NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040895

Metagenome / Metatranscriptome Family F040895

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040895
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 44 residues
Representative Sequence SIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Number of Associated Samples 141
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.89 %
% of genes from short scaffolds (< 2000 bps) 93.17 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.565 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.646 % of family members)
Environment Ontology (ENVO) Unclassified
(31.677 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.099 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.54%    Coil/Unstructured: 72.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF01266DAO 50.93
PF04185Phosphoesterase 9.94
PF04237YjbR 3.11
PF00296Bac_luciferase 2.48
PF13412HTH_24 1.86
PF01037AsnC_trans_reg 1.24
PF01740STAS 1.24
PF13404HTH_AsnC-type 1.24
PF00202Aminotran_3 1.24
PF12697Abhydrolase_6 1.24
PF00196GerE 0.62
PF00472RF-1 0.62
PF13579Glyco_trans_4_4 0.62
PF06718DUF1203 0.62
PF08029HisG_C 0.62
PF16656Pur_ac_phosph_N 0.62
PF00248Aldo_ket_red 0.62
PF07884VKOR 0.62
PF12900Pyridox_ox_2 0.62
PF13520AA_permease_2 0.62
PF11716MDMPI_N 0.62
PF10604Polyketide_cyc2 0.62
PF01370Epimerase 0.62
PF06026Rib_5-P_isom_A 0.62
PF08282Hydrolase_3 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 9.94
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 3.11
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.48
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 0.62
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.62
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.62
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.62
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.62
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.62
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.62
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.62
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.62
COG4243Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formationGeneral function prediction only [R] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.57 %
UnclassifiedrootN/A30.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig10453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia993Open in IMG/M
2199352025|deepsgr__Contig_175874All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300001991|JGI24743J22301_10151698Not Available519Open in IMG/M
3300002245|JGIcombinedJ26739_100615360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300004635|Ga0062388_100322260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1302Open in IMG/M
3300005187|Ga0066675_11189881Not Available566Open in IMG/M
3300005435|Ga0070714_101614109Not Available633Open in IMG/M
3300005537|Ga0070730_10252797All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300005541|Ga0070733_10274012Not Available1112Open in IMG/M
3300005559|Ga0066700_10835998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales617Open in IMG/M
3300005591|Ga0070761_10461268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia780Open in IMG/M
3300005598|Ga0066706_10783127All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300005602|Ga0070762_10033998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2744Open in IMG/M
3300005610|Ga0070763_10727915Not Available583Open in IMG/M
3300006028|Ga0070717_11414410Not Available632Open in IMG/M
3300006052|Ga0075029_100376676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae919Open in IMG/M
3300006162|Ga0075030_100517361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae948Open in IMG/M
3300006163|Ga0070715_10259723All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006804|Ga0079221_10129725All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300006806|Ga0079220_10484737All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300006914|Ga0075436_101456034Not Available520Open in IMG/M
3300009143|Ga0099792_10852928Not Available600Open in IMG/M
3300009524|Ga0116225_1543681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300009525|Ga0116220_10235903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300010048|Ga0126373_10674005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1091Open in IMG/M
3300010048|Ga0126373_12289559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300010359|Ga0126376_10987747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae841Open in IMG/M
3300010361|Ga0126378_12096993Not Available645Open in IMG/M
3300010376|Ga0126381_104264439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300010401|Ga0134121_11269169Not Available740Open in IMG/M
3300010880|Ga0126350_10973688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300012208|Ga0137376_11241757Not Available635Open in IMG/M
3300012358|Ga0137368_10519577Not Available765Open in IMG/M
3300012359|Ga0137385_10003719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia13276Open in IMG/M
3300012361|Ga0137360_11279047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300012495|Ga0157323_1005495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300013100|Ga0157373_10618786Not Available789Open in IMG/M
3300014164|Ga0181532_10486899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae677Open in IMG/M
3300014838|Ga0182030_11428702Not Available575Open in IMG/M
3300016270|Ga0182036_10266033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1290Open in IMG/M
3300016319|Ga0182033_10332811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1264Open in IMG/M
3300016319|Ga0182033_10890087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300016357|Ga0182032_11487744Not Available588Open in IMG/M
3300016371|Ga0182034_10531060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300016387|Ga0182040_10175042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300017821|Ga0187812_1110460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300017821|Ga0187812_1252527Not Available562Open in IMG/M
3300017822|Ga0187802_10193104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300017823|Ga0187818_10283214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300017926|Ga0187807_1085335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300017934|Ga0187803_10198887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300017942|Ga0187808_10245207Not Available801Open in IMG/M
3300017947|Ga0187785_10362644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300017955|Ga0187817_10120854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1657Open in IMG/M
3300017973|Ga0187780_10702809Not Available729Open in IMG/M
3300017995|Ga0187816_10449654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300018060|Ga0187765_11208560Not Available531Open in IMG/M
3300020199|Ga0179592_10092582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1388Open in IMG/M
3300020580|Ga0210403_10684726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300020583|Ga0210401_10839853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300021170|Ga0210400_10417076Not Available1108Open in IMG/M
3300021171|Ga0210405_10858552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300021388|Ga0213875_10161763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300021401|Ga0210393_10958235Not Available693Open in IMG/M
3300021403|Ga0210397_10345582Not Available1102Open in IMG/M
3300021403|Ga0210397_10456697Not Available962Open in IMG/M
3300021404|Ga0210389_10698064All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300021406|Ga0210386_11456209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300021406|Ga0210386_11786616Not Available506Open in IMG/M
3300021407|Ga0210383_10581417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300021420|Ga0210394_10884287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300021479|Ga0210410_10102137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2532Open in IMG/M
3300022557|Ga0212123_10735460Not Available602Open in IMG/M
3300022718|Ga0242675_1078746Not Available602Open in IMG/M
3300024187|Ga0247672_1086571Not Available542Open in IMG/M
3300024251|Ga0247679_1046151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300025634|Ga0208589_1082101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300025634|Ga0208589_1124772Not Available596Open in IMG/M
3300025915|Ga0207693_10108811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2174Open in IMG/M
3300025928|Ga0207700_10876626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia803Open in IMG/M
3300025928|Ga0207700_10937773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300025928|Ga0207700_11100810Not Available710Open in IMG/M
3300025928|Ga0207700_11738351Not Available549Open in IMG/M
3300025929|Ga0207664_10199773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1725Open in IMG/M
3300025939|Ga0207665_11104540Not Available632Open in IMG/M
3300025945|Ga0207679_10981070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300026034|Ga0208773_1005986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1609Open in IMG/M
3300026446|Ga0257178_1012909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia944Open in IMG/M
3300026467|Ga0257154_1046503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300026498|Ga0257156_1050846Not Available852Open in IMG/M
3300027080|Ga0208237_1001900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2630Open in IMG/M
3300027158|Ga0208725_1052877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300027174|Ga0207948_1016288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300027371|Ga0209418_1053313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300027857|Ga0209166_10184612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1127Open in IMG/M
3300027884|Ga0209275_10714193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300028768|Ga0307280_10087761Not Available1020Open in IMG/M
3300029882|Ga0311368_10157261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1850Open in IMG/M
3300029882|Ga0311368_10180847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300030007|Ga0311338_10136563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2952Open in IMG/M
3300030043|Ga0302306_10193571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300030054|Ga0302182_10104248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1246Open in IMG/M
3300030509|Ga0302183_10064551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1448Open in IMG/M
3300030707|Ga0310038_10475738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300030739|Ga0302311_10455769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300030940|Ga0265740_1038118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300031544|Ga0318534_10646100Not Available599Open in IMG/M
3300031545|Ga0318541_10140173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1322Open in IMG/M
3300031546|Ga0318538_10236808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300031561|Ga0318528_10084195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1653Open in IMG/M
3300031561|Ga0318528_10398558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300031668|Ga0318542_10214310Not Available973Open in IMG/M
3300031682|Ga0318560_10323563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae832Open in IMG/M
3300031708|Ga0310686_117744635All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300031723|Ga0318493_10342997Not Available811Open in IMG/M
3300031747|Ga0318502_10702288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300031747|Ga0318502_11006126Not Available508Open in IMG/M
3300031751|Ga0318494_10590777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300031764|Ga0318535_10154590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1023Open in IMG/M
3300031779|Ga0318566_10229893Not Available920Open in IMG/M
3300031781|Ga0318547_10253836Not Available1061Open in IMG/M
3300031792|Ga0318529_10056746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1700Open in IMG/M
3300031792|Ga0318529_10290327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300031797|Ga0318550_10243724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300031821|Ga0318567_10545537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300031831|Ga0318564_10053838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1753Open in IMG/M
3300031833|Ga0310917_11141016Not Available519Open in IMG/M
3300031835|Ga0318517_10198388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300031860|Ga0318495_10126954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1149Open in IMG/M
3300031879|Ga0306919_10130875All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300031894|Ga0318522_10128743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300031894|Ga0318522_10226940Not Available708Open in IMG/M
3300031896|Ga0318551_10796284Not Available549Open in IMG/M
3300031910|Ga0306923_10943920Not Available942Open in IMG/M
3300031912|Ga0306921_12049967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300031947|Ga0310909_10436428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300032001|Ga0306922_10885730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300032001|Ga0306922_12339492Not Available511Open in IMG/M
3300032008|Ga0318562_10231102Not Available1073Open in IMG/M
3300032035|Ga0310911_10051815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2141Open in IMG/M
3300032042|Ga0318545_10167593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300032060|Ga0318505_10386197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300032060|Ga0318505_10440868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300032063|Ga0318504_10526649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300032066|Ga0318514_10102047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1456Open in IMG/M
3300032068|Ga0318553_10052929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2003Open in IMG/M
3300032068|Ga0318553_10414164Not Available706Open in IMG/M
3300032068|Ga0318553_10506588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300032089|Ga0318525_10055073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1979Open in IMG/M
3300032089|Ga0318525_10287809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300032160|Ga0311301_11295944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300032174|Ga0307470_10978615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300032782|Ga0335082_10379019All Organisms → cellular organisms → Bacteria → Terrabacteria group1280Open in IMG/M
3300032828|Ga0335080_11628144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300032895|Ga0335074_10006605All Organisms → cellular organisms → Bacteria16096Open in IMG/M
3300032895|Ga0335074_11233676Not Available626Open in IMG/M
3300032897|Ga0335071_11224205Not Available696Open in IMG/M
3300032898|Ga0335072_11475571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300033289|Ga0310914_11358307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300033290|Ga0318519_10086681Not Available1659Open in IMG/M
3300033818|Ga0334804_008531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4243Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.11%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.24%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.24%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.24%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.24%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.62%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.62%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.62%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.62%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.62%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.62%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.62%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.62%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026034Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes)EnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_005485702166559006Grass SoilTQYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR
deepsgr_029851602199352025SoilSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
JGI24743J22301_1015169813300001991Corn, Switchgrass And Miscanthus RhizospherePGHGSDGQPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR*
JGIcombinedJ26739_10061536013300002245Forest SoilVDPDPEDFAGHTGITVTQYHAAGADPVNPATGAKGAPTPECTEFETFTLIRRRS*
Ga0062388_10032226023300004635Bog Forest SoilGPEGGGQTSITVTQYHAVGADPVNPGTGAKGTPTPDYTEFETFRLVRSRADGR*
Ga0066675_1118988113300005187SoilPSIKVTHYHAVGADPVNPGTGAKGGAAPDYTEFETFTLVRPR*
Ga0070714_10161410913300005435Agricultural SoilDPGSGSDGEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR*
Ga0070730_1025279723300005537Surface SoilFDVHPDPEDFGGRTAITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLIRPRRA*
Ga0070733_1027401223300005541Surface SoilVGADPVNPATGAVGGPTPDYTEFETFTLVRPRADRT*
Ga0066700_1083599823300005559SoilVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS*
Ga0070761_1046126823300005591SoilGADPVNPATGARGAPTADYTEFETFTLIRPRSDGHRRRGSR*
Ga0066706_1078312733300005598SoilYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0070762_1003399813300005602SoilHTSITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRSS*
Ga0070763_1072791523300005610SoilVGADPVNPATGAKGAPTPDYTEFETFTLIRPRRG*
Ga0070717_1141441023300006028Corn, Switchgrass And Miscanthus RhizosphereVTHYHAVGADPVNPGTGDKGTPTADYTEFETFTLVRPR*
Ga0075029_10037667613300006052WatershedsAGGQPSIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRL*
Ga0075030_10051736123300006162WatershedsVGADPVNPGTGAKGAPTPDYTEFETFRLVRPRSS*
Ga0070715_1025972333300006163Corn, Switchgrass And Miscanthus RhizospherePSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0079221_1012972513300006804Agricultural SoilPGSGSDGQPSIRVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0079220_1048473733300006806Agricultural SoilGHTSIKVTHYHAVGADPVNPTTGDKGAPTPDYTEFETFRLVRPR*
Ga0075436_10145603423300006914Populus RhizosphereDGQASIRVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0099792_1085292823300009143Vadose Zone SoilVDPGSGSGSDGEPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0116225_154368113300009524Peatlands SoilHAVGADPVNPATGAKGAPTPDYTEFETFTLVSPRRA*
Ga0116220_1023590323300009525Peatlands SoilYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRL*
Ga0126373_1067400533300010048Tropical Forest SoilPDDHTSITIRYFHAVGADPVNPATGQPGAPTSHYTEFETFTLIRPRSDRGRQD*
Ga0126373_1228955913300010048Tropical Forest SoilTVTQYHAPGADPVNPATGEAGAPTPDYTEFETFTLVRPRCDRGHR*
Ga0126376_1098774713300010359Tropical Forest SoilPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR*
Ga0126378_1209699333300010361Tropical Forest SoilDGQPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTVVRPVPGGSGALRP*
Ga0126381_10426443923300010376Tropical Forest SoilSVTGTLYHAPGADPVIPATGEAGAPTPDYTEFETFTLVHPRSGR*
Ga0134121_1126916933300010401Terrestrial SoilGSDGEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR*
Ga0126350_1097368823300010880Boreal Forest SoilGGQTSITVTQYHALGADPVNPTTGEAGTPTPDYTEFETFTLVRPRNRA*
Ga0137376_1124175713300012208Vadose Zone SoilYHAVGADPVNPGTGDKGAPTPDYTKFETFTLVRPR*
Ga0137368_1051957713300012358Vadose Zone SoilVRRRPRGGHPSIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFTLVRPR*
Ga0137385_1000371913300012359Vadose Zone SoilASIKVTHYHAVGADPVNPATGAKGAPTPDYTEFETFRLVRPRSS*
Ga0137360_1127904713300012361Vadose Zone SoilSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR*
Ga0157323_100549513300012495Arabidopsis RhizosphereQPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR*
Ga0157373_1061878613300013100Corn RhizosphereGSDGKPSIKVAHYHAVGADPVNPGSGDKRAPTTDYTEFETITPVRPR*
Ga0181532_1048689923300014164BogAPEGSEAGGQPSIKVTHYHAVGADPVNPGTGVKGAPAPDYTEFETFRLVRPGL*
Ga0182030_1142870213300014838BogQYHALGADPVNPATGAKGAPTPDYTEFETFRLVRPRSR*
Ga0182036_1026603313300016270SoilQPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPR
Ga0182033_1033281113300016319SoilHAVGADPVNPGTGVKGAPTPDYTEFETFTLVRPRQG
Ga0182033_1089008723300016319SoilSDGQPSIKVTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR
Ga0182032_1148774423300016357SoilIKVTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR
Ga0182034_1053106023300016371SoilGQTSITVTQYHALGADPVNPATGDKGAPTPDYTEFEAFKLVRPRSR
Ga0182040_1017504223300016387SoilDPEGAAHDGQTSITVTHYHALGADPVYPATGDKGAPTRDYTEFETFKLVRPRSR
Ga0187812_111046013300017821Freshwater SedimentPDPEDFGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA
Ga0187812_125252723300017821Freshwater SedimentSGGQTSITVTHYHALGADPVNPTTGAKGAPNDNYTVFETFTLIRPRSDGGTSED
Ga0187802_1019310423300017822Freshwater SedimentEDFSGQTRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG
Ga0187818_1028321423300017823Freshwater SedimentAAFDVHPDREDFGGYTSIAVTHYHAVGADPVNPATDVKGAPTPDYTEFETFTLVRPRTT
Ga0187807_108533533300017926Freshwater SedimentVQPDPEDFGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA
Ga0187803_1019888713300017934Freshwater SedimentTVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0187808_1024520713300017942Freshwater SedimentDGQTSITVTQYHALGADPVNPNTGAKGAPTDDYTVFETFTLVRPRSDGHFG
Ga0187785_1036264413300017947Tropical PeatlandTHYHAIGADPVNPASGVKGAPTPDYTEFETFTLVRPR
Ga0187817_1012085413300017955Freshwater SedimentQTSITVTQYHAVGADPVIPATGEKGSPTQDYTEFETFTLVRPRRA
Ga0187780_1070280913300017973Tropical PeatlandAAGQPSIKVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPR
Ga0187816_1044965413300017995Freshwater SedimentPEDSGGQTSITVTQYHAVGADPVNPATGEKGAPTPDYTEFETFTLVRPRRA
Ga0187765_1120856023300018060Tropical PeatlandSITVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFKLIRPR
Ga0179592_1009258233300020199Vadose Zone SoilSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0210403_1068472613300020580SoilVDPDPGSDGQPSIKVTHYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR
Ga0210401_1083985333300020583SoilDGEPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0210400_1041707613300021170SoilHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0210405_1085855223300021171SoilQPSIKVTHYHAVGADPVNPATGAKGDPTPDYTEFETFTLVRPR
Ga0213875_1016176313300021388Plant RootsPSITVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFKLIRPR
Ga0210393_1095823513300021401SoilQYHALDADPVNPTTGAKGAPTPDYTEFETFTLIRPRRG
Ga0210397_1034558223300021403SoilAVFDVHPGEVRGGMTSITVRYFHAVGADPVNPATGQPGAPTANYTEFESFTLVRRRCDG
Ga0210397_1045669713300021403SoilKVTHYHAVGADPVNPATGAKGAPTPDYTEFETFRLVRSRSS
Ga0210389_1069806413300021404SoilGADPVNPNSGATGAPTDDYTVFETFTLARPRSDWRPFDKD
Ga0210386_1145620933300021406SoilSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLIRPRSG
Ga0210386_1178661623300021406SoilQYHALGADPVNPNTGAKDAPTPDYTLFETFTLVRPRSDRRFD
Ga0210383_1058141713300021407SoilQTRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG
Ga0210394_1088428723300021420SoilDVHPDPEDFVGHTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLLRPRSLR
Ga0210410_1010213713300021479SoilEPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0212123_1073546023300022557Iron-Sulfur Acid SpringDKTSITVSHYHALGADPVNPNTGAKGAPTSNYTLFETFKLVRPRSDRH
Ga0242675_107874613300022718SoilGDQTSIKVTHYHAVGADPVNPGSGAKGAPTPDYTEFETFTLIRPRRG
Ga0247672_108657123300024187SoilPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0247679_104615113300024251SoilYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0208589_108210123300025634Arctic Peat SoilSVTVRYFHAVGADPVNPASGRPGEPTPTYTEFETVTLVRHRSDG
Ga0208589_112477223300025634Arctic Peat SoilPGPDDGDQTSITVTQYHAVGADPVNPATGAKGAPTPDYTKFETFALVRRRP
Ga0207693_1010881113300025915Corn, Switchgrass And Miscanthus RhizosphereDGQPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0207700_1087662623300025928Corn, Switchgrass And Miscanthus RhizosphereDGQPSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0207700_1093777313300025928Corn, Switchgrass And Miscanthus RhizosphereFHALGADPVNPNTGQAGAPNPNYTEFETFKLVRPRSDGRRHHG
Ga0207700_1110081013300025928Corn, Switchgrass And Miscanthus RhizosphereTSIKVTHYHAVGADPVNPTTGEKGAPTPDYTEFETFRLVRPR
Ga0207700_1173835123300025928Corn, Switchgrass And Miscanthus RhizosphereGEPSIKVTHYHAVGADPVNPGTGDKGAPNPDYTEFETFTLVRPR
Ga0207664_1019977313300025929Agricultural SoilPGSGSGSDGQPSIKVTHYHAVGADPVNPGTGDKGAPTPDYTEFETFTLVRPR
Ga0207665_1110454013300025939Corn, Switchgrass And Miscanthus RhizosphereDGQPSIKVTQYHAVGADPVNPGTGDKGTPTADYTEFETFTLVRPR
Ga0207679_1098107023300025945Corn RhizosphereGHGSDGQTSIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0208773_100598623300026034Rice Paddy SoilYHHAAGADPVNPNTGAHGAPSPDYTPFETFTLVRRRSG
Ga0257178_101290913300026446SoilVDPGSGSGSDGHPSIKVTHYHAVGANPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0257154_104650313300026467SoilGGHTSITVTQYHAVGADPVNPATGVKGAPTPDYTEFETFTLIRPRSG
Ga0257156_105084623300026498SoilIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0208237_100190013300027080Forest SoilVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLIRPRRA
Ga0208725_105287723300027158Forest SoilAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0207948_101628833300027174Forest SoilELAGFESGGQASIRVTQYHAVGADPVNPGTGAKGAPTPDYTEFETFTLIRPRSG
Ga0209418_105331313300027371Forest SoilYHAVGADSVNPVTGVKGAPTPDYTEFETFTLVRPR
Ga0209166_1018461223300027857Surface SoilVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLIRPRRA
Ga0209275_1071419313300027884SoilSITVTQYHAVGADPVNPATGANGAPTPDYTEFETFRLVRPRSS
Ga0307280_1008776113300028768SoilLTHYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPR
Ga0311368_1015726143300029882PalsaYHAVGADPVNPATGAKGAPTPDYTEFETFTVTRRRSDGGL
Ga0311368_1018084713300029882PalsaTHYHTVGAADPVNPTTGAKGVPTPDYTEFETFTLVRPRSA
Ga0311338_1013656313300030007PalsaHAVGADPVNSGTGVKGAPTPDYTEFETFALVHRRP
Ga0302306_1019357123300030043PalsaTESGDRTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTVTRRRSDGGL
Ga0302182_1010424813300030054PalsaSITVTQYHAVGADPVNPATGDKGAPTPDYTEFETFTVTRPRSDGGP
Ga0302183_1006455123300030509PalsaQYHAVGADPVNPATGDKGAPTPDYTEFETFTVTRPRSDGGP
Ga0310038_1047573823300030707Peatlands SoilEGSEAGGQPSIKVTHYHAVGADPVNPGTGVKGAPAPDYTEFETFRLVRPRF
Ga0302311_1045576913300030739PalsaRTSITVTQYHAVGADPVNPATGVKGAPTPDYTEFETFTVTRPRSDGGR
Ga0265740_103811823300030940SoilQYHAVGADPVNSATGAKGAPTPDYTEFETFTLIRPRRG
Ga0318534_1064610023300031544SoilFDVHPAPEDFGGQTSITVTQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0318541_1014017333300031545SoilITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318538_1023680833300031546SoilVHPERADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRQG
Ga0318528_1008419513300031561SoilTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318528_1039855823300031561SoilPNPADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0318542_1021431013300031668SoilGLTGSDGQPSIKVTHYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPR
Ga0318560_1032356323300031682SoilHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR
Ga0310686_11774463533300031708SoilASIKVTHYHAVGADPVNPDTAAKGAPTPDYTEFETFRLVRPRSF
Ga0318493_1034299723300031723SoilQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0318502_1070228823300031747SoilIKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR
Ga0318502_1100612623300031747SoilYHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRPS
Ga0318494_1059077713300031751SoilITHYHAVGADPVNPVTGVKGAPTPDYTEFETFRLVRPRSSEGLG
Ga0318535_1015459023300031764SoilVRYFHALGADPTNPNTGTKGAPNSVYTLFETVKLIRPRSRR
Ga0318566_1022989323300031779SoilITVTQYHAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0318547_1025383613300031781SoilDFGGQTSITVTQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0318529_1005674633300031792SoilDRADFGSQTSITVTQYHAVGAGRGNPATGARGAPAPDYTEFETFTLVRPRRG
Ga0318529_1029032713300031792SoilVHPDREDFGGHTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318550_1024372423300031797SoilYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0318567_1054553713300031821SoilTRITVTHYHAVGADPVNPATGAKGAPTPDYTEFETFSLVRPRGG
Ga0318564_1005383843300031831SoilVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0310917_1114101623300031833SoilVHPDPADSGGRTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318517_1019838813300031835SoilTHYHALGADPVYPATGDKGAPTPDYTEFETFKLVRPRSR
Ga0318495_1012695423300031860SoilGHTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0306919_1013087513300031879SoilTVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR
Ga0318522_1012874313300031894SoilTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0318522_1022694023300031894SoilTQYQAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0318551_1079628413300031896SoilSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0306923_1094392013300031910SoilASIKVTHYHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRSS
Ga0306921_1204996723300031912SoilPAGPETAGQAGIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS
Ga0310909_1043642823300031947SoilHTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0306922_1088573013300032001SoilADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRQG
Ga0306922_1233949213300032001SoilSGGRTSITVTQYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318562_1023110213300032008SoilYHAVGADPVNPASGVKGAPTPDYTEFETFTLVRPR
Ga0310911_1005181513300032035SoilITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0318545_1016759323300032042SoilYHAVGADPVNPATGTKGAPTPDYTEFETFTLVRPRRG
Ga0318505_1038619713300032060SoilPDGQTSITVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR
Ga0318505_1044086823300032060SoilVTHYHAVGADPVNPATGAKGEPTPDYTEFETFTLVRPR
Ga0318504_1052664923300032063SoilGSDGQPSIKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR
Ga0318514_1010204713300032066SoilGQTSITVTQYHAVGADPVHPATGDKGAPTPDYTEFEAFRLVRPRSR
Ga0318553_1005292913300032068SoilTHYHAVGADPVNPTSGVKGAPTPDYTEFETFRLVRPRPS
Ga0318553_1041416413300032068SoilQYHAVGADPVNPGTGAKGAPTPDYTEFETFTLVRPRRG
Ga0318553_1050658823300032068SoilADFGGQTSITVTQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRPRRG
Ga0318525_1005507333300032089SoilIKVTHYHAVGADPVNPGTGVKGAPTPDYTEFETFRLVRPRSS
Ga0318525_1028780923300032089SoilVHPDRADFGSQTSITVTQYHAVGAGRGNPATGARGAPAPDYTEFETFTLVRPRRG
Ga0311301_1129594423300032160Peatlands SoilGGQASIKVTHYHAVGADPVNPGTGAKGAPTPDYTEFETFRIVRPHSFAGTGGGG
Ga0307470_1097861523300032174Hardwood Forest SoilKVTHYHAVGADPVNPGTGTKGAPTPDYTEFETFTLVRPR
Ga0335082_1037901913300032782SoilTHYHAVGADPVNPTTGVKGAPTPDYTEFETFRLVRPRSS
Ga0335080_1162814413300032828SoilPSIKITQYHAVGADPVNPATGAKGAPTPDYTEFETFTLVRSR
Ga0335074_1000660523300032895SoilVTQYHAVGADPVNPATGAKGAPTPDYTEFETFRLIRPRSS
Ga0335074_1123367623300032895SoilYHALGADPVNPNTGAKGAPTPDYTLFETFTLVRPRSDRRFD
Ga0335071_1122420533300032897SoilHYHAVGADPVNPTTGNKGAPTPDYTEFETFRLVRPR
Ga0335072_1147557123300032898SoilVDPHGGGNGRGTITVRYFHAPGADPTNPTSGVKGAPNPTYTEFETFTLF
Ga0310914_1135830723300033289SoilSIKVTHYHAVGADPVNPASGAKGAPSPDYTEFETFTLVRPR
Ga0318519_1008668143300033290SoilTQYHAVGADPVNPGSGAKGEPTPDYTEFETFTLVRPRRG
Ga0334804_008531_4095_42413300033818SoilAGGQTSITVTQYHALGADPVNPATGAKGAPTPDYTEFETFRLVRPRSR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.