Basic Information | |
---|---|
Family ID | F040938 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 41 residues |
Representative Sequence | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASP |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 96.89 % |
% of genes from short scaffolds (< 2000 bps) | 96.89 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.031 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (8.075 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.845 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.373 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF01527 | HTH_Tnp_1 | 80.75 |
PF00248 | Aldo_ket_red | 0.62 |
PF13701 | DDE_Tnp_1_4 | 0.62 |
PF07592 | DDE_Tnp_ISAZ013 | 0.62 |
PF02371 | Transposase_20 | 0.62 |
PF16355 | DUF4982 | 0.62 |
PF00589 | Phage_integrase | 0.62 |
PF00440 | TetR_N | 0.62 |
PF03050 | DDE_Tnp_IS66 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.03 % |
Unclassified | root | N/A | 4.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908029|A2_v1_NODE_4257_len_2359_cov_7_792285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2409 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1088977 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300000878|AL9A1W_1101906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 722 | Open in IMG/M |
3300000886|AL3A1W_1358774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 726 | Open in IMG/M |
3300001385|JGI20193J14888_1048491 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300001537|A2065W1_10868865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1120 | Open in IMG/M |
3300002162|JGI24139J26690_1056469 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300002549|JGI24130J36418_10130329 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300002569|JGI24136J36422_10166552 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300003465|P52013CM_1104404 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300004081|Ga0063454_100750035 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300004267|Ga0066396_10039603 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300005340|Ga0070689_101832582 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005355|Ga0070671_101978600 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005436|Ga0070713_101382323 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005454|Ga0066687_10254907 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300005712|Ga0070764_10274570 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005827|Ga0074478_1654095 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005833|Ga0074472_10438351 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300005836|Ga0074470_10714651 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300005873|Ga0075287_1026589 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005886|Ga0075286_1074367 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005898|Ga0075276_10171388 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005921|Ga0070766_10816867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300006031|Ga0066651_10178341 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300006102|Ga0075015_100397594 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300006196|Ga0075422_10121255 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300006795|Ga0075520_1452040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
3300006880|Ga0075429_100243920 | Not Available | 1574 | Open in IMG/M |
3300006904|Ga0075424_101224499 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300009167|Ga0113563_11844690 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300009609|Ga0105347_1274052 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300009631|Ga0116115_1132816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 634 | Open in IMG/M |
3300009698|Ga0116216_10320941 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300009943|Ga0117933_1610503 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300010048|Ga0126373_11340151 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300010371|Ga0134125_10914459 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300011084|Ga0138562_1021346 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300011998|Ga0120114_1099455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 560 | Open in IMG/M |
3300012035|Ga0137445_1127742 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012152|Ga0137347_1105859 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012171|Ga0137342_1064880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300012200|Ga0137382_10511191 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300012204|Ga0137374_10728693 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300012207|Ga0137381_10897968 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300012285|Ga0137370_10557397 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012684|Ga0136614_10286091 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300012910|Ga0157308_10430733 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012913|Ga0157298_10075393 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300012958|Ga0164299_11686027 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300012964|Ga0153916_11686316 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300013297|Ga0157378_12943436 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300013307|Ga0157372_11767593 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300014158|Ga0181521_10027764 | All Organisms → cellular organisms → Bacteria | 4422 | Open in IMG/M |
3300014161|Ga0181529_10355189 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300014201|Ga0181537_10790434 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300014266|Ga0075359_1155845 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300014490|Ga0182010_10599402 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300014491|Ga0182014_10447796 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300014493|Ga0182016_10454802 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300014501|Ga0182024_10939947 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300014502|Ga0182021_11490860 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300014502|Ga0182021_11565062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300014502|Ga0182021_13295810 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300014654|Ga0181525_10684477 | Not Available | 575 | Open in IMG/M |
3300014658|Ga0181519_10550660 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300015371|Ga0132258_13715521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300017926|Ga0187807_1128181 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300017929|Ga0187849_1322010 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300017935|Ga0187848_10226490 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300017970|Ga0187783_10822009 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300018005|Ga0187878_1340682 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300018034|Ga0187863_10308157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
3300018037|Ga0187883_10294391 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300018052|Ga0184638_1153237 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300018055|Ga0184616_10362749 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300018076|Ga0184609_10415496 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300018090|Ga0187770_11159417 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018422|Ga0190265_13017451 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300018468|Ga0066662_10931764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
3300018481|Ga0190271_11344542 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300019788|Ga0182028_1022612 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300021407|Ga0210383_10980126 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300021963|Ga0222712_10513696 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300021976|Ga0193742_1093141 | Not Available | 1080 | Open in IMG/M |
3300022520|Ga0224538_1038605 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300023077|Ga0247802_1064613 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300023101|Ga0224557_1231204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300025130|Ga0209594_1208211 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300025322|Ga0209641_11074905 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300025432|Ga0208821_1078068 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300025548|Ga0208716_1091478 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300025619|Ga0207926_1131286 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300025625|Ga0208219_1147579 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300025725|Ga0209638_1253339 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300025852|Ga0209124_10328711 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300025865|Ga0209226_10403177 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300025865|Ga0209226_10439241 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300025888|Ga0209540_10434432 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300025918|Ga0207662_10605932 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300025923|Ga0207681_11856120 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300025928|Ga0207700_11046826 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300026089|Ga0207648_11469380 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300026217|Ga0209871_1079698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300027334|Ga0209529_1054235 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300027364|Ga0209967_1024032 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300027439|Ga0209332_1087792 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027634|Ga0209905_1099799 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300027680|Ga0207826_1118479 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300027783|Ga0209448_10164749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300027787|Ga0209074_10193918 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300027825|Ga0209039_10249565 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300027890|Ga0209496_10676438 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300027911|Ga0209698_11010286 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300028746|Ga0302233_10140996 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300028747|Ga0302219_10137067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
3300028859|Ga0302265_1189540 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300028867|Ga0302146_10227914 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300028870|Ga0302254_10274757 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300028906|Ga0308309_11544943 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300029956|Ga0302150_10163589 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300030007|Ga0311338_11512733 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300031028|Ga0302180_10234347 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300031232|Ga0302323_103360208 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031238|Ga0265332_10218946 | Not Available | 790 | Open in IMG/M |
3300031242|Ga0265329_10251922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300031259|Ga0302187_10414078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300031521|Ga0311364_11828538 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031616|Ga0307508_10677243 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031708|Ga0310686_100846438 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300031711|Ga0265314_10581139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300031722|Ga0311351_10949668 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300031726|Ga0302321_102557553 | Not Available | 596 | Open in IMG/M |
3300031740|Ga0307468_101889486 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031772|Ga0315288_11420136 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031781|Ga0318547_10589100 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300031831|Ga0318564_10427740 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031885|Ga0315285_10568152 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300031896|Ga0318551_10440251 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300031913|Ga0310891_10389729 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300031939|Ga0308174_11312928 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300032342|Ga0315286_12004063 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300032401|Ga0315275_11952820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300032828|Ga0335080_11645847 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300032892|Ga0335081_12440797 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300032954|Ga0335083_11305471 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300032954|Ga0335083_11483640 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300033402|Ga0326728_10294499 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300033408|Ga0316605_12194488 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300033482|Ga0316627_101642970 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300033513|Ga0316628_102959717 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300033513|Ga0316628_104202367 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300033521|Ga0316616_103651795 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300033798|Ga0334821_066991 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300033824|Ga0334840_139624 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300033891|Ga0334811_180734 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300033982|Ga0371487_0376607 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300034690|Ga0364923_0107791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 8.07% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.11% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.11% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.11% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.11% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.11% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.48% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.48% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.48% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.86% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.86% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.86% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.24% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.24% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.24% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.24% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.24% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.24% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.24% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.62% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.62% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.62% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.62% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment | 0.62% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.62% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.62% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.62% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.62% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002162 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009943 | Combined Assembly of Gp0139325, Gp0139347, Gp0139348 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
3300022520 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_v1_00066910 | 2124908029 | Soil | MDAVTELCLAVGIESACDALGVARASFYRQRPPLGP |
AF_2010_repII_A100DRAFT_10889771 | 3300000655 | Forest Soil | MDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPSA |
AL9A1W_11019061 | 3300000878 | Permafrost | MDAVSQLAPTVGIESACDALGVARASFYRLRPPLGPPPTAVLS |
AL3A1W_13587742 | 3300000886 | Permafrost | MDAVSQLAPTVGIESACDALGVARASFYRLRPPLGP |
JGI20193J14888_10484911 | 3300001385 | Arctic Peat Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPP |
A2065W1_108688651 | 3300001537 | Permafrost | MNAVDQLAPTVGIASACEALGVARASFYRQPVFGPALPVPPRS |
JGI24139J26690_10564692 | 3300002162 | Arctic Peat Soil | MDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPAS |
JGI24130J36418_101303291 | 3300002549 | Arctic Peat Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPEPALP |
JGI24136J36422_101665522 | 3300002569 | Arctic Peat Soil | MDAVTRLAPTVGIVAACDLLAVARASFYRQRPVLGPSVSPAPEPALPLER |
P52013CM_11044041 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MDAVTHLAPTVGVVAACVFLGVARASFYRQRPVLGPPAAPAPEAA |
Ga0063454_1007500352 | 3300004081 | Soil | MDAVLQLSSTIGIESACDALGVARASFYRQRPLLGPALSIQLSM |
Ga0066396_100396033 | 3300004267 | Tropical Forest Soil | MDAVTQLAPTVGIVAACDFLGVARASFYRQRPVLGPSAVPP |
Ga0070689_1018325822 | 3300005340 | Switchgrass Rhizosphere | MDAVLQLSSTIGIESACDALGVARASFYRQRPLLGPALTIQLSTP |
Ga0070671_1019786001 | 3300005355 | Switchgrass Rhizosphere | MDAVIHLAPTVGVVAACALLAVARASFYRQRPLLGPSASPGPEP |
Ga0070713_1013823232 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVIHLAPTVGVVAACDFLAVARASFYRERPVLGPPPSPV |
Ga0066687_102549073 | 3300005454 | Soil | MDAVARLAPTVGIVAACDCLAVARASFYRQRPVLGPPASPA |
Ga0070764_102745702 | 3300005712 | Soil | MDAVTQLAPTVGIVAACDFLAVARASFYRQRPVLVPPPSPA |
Ga0074478_16540951 | 3300005827 | Sediment (Intertidal) | MDAVTYLSPSVGVVSACDVLGVARASFYRQRPVLGPPA |
Ga0074472_104383512 | 3300005833 | Sediment (Intertidal) | MDAALSLSSSVGIQPACAHLGVARASFYRQRPLLGPLQKPGLLASP |
Ga0074470_107146513 | 3300005836 | Sediment (Intertidal) | MDAAAVLASTVGVQAACDVLAVPRATFYRHRPLLGPAPLAASPAS |
Ga0075287_10265891 | 3300005873 | Rice Paddy Soil | MDAVTHLAPTVGVVAACDALSVARASFYRQRPVLGPPPASPGPGP |
Ga0075286_10743672 | 3300005886 | Rice Paddy Soil | MEGVTQLAPTVGIVAACDFLGVARASFYRQRPVLGP |
Ga0075276_101713882 | 3300005898 | Rice Paddy Soil | MDAVTHLAPTVGVLAACDVLGVARASFYRQRPLFGPPASPAPE |
Ga0070766_108168672 | 3300005921 | Soil | MDAVLQLSSTVGVESACDVLGVARASFYRRRPLLGP |
Ga0066651_101783411 | 3300006031 | Soil | MDAVTHLAPTVGIVAACNFLAVARASFYRQRPVLGPSASPAPEP |
Ga0075015_1003975941 | 3300006102 | Watersheds | MDAVLQLSPTVGIESACDALGVARASFYRLRPPLG |
Ga0075422_101212553 | 3300006196 | Populus Rhizosphere | MEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGP |
Ga0075520_14520401 | 3300006795 | Arctic Peat Soil | MDAVNQLAPTVGIESACNVLGLPRAAFYRRPVFGPKLL |
Ga0075429_1002439202 | 3300006880 | Populus Rhizosphere | MDAVTQLAPTVGVVAACDFLAVARASFYRQRRVLGDTTK* |
Ga0075424_1012244991 | 3300006904 | Populus Rhizosphere | MDAVTHLAPSVGVLAACDVLGVARASFYRQRPMFGPP |
Ga0113563_118446902 | 3300009167 | Freshwater Wetlands | MDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPVSPAPDPVLPGER |
Ga0116108_11979881 | 3300009519 | Peatland | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPILGPLASPPPEPVTPSERP |
Ga0105347_12740521 | 3300009609 | Soil | MDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFGP |
Ga0116115_11328162 | 3300009631 | Peatland | MDAVTHLAPTVGVLAACDVLGVARASFYRQRPVLGPPASAPPE |
Ga0116216_103209413 | 3300009698 | Peatlands Soil | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPS |
Ga0117933_16105031 | 3300009943 | Hot Spring Fe-Si Sediment | MDAVTHLAPTVGVVAACEFLGVARASFYRQRSVLGPSAA |
Ga0126373_113401511 | 3300010048 | Tropical Forest Soil | MDAVTRLAPTVGIASACDFLGVARASFYRQRPALGPLATPAPASPDRA |
Ga0134125_109144591 | 3300010371 | Terrestrial Soil | MDAVTHLAPTVGVVAACDALGVARASFYRQRPVLGPSS |
Ga0138562_10213462 | 3300011084 | Peatlands Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVFGPPA |
Ga0120114_10994552 | 3300011998 | Permafrost | MNAVDQLAPAVGIESACEALGVARASFYRQPVFGPMPLQSRP |
Ga0137445_11277421 | 3300012035 | Soil | MDAVDQLAPAVGIESACDALGVSRASFYRQPVFGPALPAPVMV |
Ga0137347_11058592 | 3300012152 | Soil | MDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPPAS |
Ga0137342_10648802 | 3300012171 | Soil | MDAVQQLAPTIGVESACDVLGLPRASFYRKRPVAGSAL |
Ga0137382_105111912 | 3300012200 | Vadose Zone Soil | MDAVTHLAPTVGIVAACDFLAVARASFYRQRPVLSPSVSPVPE |
Ga0137374_107286933 | 3300012204 | Vadose Zone Soil | MASVAELGPLVGVTAACETLGVARASFYRQAQPRA |
Ga0137381_108979681 | 3300012207 | Vadose Zone Soil | MDAVTHLAPTVGIVAACDFLAVALASFYRQRPVLG |
Ga0137370_105573971 | 3300012285 | Vadose Zone Soil | MDATTQLSSIVGIVTACVVLGVSRASFYRQRPLVGPIP |
Ga0136614_102860914 | 3300012684 | Polar Desert Sand | MEAVEHLAPTVGTAAACHALGVARSRVYRARRRTPDA |
Ga0157308_104307332 | 3300012910 | Soil | MEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGPLAA |
Ga0157298_100753932 | 3300012913 | Soil | MEAVLALAPTVGLQAACDHLAVARASFYRQRPRFGPLAAPLGPAAI |
Ga0164299_116860272 | 3300012958 | Soil | MDAVQELAPAVGIESACDALGVSRASFYRRTAFGPA |
Ga0153916_116863161 | 3300012964 | Freshwater Wetlands | MDAVTHLAPTVGVVAACDVLGVARASFYRQRPVLGPSASPAPEL |
Ga0157378_129434361 | 3300013297 | Miscanthus Rhizosphere | MDAVTHLAPTVGVLAACDVLGVARASFYRQRPVFGLQFHP |
Ga0157372_117675933 | 3300013307 | Corn Rhizosphere | MDAVAHLAPTVGIVAACDCLAVPRASFYRQRPVLGPSASPAPDEPSMPA |
Ga0181521_100277641 | 3300014158 | Bog | MDAVTHRVPTGGVVAAGDVLEVARARFYRRRPVLGPLASPAPEPAWPGERSAPA |
Ga0181529_103551891 | 3300014161 | Bog | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAP |
Ga0181537_107904342 | 3300014201 | Bog | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPE |
Ga0075359_11558452 | 3300014266 | Natural And Restored Wetlands | MDAVTHLAPTVGVVAACDSLGVVRASFYRQRPVLGPSASPPPA |
Ga0182010_105994021 | 3300014490 | Fen | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPLASPAPGPALPS |
Ga0182014_104477962 | 3300014491 | Bog | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEP |
Ga0182016_104548023 | 3300014493 | Bog | MDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSAAPLPELPLA |
Ga0182024_109399471 | 3300014501 | Permafrost | MDAVHQLAPTVGIEWACDALGVARASFYRQPVFGPALP |
Ga0182021_114908603 | 3300014502 | Fen | MDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPASPA |
Ga0182021_115650623 | 3300014502 | Fen | MDAVLQLSSTVGIESACDALGVARASFYRLRPLLGPA |
Ga0182021_132958102 | 3300014502 | Fen | MDAVVHLAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEPV |
Ga0181525_106844772 | 3300014654 | Bog | MAAVTQLAPSVGVVAACECLGMARASFYRQRPVVGPPTAPPSESTLPCPRP |
Ga0181519_105506602 | 3300014658 | Bog | MDAVTHLAPTVGIVAACDFLAVARSSFYRQRPVLGSSAW |
Ga0132258_137155213 | 3300015371 | Arabidopsis Rhizosphere | MMDAVLQLSSTVGIESACDVLGVARASFYRQRPLLGPALSI |
Ga0187807_11281812 | 3300017926 | Freshwater Sediment | MDAVTQLASTVGVVAACDFLAVARASFYRRRPVLGPSASLAPEPAPP |
Ga0187849_13220101 | 3300017929 | Peatland | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVPGPTASPVPEPVLPAA |
Ga0187848_102264902 | 3300017935 | Peatland | MDAVIHLAPTVGVGAACDALGVARASFYRQRPALGPPPASPV |
Ga0187783_108220092 | 3300017970 | Tropical Peatland | MDAVTHLAPTVGIVAACDFLGVARASFYRQRPVLGPLAT |
Ga0187878_13406822 | 3300018005 | Peatland | MDAVTHLAPTVGVVAACDFRGVARASFYRQRPVLGPPASAALEPAVPM |
Ga0187863_103081573 | 3300018034 | Peatland | MDATLQLSCTVGIESACDALGVARASFYRRRPLFG |
Ga0187883_102943913 | 3300018037 | Peatland | MNAVTALAPTVGIVAACDCLAVARASFYRQRPVLGPSASPAPEPVTPSE |
Ga0184638_11532371 | 3300018052 | Groundwater Sediment | MDAVTRLAPTVGIVAACDFLAVARASFYRQRPVLGPPVSSAP |
Ga0184616_103627491 | 3300018055 | Groundwater Sediment | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASP |
Ga0184609_104154962 | 3300018076 | Groundwater Sediment | MDAVSQLAPTVGVESACDVLGVARASFYRTLPLLRPMLASHMPLTLR |
Ga0187770_111594171 | 3300018090 | Tropical Peatland | MDAVTHLAPTVGVAAACDFLGVARASFYRQRPVLGPPAAPV |
Ga0190265_130174511 | 3300018422 | Soil | MDAVTHLAPTVGVLAACDVLGVARASFYRQRPMLGPPASLA |
Ga0066662_109317642 | 3300018468 | Grasslands Soil | MDAVLQLSSTVGIESACAVLGVARASFYRQRPLLGPAL |
Ga0190271_113445421 | 3300018481 | Soil | MDAVAHLASTVGIVAACDCLTVARASFYRQRPVLGPPASLTAEPALPA |
Ga0182028_10226121 | 3300019788 | Fen | MDAVTHLAPTVGVVAACDFLGVARASFYSFYRQRPVLGPTASP |
Ga0210383_109801262 | 3300021407 | Soil | MDAVTHLSPTVGVVAAGDFLGVARASFYRQRPLLGP |
Ga0222712_105136961 | 3300021963 | Estuarine Water | MDAVLSLSPQIGIHSACSCLGVARATFYRQRPFLGPHE |
Ga0193742_10931411 | 3300021976 | Soil | MDAVSHLSSTVGIESACGALGVARASYYRQRPLLGPFPLAQF |
Ga0224538_10386052 | 3300022520 | Soil | MDAVTHLAPTVGVFAACDSLGVARASFYRQRPVLGPPP |
Ga0247802_10646131 | 3300023077 | Soil | MDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFG |
Ga0224557_12312041 | 3300023101 | Soil | MDAVLLLSVTVGIESACDALGVARASFYRQRPLLGPT |
Ga0209594_12082111 | 3300025130 | Groundwater | MNAVTELSPSVGIVTACQALGVARASFYRQRPRLGPPAAPLPEPEPAAA |
Ga0209641_110749051 | 3300025322 | Soil | MDAVTHLAPTVGVVAACDLLGVARASFYRQRPILGPPTSPP |
Ga0208821_10780682 | 3300025432 | Peatland | MDAVTHLASTVGVRAACDFLGVARASFYRQRPVFGPSASPAPEPALAE |
Ga0208716_10914781 | 3300025548 | Arctic Peat Soil | MDAVVHLAPTVGTVAACDFLGVARASFYRQRPVLGPS |
Ga0207926_11312861 | 3300025619 | Arctic Peat Soil | MDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPASP |
Ga0208219_11475791 | 3300025625 | Arctic Peat Soil | MNAVDQLAPTIGIEPACEALGVARASFYRQPVFGPAW |
Ga0209638_12533392 | 3300025725 | Arctic Peat Soil | MDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLG |
Ga0209124_103287111 | 3300025852 | Arctic Peat Soil | MDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPPASPAP |
Ga0209226_104031772 | 3300025865 | Arctic Peat Soil | MDAVVHLAPTVGTVAACDFLGVARASFYRQRPVLGPSASPAPEP |
Ga0209226_104392411 | 3300025865 | Arctic Peat Soil | MDAVTRLAPTVGIVAACDLLAVARASFYRQRPVLGPSVSPAPEPALP |
Ga0209540_104344321 | 3300025888 | Arctic Peat Soil | MDAVTHLAPTVGIVAACDALAVSRASFYRQRPVLGPP |
Ga0207662_106059321 | 3300025918 | Switchgrass Rhizosphere | MDAVQELAPAVGIESACDALGVSRASFYRRPAFGP |
Ga0207681_118561201 | 3300025923 | Switchgrass Rhizosphere | MDAVQQLAPTVGIESACDALGVSRASFYRQPAFGPAL |
Ga0207700_110468262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVIHLAPTVGVVAACDFLAVARASFYRERPVLGPPPSPVPE |
Ga0207648_114693801 | 3300026089 | Miscanthus Rhizosphere | MDAVLTLSPTVGIQAACDHLAVARASLYRQRPTFGPLAA |
Ga0209871_10796981 | 3300026217 | Permafrost Soil | MDAVLQLSSTVGIESACDALGVARASFYRRRPLVGPAPSG |
Ga0209529_10542351 | 3300027334 | Forest Soil | MEAVQELAPTVGIESACDALGVARASFYRQRPVLGPTLPVPVI |
Ga0209967_10240321 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MDAVAHLAPTVGVVAACDFLAAARASFYRQRPVLGPLTALAPEPN |
Ga0209332_10877922 | 3300027439 | Forest Soil | MEAVTHLSPAVGVVAACDSLGVARASFYRQRPILGPSASPAPDPAL |
Ga0209905_10997991 | 3300027634 | Thawing Permafrost | MDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSASPLPEPCLLYTSRCV |
Ga0207826_11184791 | 3300027680 | Tropical Forest Soil | MDAVTHLAPTVGTVAACDFLGVARASFYRQRPVLGPS |
Ga0209448_101647491 | 3300027783 | Bog Forest Soil | MDAVRQLVPTVGVESACEALGVARASFYRQPVFGPVLPATV |
Ga0209074_101939182 | 3300027787 | Agricultural Soil | MDAVTHLAPTVGVLAACDVLGVARASFYRRRPMLGPPPASPP |
Ga0209039_102495651 | 3300027825 | Bog Forest Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPEPVLPA |
Ga0209501_105304042 | 3300027844 | Marine | MAAAWQLSATVGVESACDALGVARASFYRRRRPSVPRAA |
Ga0209496_106764381 | 3300027890 | Wetland | MDAVTHLAPTVGVLAACDFLGVARGSFYRQRPVFGPPALP |
Ga0209698_110102861 | 3300027911 | Watersheds | MDAVTHLAPTVGIVAACDVLAVSRASFYRQRPVLGP |
Ga0302233_101409961 | 3300028746 | Palsa | MDAVTHLSPTVGVVAACDVLGVARASFYRQRPVLGPSASPLPEPSLA |
Ga0302219_101370672 | 3300028747 | Palsa | MDAVLQLSTTVGIESACDALGVARASFYRQRPLLGPT |
Ga0302265_11895401 | 3300028859 | Bog | MNAVTDLAPTVGILAACDFLSVSRASFYRQRPVLGPPVAPA |
Ga0302146_102279142 | 3300028867 | Bog | MNAVTDLAPTVGIVAACDFLAVSRASFYRQRPILGPPVAPAPGPA |
Ga0302254_102747571 | 3300028870 | Fen | MDAVTHLAPTVGVVAACDSLGVARASFYRQRPVLGPPASPMPEL |
Ga0308309_115449431 | 3300028906 | Soil | MDAVTHLSPTVGVVAACDFLGVARATFYRQRPLLGPSAS |
Ga0302150_101635892 | 3300029956 | Bog | MNAVTDLAPTVGIVAACDFLAVSRASFYRKRPILGPPVAPAPGPALPVE |
Ga0311338_115127331 | 3300030007 | Palsa | MDAVTHLSPTVGVVAACDVLGVARATFYRQRPVLCPSASLLL |
Ga0302180_102343472 | 3300031028 | Palsa | MDAVLQLSTTVGIESACDALGVARASFYRQRPLLGPTDGGA |
Ga0302323_1033602082 | 3300031232 | Fen | MDAVVQLAPTVGIVAACDFLAVARASFYRQRPVLGPPSSSAT |
Ga0265332_102189461 | 3300031238 | Rhizosphere | MDAVIQLVPTVGVVAACDSLGVARASFYRQRPVLGPP |
Ga0265329_102519222 | 3300031242 | Rhizosphere | MDAVLQLSSTVGIESACDVLDVSRASFYRQRPLLGPA |
Ga0302187_104140781 | 3300031259 | Bog | MDATLQLSCTVGIESACDALGVARATFYRRRPVFG |
Ga0311364_118285382 | 3300031521 | Fen | MDAVTHLAPAVGVVAACGSLGVARASFYRQRPVLG |
Ga0307508_106772431 | 3300031616 | Ectomycorrhiza | MDAVTQLAPAVGIVAACDCLGVSRASFYRLRPVLGPSRLPMPELIPPVD |
Ga0310686_1008464381 | 3300031708 | Soil | MDAVTQLAPTVGLVAACDFLAVARASFYRQRPVFGPPSSP |
Ga0265314_105811392 | 3300031711 | Rhizosphere | MDAVLQLSTTVGIESACDALDVARASFYRQRPLLGPTLSALFPA |
Ga0311351_109496682 | 3300031722 | Fen | MDAVIHLAPTVGFVAACDCLGVPRASFYRQRPVLGPPASSIPEPPLPS |
Ga0302321_1025575531 | 3300031726 | Fen | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGSPASPA |
Ga0307468_1018894862 | 3300031740 | Hardwood Forest Soil | MDAVHQLAPSVGIESACDALGVARASFYRQPVFGPAPF |
Ga0315288_114201361 | 3300031772 | Sediment | MDAVTQLAPTVGVVAACDFLGVPRASFYRQRPVLGPPASP |
Ga0318547_105891002 | 3300031781 | Soil | MDAVAQLAPTVGVVAACDFLAVARASFYRQRPVLGPSASPA |
Ga0318564_104277402 | 3300031831 | Soil | MDAVTRLATAVGVVAACDFLSVARASFYRQRPILGPAAVPAPPAE |
Ga0315285_105681521 | 3300031885 | Sediment | MDAVSQLAPTVGIESACDVLGVARASFYRQRLRLGPRLAAP |
Ga0318551_104402512 | 3300031896 | Soil | MDAVAQLAPTVGVVAACDFLAVARASFYRQRPVLGPSASPAPEPAPPSE |
Ga0310891_103897292 | 3300031913 | Soil | MDAVTHLAPTVGIVAACDCLGVARASFYRQRPVLGPLALPPP |
Ga0308174_113129281 | 3300031939 | Soil | MDAVTHLAPTVGIVSACDFLAVARASFYRQRPVLGPSPSPVPE |
Ga0315270_108305011 | 3300032275 | Sediment | MDAVTQLAPTVGVVAACDFLAVARASFYRQRPVLGPPVSSAPDPALPLE |
Ga0315286_120040631 | 3300032342 | Sediment | MDAVTHLAPTVGVFAACDFLGVARASFYRQRPVLGPPASPA |
Ga0315275_119528201 | 3300032401 | Sediment | MDAVRQLAPTVGIESACDVLGVARASFYRQRPRLGPR |
Ga0335080_116458472 | 3300032828 | Soil | MDAVTHLAPTVGVAAACDSLGAARASFYRQRPVFGPPLLPPP |
Ga0335081_124407971 | 3300032892 | Soil | MDAVTQLAPTVGIVAACDFLGAARASFYRQRPILGPSAVPAAEPTS |
Ga0335083_113054711 | 3300032954 | Soil | MDAVTHLAPTVGVVAACDALGVARASFYRQRPVLGPPPA |
Ga0335083_114836402 | 3300032954 | Soil | MNAVTELSPAVGVLSACEVLGVARASFYRHRPRLGP |
Ga0326728_102944991 | 3300033402 | Peat Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPAAPTPEPVLAAER |
Ga0316605_121944882 | 3300033408 | Soil | MQAVTELSAIVGIVAACDALGIARAAFYRRRPRLRLVEG |
Ga0316627_1016429702 | 3300033482 | Soil | MDAVTHLAPTVGVLAACDFLGVARGSFYRQRPVFGPPALPPPE |
Ga0316628_1029597172 | 3300033513 | Soil | MDAVTHLAPTVGVLAACDVLGVARASCYRQRPMLGPPASPASELALPAQ |
Ga0316628_1042023671 | 3300033513 | Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPPASPAPE |
Ga0316616_1036517951 | 3300033521 | Soil | MNAVTELTPTVGILAACDFLGVARASFYRQRPRLGPAASSV |
Ga0334821_066991_606_713 | 3300033798 | Soil | MDAVAHLAPTVGIVAACDCFAVARASFYRQRPVLGP |
Ga0334840_139624_499_642 | 3300033824 | Soil | MDAVTRLAPTVGIVAACDFLAVARASFYRQRPVLGPSASPAPEPVTPS |
Ga0334811_180734_3_116 | 3300033891 | Soil | MDAVTHLAPTVGVVAACDFLGVARASFYRQRPVLGPAA |
Ga0371487_0376607_488_619 | 3300033982 | Peat Soil | MDAVAHLAPTVGIVAACDCLAVARASFYRQRPVLGPPASPAPKP |
Ga0364923_0107791_3_110 | 3300034690 | Sediment | MDAVLTLSPTVGIQAACDHLAVARASLYRQRPRFGP |
⦗Top⦘ |