ga0209444_102348083 | 3300027756 | Freshwater Lake | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEADDYYAE |
| Ga0209296_10809844 | 3300027759 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNANEAGDYSNE |
| Ga0209296_11602453 | 3300027759 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEVGDYCNE |
| Ga0209296_11894814 | 3300027759 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQN |
| Ga0209296_14020561 | 3300027759 | Freshwater Lake | LINNNMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYTNE |
| Ga0209770_101914021 | 3300027769 | Freshwater Lake | MIDPEDIAYEDSVSGDTAGWPGDGSGEDDFQDYNQNEAG |
| Ga0209400_11253624 | 3300027963 | Freshwater Lake | MIDPEDISYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDY |
| Ga0209191_10468801 | 3300027969 | Freshwater Lake | YEDRVSGDADSYTGNGSGEDDLADYNQNEAYDYTNE |
| Ga0209299_13555472 | 3300027974 | Freshwater Lake | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEVGDYC |
| Ga0304730_10637294 | 3300028394 | Freshwater Lake | MIDPEDISYEDRVSGDADSYTGNGSGEDDLADYNQNEAGDYSNE |
| (restricted) Ga0247843_10031146 | 3300028569 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYSNE |
| Ga0315293_102458394 | 3300031746 | Sediment | MDPEDIAYEDRASGDANSYTGNGSGEDDLADYNQNEVADYNNE |
| Ga0315907_102161851 | 3300031758 | Freshwater | PEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0315907_108102751 | 3300031758 | Freshwater | MDPEDIAYEDSVSSNTAGWPGDGSGEDDFQDYNQNEAGDYYAE |
| Ga0315907_111696152 | 3300031758 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYCNE |
| Ga0315900_110061072 | 3300031787 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYGE |
| Ga0315909_109420052 | 3300031857 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE |
| Ga0315276_106152121 | 3300032177 | Sediment | NNNMIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEADDYTNE |
| Ga0316625_1013170513 | 3300033418 | Soil | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE |
| Ga0316616_1026767291 | 3300033521 | Soil | LNNNNNMDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEADDYYNE |
| Ga0334978_0377746_183_317 | 3300033979 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEVGDYSNE |
| Ga0334986_0058952_131_271 | 3300034012 | Freshwater | MNMIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0335002_0090351_831_965 | 3300034020 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNANEAGDYYNE |
| Ga0334987_0005508_4207_4341 | 3300034061 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDFADYNQNEADDYYNE |
| Ga0335001_0023842_1312_1446 | 3300034064 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYNE |
| Ga0335019_0452614_231_362 | 3300034066 | Freshwater | MDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNANEAGDYYNE |
| Ga0335036_0015802_119_253 | 3300034106 | Freshwater | MIDPEDIAYEDRVTGDAYSYTGDGSGEDDLADYTQNEAGDYCNE |
| Ga0335066_0055649_156_290 | 3300034112 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFQDYNQNEAGDYYNE |
| Ga0335061_0573186_444_569 | 3300034168 | Freshwater | MIDPEDIAYEDRVSGDADSYTGNGSGEDDLADYNQNEAGLY |
| Ga0335052_0643702_406_525 | 3300034279 | Freshwater | DIAYEDRVTGDAYSYTGDGSGEDDLADYTQNEAGDYCNE |
| Ga0335048_0471475_233_367 | 3300034356 | Freshwater | MIDPEDIAYEDSVSSDTAGWPGDGSGEDDFADYNQNEAGDYYAE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |