Basic Information | |
---|---|
Family ID | F040792 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 43 residues |
Representative Sequence | AQLPVEEKLRLATEKIDCSGSLEETRRQVEALAAKLRRSQAER |
Number of Associated Samples | 129 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 65.22 % |
% of genes from short scaffolds (< 2000 bps) | 61.49 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.975 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.329 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.298 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.311 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF13365 | Trypsin_2 | 52.80 |
PF04028 | DUF374 | 3.11 |
PF00834 | Ribul_P_3_epim | 3.11 |
PF05187 | ETF_QO | 0.62 |
PF13180 | PDZ_2 | 0.62 |
PF01784 | NIF3 | 0.62 |
PF00041 | fn3 | 0.62 |
PF00912 | Transgly | 0.62 |
PF13561 | adh_short_C2 | 0.62 |
PF01121 | CoaE | 0.62 |
PF07238 | PilZ | 0.62 |
PF12697 | Abhydrolase_6 | 0.62 |
PF02894 | GFO_IDH_MocA_C | 0.62 |
PF00326 | Peptidase_S9 | 0.62 |
PF00089 | Trypsin | 0.62 |
PF12833 | HTH_18 | 0.62 |
PF13517 | FG-GAP_3 | 0.62 |
PF02738 | MoCoBD_1 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 3.11 |
COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 3.11 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.62 |
COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 0.62 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.62 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.62 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 0.62 |
COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 0.62 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.98 % |
Unclassified | root | N/A | 36.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_105373503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
3300001593|JGI12635J15846_10020370 | All Organisms → cellular organisms → Bacteria | 5459 | Open in IMG/M |
3300001867|JGI12627J18819_10008751 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100253811 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100366941 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100442246 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300004082|Ga0062384_100076336 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
3300004082|Ga0062384_100401529 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300005332|Ga0066388_107422620 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005436|Ga0070713_101558509 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005526|Ga0073909_10008666 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
3300005537|Ga0070730_10980736 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005542|Ga0070732_10368284 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005554|Ga0066661_10351525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
3300005569|Ga0066705_10884680 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005575|Ga0066702_10786116 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005618|Ga0068864_101309404 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005843|Ga0068860_102412263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300005944|Ga0066788_10167834 | Not Available | 563 | Open in IMG/M |
3300006047|Ga0075024_100529975 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300006050|Ga0075028_100097600 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300006173|Ga0070716_101606182 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300006237|Ga0097621_100421994 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300006800|Ga0066660_10347291 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300009088|Ga0099830_10291601 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300009089|Ga0099828_10163251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1974 | Open in IMG/M |
3300009162|Ga0075423_10329969 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300010046|Ga0126384_10060288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2656 | Open in IMG/M |
3300010159|Ga0099796_10346820 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300010320|Ga0134109_10269124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300010322|Ga0134084_10023811 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300010322|Ga0134084_10136709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
3300010341|Ga0074045_10911145 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010359|Ga0126376_10559966 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300010361|Ga0126378_10135874 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
3300010376|Ga0126381_101954746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300010398|Ga0126383_11639126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300011270|Ga0137391_10755935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300011271|Ga0137393_11630276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012096|Ga0137389_11189330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300012189|Ga0137388_11606281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300012202|Ga0137363_10464275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
3300012202|Ga0137363_10979513 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012207|Ga0137381_10192996 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300012207|Ga0137381_10317945 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300012351|Ga0137386_10955042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300012351|Ga0137386_11255220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300012356|Ga0137371_10263255 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300012362|Ga0137361_10241615 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300012363|Ga0137390_11140535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300012582|Ga0137358_10244263 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300012683|Ga0137398_10572131 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300012918|Ga0137396_11146222 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012922|Ga0137394_10715042 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300012923|Ga0137359_11787105 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300012927|Ga0137416_11919409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300013832|Ga0120132_1139269 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300014157|Ga0134078_10613795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300014657|Ga0181522_10783944 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300014968|Ga0157379_11222077 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300015054|Ga0137420_1411986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
3300016357|Ga0182032_10616911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
3300016445|Ga0182038_12047330 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300017959|Ga0187779_10427461 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300017959|Ga0187779_10718857 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300019789|Ga0137408_1290598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300020021|Ga0193726_1089479 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300020579|Ga0210407_10426192 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300020580|Ga0210403_10519428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
3300020580|Ga0210403_11067039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300020580|Ga0210403_11235060 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300020582|Ga0210395_11350311 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300020582|Ga0210395_11420591 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300021168|Ga0210406_10305591 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300021171|Ga0210405_10734312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300021404|Ga0210389_10321885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
3300021420|Ga0210394_10385650 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300021478|Ga0210402_11882654 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300026215|Ga0209849_1059885 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300026281|Ga0209863_10155946 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300026319|Ga0209647_1236643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300026376|Ga0257167_1029105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300026550|Ga0209474_10131008 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300027565|Ga0209219_1080792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300027681|Ga0208991_1127931 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300027738|Ga0208989_10022407 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300027787|Ga0209074_10273399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300027867|Ga0209167_10100217 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300027903|Ga0209488_10501802 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300027903|Ga0209488_10994060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300028047|Ga0209526_10668259 | Not Available | 658 | Open in IMG/M |
3300031057|Ga0170834_102337630 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300031720|Ga0307469_11037854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300031740|Ga0307468_100522879 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300031782|Ga0318552_10108087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1378 | Open in IMG/M |
3300031823|Ga0307478_10911035 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300031912|Ga0306921_11599587 | Not Available | 708 | Open in IMG/M |
3300031945|Ga0310913_10769763 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300031962|Ga0307479_10051039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3973 | Open in IMG/M |
3300031962|Ga0307479_10351519 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300031962|Ga0307479_11180719 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300032180|Ga0307471_103961070 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300032770|Ga0335085_10372303 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300032770|Ga0335085_11559799 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300032783|Ga0335079_11276888 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300033290|Ga0318519_10609583 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.53% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.21% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.21% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.86% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.24% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.24% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.24% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1053735033 | 3300000955 | Soil | RRRISAQLPVEEKLRLATEKIDCSGSLEDTRRQIEALAGKLRCAQPPQ* |
JGI12635J15846_100203705 | 3300001593 | Forest Soil | IAAQLPVEEKLRLATEKIDCSGSLEETHRQVEALAFKLRRPQTAR* |
JGI12627J18819_100087511 | 3300001867 | Forest Soil | ALATERIDCSGPLEETRRQVEVFAKELGRASQGK* |
JGIcombinedJ26739_1002538113 | 3300002245 | Forest Soil | ADKLRYATEKIDCSGSLEDTRKQVEGLAAKLQSKNTQ* |
JGIcombinedJ26739_1003669412 | 3300002245 | Forest Soil | EEKLGHATERIDCSGSLAETREQVEQLATKLREVRPTV* |
JGIcombinedJ26739_1004422462 | 3300002245 | Forest Soil | PVEEKLGHATERIDCSGSLAETRQQVERFATKLREVRPTV* |
JGI25615J43890_10995901 | 3300002910 | Grasslands Soil | DEDARRRIAAQLPVAEKLRLATERIDCSGSLEHTRTQVAALAAKLRRPSAKVSS* |
JGI25616J43925_102011532 | 3300002917 | Grasslands Soil | EKLRYATEKIDCSGTLDATRRQVEALAAKLRRAHRNLSS* |
Ga0062384_1000763363 | 3300004082 | Bog Forest Soil | VEARRRIAAQMSVEEKLKSATEKIDCSGSLDETRRQVEKFAARLRRGVAGNV* |
Ga0062384_1004015292 | 3300004082 | Bog Forest Soil | SAQMPADEKLKFATEKIDCSGSLEETRRQIEELAAKLRRGTNGSV* |
Ga0062595_1012812111 | 3300004479 | Soil | AEEKLRYATEKIDCSGSMEETRRQVDELAARLKRGAAGRV* |
Ga0066388_1074226202 | 3300005332 | Tropical Forest Soil | ESRKRVASQMPVDEKLRYATERVDCSGSLDDTRRQVAALAAKLRSQPSK* |
Ga0070713_1015585091 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QLPVEGKLRYASEEIDCSGTLEETRRQVEALAQKLRRPSNKTSL* |
Ga0073909_100086665 | 3300005526 | Surface Soil | ARKRIAMQLPVPEKLAMATEKIDCSGTLEATRHQLEQLAAKLGQGLPGK* |
Ga0070730_109807361 | 3300005537 | Surface Soil | RIAAQMPVDEKLRYATQKIDCSHTLEETRRQIEALAQKLHHPSNKVL* |
Ga0070732_103682841 | 3300005542 | Surface Soil | RIDAQLPVEEKLRYATEKIDCSGTLEETRRQVEALTIKIHGASNK* |
Ga0066661_103515252 | 3300005554 | Soil | SRIAAQLPIEDKLSHATEKIDCSGSLEETRKQVEALAAKLRVNTTP* |
Ga0066699_112079962 | 3300005561 | Soil | KLRHATDKIDCSGTLEQTRQQVEALAARLHGSKAAR* |
Ga0066705_108846801 | 3300005569 | Soil | IAAQMLVEEKLRYATEKIDCSGTLEQTRRQVEALGARLHRSKAVR* |
Ga0066702_107861162 | 3300005575 | Soil | AAKMALATVKIDCSGSLDVTRRQVEEFAETLRQASPSKSSG* |
Ga0068864_1013094042 | 3300005618 | Switchgrass Rhizosphere | RIGTQMPVQEKLALAAEKIDCSGSIEETRSQVDALADKLRAAASAN* |
Ga0068860_1024122632 | 3300005843 | Switchgrass Rhizosphere | MQMPVEEKLELAAEKIDCSGSIEETRSQVDALAAKLRAAASAN* |
Ga0066788_101678341 | 3300005944 | Soil | ARNRIASQLPVEEKRKLATEQIDCSGSLEDTRRQVETLAEKLKSRG* |
Ga0075024_1005299752 | 3300006047 | Watersheds | IASQLPVEEKLSLANEKIDCSGSLEQTRRQVEALASKLRCPQAARP* |
Ga0075028_1000976002 | 3300006050 | Watersheds | AAQMPVEEKLRFATEKIDCSGSLEDTRQQVQALAAKLRPQPSNT* |
Ga0070716_1016061822 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VQMPVEQKLKFATEKIDCSGTMEQTRKQVEELAVKIRAR* |
Ga0097621_1004219941 | 3300006237 | Miscanthus Rhizosphere | QMPVEEKLKFATEKIDCSGSLEETRRQVEALAGRIRSGSRKQ* |
Ga0066659_111318251 | 3300006797 | Soil | MPVEEKLRYATEKIDCAGTLEQTRRQVEALGARLHRRKAVP* |
Ga0066660_103472911 | 3300006800 | Soil | QMLVEEKLRYATEKIDCSGTLEQTRRQVEALGARLHRSKAVR* |
Ga0079221_112399042 | 3300006804 | Agricultural Soil | VQEKLALAAEKIDCSGSIEETRSQVDALAAKLRAAASTN* |
Ga0099793_107092231 | 3300007258 | Vadose Zone Soil | DEKLRLATEKIDCSGSLEETRRQVEALAAKLRRSQAER* |
Ga0099795_101019842 | 3300007788 | Vadose Zone Soil | RLATEKIDCSSSLDETRHQVEALAAKLRRAQAAR* |
Ga0099829_116129541 | 3300009038 | Vadose Zone Soil | LRLATEKIDCSGSLEQTRLQVQSLATKLRRAQTTR* |
Ga0099830_102916011 | 3300009088 | Vadose Zone Soil | RRIAAQLSVEEKLRHATEKIDCSGALEETRRQVAALAAKFRRQTAR* |
Ga0099830_118090862 | 3300009088 | Vadose Zone Soil | VDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRGRPAR* |
Ga0099828_101632511 | 3300009089 | Vadose Zone Soil | EPEARRRIAAQLTVEEKLLLATERIDCSGSLEETRRQVEALATKLRRSQTAR* |
Ga0075423_103299691 | 3300009162 | Populus Rhizosphere | QRIGTQMPVQEKLALAAEKIDCSGSIEETRSQVDALADKLRAAASAN* |
Ga0126384_100602881 | 3300010046 | Tropical Forest Soil | QMPVEEKLSLAAEKIDCSGSLEKTRRQVEALGAKLQADSHPD* |
Ga0099796_103468201 | 3300010159 | Vadose Zone Soil | QLPMEDKLRHATQKIDCSGSLEETRKQVEALAAKLRVNTTP* |
Ga0134109_102691242 | 3300010320 | Grasslands Soil | RIAAQLPVEEKLRLATEKIDCSGSLEETRRQVEARAAKLRRSPAER* |
Ga0134084_100238111 | 3300010322 | Grasslands Soil | RIAAQLPVEEKLLLATEKIDCSGSLEETRRQVEALAAKLRRNRTTR* |
Ga0134084_101367091 | 3300010322 | Grasslands Soil | RIAAQMPVEEKLRYATEKIDCSGTLEQTRRQVEALGARLHRRKAVP* |
Ga0074045_109111452 | 3300010341 | Bog Forest Soil | AQMPAEEKLKFATAKIDCSGSLEETRRQVEELTAKLRRGAAENV* |
Ga0126376_105599662 | 3300010359 | Tropical Forest Soil | IAAQMPVEEKLKLATYKIDCSGSIEETRRQVQELANTLRT* |
Ga0126378_101358744 | 3300010361 | Tropical Forest Soil | EARQRIAMQMPVEEKLSLAAEKIDCSGSLEKTRRQVEALGAKLQADSHPD* |
Ga0126381_1019547461 | 3300010376 | Tropical Forest Soil | QMPVEEKLRYATEKIDCTGPLEQTRQQVEALAAKLHRSKAGR* |
Ga0126383_116391261 | 3300010398 | Tropical Forest Soil | QMPVEEKLKQATEKVDCSGSLEQTRRQVEGLAAKLRRRLAAS* |
Ga0150983_145406131 | 3300011120 | Forest Soil | EKLRFATEKIDCSGSLEATRTQVAALAAKLRRPSTKVSST* |
Ga0137391_107559352 | 3300011270 | Vadose Zone Soil | IAAQLPVDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRGRPAR* |
Ga0137393_112969912 | 3300011271 | Vadose Zone Soil | LRLATEKIDCSGSLEETRRQVEALAAKLRRSRPAP* |
Ga0137393_116302761 | 3300011271 | Vadose Zone Soil | QLPVEEKLRLATEKIDCSGSLEETRRQVAALAARLRRSRAER* |
Ga0137389_111893301 | 3300012096 | Vadose Zone Soil | ISAQMPAEEKLRHATEKIDCSGTLGQTRRQVEALAAKLHRTKAAQ* |
Ga0137388_116062811 | 3300012189 | Vadose Zone Soil | RIAAQLPVDEKLRLATEKIDCSGSLEETRRQVEALATKLRRSQPAR* |
Ga0137388_120406202 | 3300012189 | Vadose Zone Soil | VDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRGRPAP* |
Ga0137363_104642752 | 3300012202 | Vadose Zone Soil | QLPVEEKLRLATEKIDCSGSLEETRGQVEALATKLRHSQTVR* |
Ga0137363_109795132 | 3300012202 | Vadose Zone Soil | DARRRVAAQLPVDDKLRHATEKIDCSGSIKETRKQVEALAAKLRTSSTP* |
Ga0137380_116810832 | 3300012206 | Vadose Zone Soil | VEEKLRHATEKIDCSGSLEETRRQIAALAAKLRRQTAR* |
Ga0137381_101929963 | 3300012207 | Vadose Zone Soil | RIAAQLAVEEKLLLATEKIDCSGSLEETRRQVEALAAKLRRNRTTR* |
Ga0137381_103179452 | 3300012207 | Vadose Zone Soil | QLPVEEKLRLATEKIDCSGSLEETRRQVEAFAVRLRFSQMAR* |
Ga0137386_109550422 | 3300012351 | Vadose Zone Soil | AAQMPVEEKVRLATEKIDCSSTLEQTRQQVEALAVKLHRSKAAR* |
Ga0137386_112552202 | 3300012351 | Vadose Zone Soil | RRIAAQLSVEEKLRHATEKIDCSGSLEETRRQIAALAAKLRRQTAR* |
Ga0137371_102632551 | 3300012356 | Vadose Zone Soil | RERLVARGLTEAEARRRIAAQFSVVFKQTPATEKIDCSGSLEETRRQVAALAAKFRRQTAR* |
Ga0137360_105190141 | 3300012361 | Vadose Zone Soil | KLRHATEKIDCSGSLEETRKQVEALAAKLRVNTTP* |
Ga0137361_102416153 | 3300012362 | Vadose Zone Soil | AQLPVEEKLRLATEKIDCSGSLEETRRQVEALAAKLRRSQAER* |
Ga0137361_117758761 | 3300012362 | Vadose Zone Soil | LLATEKIDCSGSLEATRRQVETLAAKLRRTQAARP* |
Ga0137390_111405351 | 3300012363 | Vadose Zone Soil | RIAAQLPVDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRSRPAR* |
Ga0137358_102442631 | 3300012582 | Vadose Zone Soil | TRIAAQLPMEDKLSHATEKIDCSRSLEETRKQVEALAAKLRVNTTP* |
Ga0137398_105721311 | 3300012683 | Vadose Zone Soil | GFTDTDARRRIAAQLPVDDKLRHATEKIDCSGSIKETRKQVEALAAKLRTNTTP* |
Ga0137398_107288121 | 3300012683 | Vadose Zone Soil | LPVDEKLRLATEKIDCSGSLEETRRQVAALAAKLRRDQTTR* |
Ga0137397_104920562 | 3300012685 | Vadose Zone Soil | EEKLRIAAEKIDCSGSLEETRHQVEALAGKLRCAQPPQ* |
Ga0137396_103387001 | 3300012918 | Vadose Zone Soil | EKLRLATEKIDCSGSLEETRRQVAALAARLRRSLAER* |
Ga0137396_111462221 | 3300012918 | Vadose Zone Soil | EARRRMAMQLSVAEKLRYATEKIDCSGSLEETRRQVEALAARLRRKAASS* |
Ga0137394_103636101 | 3300012922 | Vadose Zone Soil | RHATEKIDCSGSFEETRRQVEALAGKLRRAQPRQ* |
Ga0137394_107150422 | 3300012922 | Vadose Zone Soil | ARTRIAAQLPVEDKLSHATEKIDCSGSLEETRKQVEALAAKLRVNTTP* |
Ga0137359_116515692 | 3300012923 | Vadose Zone Soil | EKLRLATEKIDCSGSLEETRRQVQALAGKLRGAQPPP* |
Ga0137359_117871051 | 3300012923 | Vadose Zone Soil | ARTRIAAQLPMEDKLRHATEKIDCSGSLEETRKQVEALAAKLRVNTTP* |
Ga0137419_109899852 | 3300012925 | Vadose Zone Soil | VEEKLRLATEKIDCSGSLEETRRQVEALATILRRSQMAR* |
Ga0137416_119194092 | 3300012927 | Vadose Zone Soil | AQLPVEEKLLLATEKIDCSGSLEQTRRQVEALAAKLRRGQSAR* |
Ga0137404_107355071 | 3300012929 | Vadose Zone Soil | LPVEEKLRHATEKIDCSGSFEETRRQVEALAGKLRRAQPPQ* |
Ga0137404_110525132 | 3300012929 | Vadose Zone Soil | EKLRLATEKIDCSGSLEDTRAQIQALAEKLRRAA* |
Ga0120132_11392692 | 3300013832 | Permafrost | AQLPVEEKLRRATDKIDCSGSLAETRSQVELLVTKLRAARPTD* |
Ga0134078_106137951 | 3300014157 | Grasslands Soil | RRRIAAQMPVEEKLRLATEKIDCSGTLGQTRQQVEALAAKLHRSKAAR* |
Ga0181522_107839442 | 3300014657 | Bog | ASQMPQEEKLRHAKYKIDCSQSIEETRRQVAQLAQILRPPQ* |
Ga0157379_112220772 | 3300014968 | Switchgrass Rhizosphere | QMPVQEKLALAEEKIDCSGSMEETRRQVDALAARLRAASPAV* |
Ga0137420_14119862 | 3300015054 | Vadose Zone Soil | RRRIAAQLPVEEKLRLATEKIDCSGSIEETRRQVEALATKLRRSQMAR* |
Ga0132258_122492971 | 3300015371 | Arabidopsis Rhizosphere | MPAEEKLKFATEKIDCSGSLEETRRQVEALAARIRSGSRKQ* |
Ga0182036_116869551 | 3300016270 | Soil | KLRQATYSIDCSGSLESTHSQVVSLAAKLRKKSSP |
Ga0182032_106169111 | 3300016357 | Soil | RGRIAAQLPINEKLRHATYSIDCSGSLESTRSQVVSLAATLRKKSSP |
Ga0182037_110716381 | 3300016404 | Soil | LRHATERIDCSGTLRETRREVEALAAKLRSRPSNS |
Ga0182038_120473302 | 3300016445 | Soil | QMPAEEKLALATEKIDCSGSFDETRRQVDALASKLRAASVAR |
Ga0187779_101541061 | 3300017959 | Tropical Peatland | EKLRYATEKIDCSGTLEETRAQVRALASKLRKKALG |
Ga0187779_104274611 | 3300017959 | Tropical Peatland | EPEARLRMAAQMPVDEKLQHATERIDCSGTMEETRAQVRALAGRLRSSSS |
Ga0187779_107188571 | 3300017959 | Tropical Peatland | IAAQMPVDEKLRHATEKIDCSGTLEETLAQVRELAAKLRKAAN |
Ga0187781_104278951 | 3300017972 | Tropical Peatland | PVEEKLKHATERIDCSGSLEETWAQVRELAARIRKSKMENGK |
Ga0137408_12905982 | 3300019789 | Vadose Zone Soil | RRIAAQLPVAEKLRLATEKIDCSGSLEQTRLQVQALATKLRRAQAVR |
Ga0193726_10894791 | 3300020021 | Soil | IELQLPVSEKLARATEKIDCSGSLEETRRQVAELAAKLRSDPESVQI |
Ga0210407_104261921 | 3300020579 | Soil | RIASQMPVEEKLKFATVKIDCSGTLEETRTEVEELAKGLREKK |
Ga0210403_105194282 | 3300020580 | Soil | AAQLPVDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRNQTTR |
Ga0210403_110670391 | 3300020580 | Soil | AEARRRIAAQLPVAEKLRQATEKIDCSHSIEETRRQVEALAAKLRRQPQKS |
Ga0210403_112350602 | 3300020580 | Soil | RIAAQLPMTEKLTHATEKIDCSGSLEDTRRQVQSLAASLRSKTATPQQ |
Ga0210399_100208581 | 3300020581 | Soil | PVDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRNQTTR |
Ga0210395_113503111 | 3300020582 | Soil | RRIAAQMPAEEKLKYATEKIDCSGSLEETRRQVGELAGRLRTGEKSDVKK |
Ga0210395_114205912 | 3300020582 | Soil | RRRIAAQLPVEEKLRLSTEKIDCSGSLEETRRQVTALAVKLRRVQPPK |
Ga0210401_105395752 | 3300020583 | Soil | VAEKLHFATEKIDCSGSLEDTRTQVAALAAKLRRLSTKVSS |
Ga0210404_105902631 | 3300021088 | Soil | LPVEEKLRLATEKIDCSGSLEETRRQVTALAVKLRRVHPSK |
Ga0210406_103055912 | 3300021168 | Soil | AQLPVEEKLRLATEKIDCSGTLEETRLQVEALAIKLRRAPSVP |
Ga0210400_115377182 | 3300021170 | Soil | EKLKFATQEIDCSGSLEETRRQVEELAAKLRRGTNASV |
Ga0210405_107343122 | 3300021171 | Soil | ARRRIAMQLPVAEKLRYASEKIDCSGSLEQTRHQVEALAAKLRRSSAQT |
Ga0210405_112869572 | 3300021171 | Soil | KLRFATEKIDCSGSLEDTRTQTAALAAKLRRPSTKVSS |
Ga0210405_113957041 | 3300021171 | Soil | AEKLHFATEKIDCSGSLEDTRTQVAALAAKLRRLSTKVSS |
Ga0210408_100246575 | 3300021178 | Soil | KLLLATEKIDCTGSLEATRRQVEALAFKLRRAQTAQP |
Ga0210389_103218851 | 3300021404 | Soil | AQLPMTEKLTHATEKIDCSGSLEDTRRQVQSLAASLRSKTATPQQ |
Ga0210394_103856502 | 3300021420 | Soil | IAAQLPVDEKLRLATEKIDCSGSLEETRRQVEALAAKLRRNQTTR |
Ga0210402_118826542 | 3300021478 | Soil | AQLPIAEKLSYATEKIDCSGSLEDTRAQVATLAAKLRRDVRDVSS |
Ga0210402_119056581 | 3300021478 | Soil | EDKLRYATEKIDCSGSLQETRRQVESLARKLHGSRPLP |
Ga0210410_108876802 | 3300021479 | Soil | VAEKLRHATEKIDCSGSLEETRRQVQALAAKLRAF |
Ga0213853_110638512 | 3300021861 | Watersheds | LPTEEKLRFATEKIDCSGTLEETRRQVEALAIKLRRAPSTP |
Ga0213853_110774931 | 3300021861 | Watersheds | KLSLANEKIDCSGSLEQTRRQVEALAFKLRRAQTATP |
Ga0207676_114497072 | 3300026095 | Switchgrass Rhizosphere | EKLALAAEKIDCSGSIEETRSQVDALADKLRAAASAN |
Ga0209849_10598851 | 3300026215 | Soil | PVEEKVQQATETIDCSGPMTETKRQVEQLATKLRGMRPSH |
Ga0209863_101559462 | 3300026281 | Prmafrost Soil | DARRRMAAQLPVEEKVQQATETIDCSGPMTETKRQVEQLATKLRGMRPSH |
Ga0209235_11772071 | 3300026296 | Grasslands Soil | VEEKLYLATEKIDCSGSLEETRRQVQALATKLRLEAART |
Ga0209647_12366431 | 3300026319 | Grasslands Soil | ARRRIAAQLPVEEKLLLATEKIDCSGSLEATRRQVETLAAKLRRTQAARP |
Ga0257167_10291051 | 3300026376 | Soil | EEEARRRIAMQLSVAEKMRYATEKIDCSGSLEETRRQVETLAARLRRTTSKS |
Ga0209156_100326011 | 3300026547 | Soil | KLRLATEKIDCSGTLEETRSQVEALATKLRCTQTAR |
Ga0209156_100951613 | 3300026547 | Soil | VEEKLLLATEKIDCSGSLEETRRQVEALAAKLRRNRTTR |
Ga0209474_101310081 | 3300026550 | Soil | AAQLPVEEKLRLATEKIDCSGTLEETRHQVEALASKLRFSQTAW |
Ga0209219_10807921 | 3300027565 | Forest Soil | LGHATERIDCSRSIAETRQQVEQLATKLREVRPTA |
Ga0208991_11279311 | 3300027681 | Forest Soil | QLPVEEKLGHATEKIDCSGSLTETRQQVEQLATKLREVRPTI |
Ga0208989_100224073 | 3300027738 | Forest Soil | TEEEACRRIASQLPVEEKLGHATEKIDCSGSLTETRQQVEQLATKLREVRPTI |
Ga0209074_102733991 | 3300027787 | Agricultural Soil | RISAQMPVEEKLRHATERIDCSGTLEQTRRQVEALGARLHRSKATR |
Ga0209180_107572891 | 3300027846 | Vadose Zone Soil | LRLATEKIDCSGSLEQTRLQVQSLATKLRRAQTTR |
Ga0209167_101002171 | 3300027867 | Surface Soil | PVDEKLRYATQKIDCSHTLEETRRQIEALAQKLHHPSNKVL |
Ga0209167_103546831 | 3300027867 | Surface Soil | EDKLRYATEKIDCSGSLQETRRQVEALARKLHGGRPLP |
Ga0209488_105018022 | 3300027903 | Vadose Zone Soil | QLPFDDKLRHATEKIDCSGSLEETRKQVEALAAKLRVNTTP |
Ga0209488_109940601 | 3300027903 | Vadose Zone Soil | RRRIAAQLPVAEKLRLATEKIDCSGSLEQTRLQVQALATKLRRAQAVR |
Ga0209526_106682592 | 3300028047 | Forest Soil | RRRIGSQLPVEEKLGHATERIDCSGSLAETRQQVEQLATKLREVRPTV |
Ga0311357_116719482 | 3300030524 | Palsa | AQLPVEEKIKFATETIDCSGSLEQTRKQVEALAAKLRHA |
Ga0170834_1023376301 | 3300031057 | Forest Soil | SEREARKRIALQMPVQEKLALATDKINCSGSLEETRQQVEALAAKLRQA |
Ga0170823_142634621 | 3300031128 | Forest Soil | KLKFATMKIDCSGTLEETRRQVEELTKGLRERSNE |
Ga0310686_1091076911 | 3300031708 | Soil | LPVEEKLRLATEKIDCSGSMEETRREVAAFAVKLRRAQPAP |
Ga0307474_107886992 | 3300031718 | Hardwood Forest Soil | EEKLRHATEKIDCSSSLEETRRQVVALAARLRRNQSA |
Ga0307469_110378542 | 3300031720 | Hardwood Forest Soil | EPEACRRIAAQLPVEEKLLLATEKIDCSGSLDETRRQVEALAAKLRRTHAAR |
Ga0307468_1005228792 | 3300031740 | Hardwood Forest Soil | QMPVAEKLALATEKIDCSGSMEETRRQVDALAAKLRAAAPAT |
Ga0307477_107728971 | 3300031753 | Hardwood Forest Soil | SVTEKLRYATEKIDCSGSLEETRRQVEVLGARLRRKAASS |
Ga0318552_101080872 | 3300031782 | Soil | KRRIAAQLPLEDKLKYATETIDCSGTLEQTRAQVRALAAKLRRH |
Ga0307473_115451501 | 3300031820 | Hardwood Forest Soil | KLRFATEKIDCSGSLEETRRQVEALAAKLRGSVSPKR |
Ga0307478_109110352 | 3300031823 | Hardwood Forest Soil | ASQMPVEEKLKFATVKMDCSGTLEETRRQVEELAKGLREKK |
Ga0306921_115995872 | 3300031912 | Soil | LARGTSEVEARRRIAAQLPINEKLRHATYAIDCSRSLDDTRSQVESLAAKLHKQSSS |
Ga0310913_107697631 | 3300031945 | Soil | AAQMPAENKLALATEKIDCSGSLDETRRQVDVLAARLRAASLLK |
Ga0307479_100510396 | 3300031962 | Hardwood Forest Soil | EDARRRIAAQLPTAQKLSYATEKIDCSGSLEDTRKQVKALAAKLRVNRAT |
Ga0307479_101776701 | 3300031962 | Hardwood Forest Soil | QLPIDEKLRFATEKIDCSGSLETTRTQVAALAAKLRRPSTKV |
Ga0307479_103515192 | 3300031962 | Hardwood Forest Soil | EDARRRIAAQLPVTEKLRHATEKIDCSGSLEDTRKQVGALAAKLRAKTTP |
Ga0307479_111807191 | 3300031962 | Hardwood Forest Soil | QLPVAEKLRHATEKIDCSGSLEATRAQVAALAAKLRRSSTKMSS |
Ga0318518_100219154 | 3300032090 | Soil | SEKLRYATEKIDCSGTLDETRQQVEALAAKLHRSKAAQ |
Ga0307471_1039610701 | 3300032180 | Hardwood Forest Soil | AAQMPVADKLALATEKIDCSGSLEDTQRQVEAFATKLRQSSGR |
Ga0335085_103723031 | 3300032770 | Soil | IAAQMPVEEKLRFATEKIDCSGTLEETRTQVRALASKLRAMR |
Ga0335085_115597991 | 3300032770 | Soil | EAKARIALQLSTEEKLQYATERIDCSGSLEQTRRQIEALAVKWRQG |
Ga0335079_112768881 | 3300032783 | Soil | RIAAQMPLEEKLKYATEKVDCSGTLEETREQVGSLAKRLRKA |
Ga0335076_100335781 | 3300032955 | Soil | QMPVEEKLKHATERIDCSGAMEETRAQVKALAERLRKV |
Ga0318519_106095832 | 3300033290 | Soil | ATQMPVQEKLTLAEEKIDCSGSMEETRYQVDALAARLRALPRSN |
⦗Top⦘ |