Basic Information | |
---|---|
Family ID | F041111 |
Family Type | Metagenome |
Number of Sequences | 160 |
Average Sequence Length | 45 residues |
Representative Sequence | HDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGDFTS |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.26 % |
% of genes near scaffold ends (potentially truncated) | 99.38 % |
% of genes from short scaffolds (< 2000 bps) | 81.25 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.250 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.625 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF06441 | EHN | 3.12 |
PF00072 | Response_reg | 2.50 |
PF04237 | YjbR | 2.50 |
PF05598 | DUF772 | 1.88 |
PF02627 | CMD | 1.25 |
PF01979 | Amidohydro_1 | 1.25 |
PF00903 | Glyoxalase | 1.25 |
PF07007 | LprI | 1.25 |
PF00893 | Multi_Drug_Res | 1.25 |
PF14534 | DUF4440 | 1.25 |
PF04250 | DUF429 | 1.25 |
PF06739 | SBBP | 1.25 |
PF04545 | Sigma70_r4 | 1.25 |
PF00891 | Methyltransf_2 | 0.62 |
PF11752 | DUF3309 | 0.62 |
PF00581 | Rhodanese | 0.62 |
PF05593 | RHS_repeat | 0.62 |
PF00034 | Cytochrom_C | 0.62 |
PF08281 | Sigma70_r4_2 | 0.62 |
PF03551 | PadR | 0.62 |
PF03083 | MtN3_slv | 0.62 |
PF00383 | dCMP_cyt_deam_1 | 0.62 |
PF02472 | ExbD | 0.62 |
PF00578 | AhpC-TSA | 0.62 |
PF13646 | HEAT_2 | 0.62 |
PF00486 | Trans_reg_C | 0.62 |
PF03544 | TonB_C | 0.62 |
PF02371 | Transposase_20 | 0.62 |
PF02836 | Glyco_hydro_2_C | 0.62 |
PF14559 | TPR_19 | 0.62 |
PF03819 | MazG | 0.62 |
PF01740 | STAS | 0.62 |
PF07080 | DUF1348 | 0.62 |
PF00005 | ABC_tran | 0.62 |
PF14300 | DUF4375 | 0.62 |
PF07929 | PRiA4_ORF3 | 0.62 |
PF13742 | tRNA_anti_2 | 0.62 |
PF01833 | TIG | 0.62 |
PF16640 | Big_3_5 | 0.62 |
PF00239 | Resolvase | 0.62 |
PF13560 | HTH_31 | 0.62 |
PF08002 | DUF1697 | 0.62 |
PF13358 | DDE_3 | 0.62 |
PF13649 | Methyltransf_25 | 0.62 |
PF01872 | RibD_C | 0.62 |
PF00069 | Pkinase | 0.62 |
PF12704 | MacB_PCD | 0.62 |
PF08241 | Methyltransf_11 | 0.62 |
PF08478 | POTRA_1 | 0.62 |
PF01548 | DEDD_Tnp_IS110 | 0.62 |
PF07813 | LTXXQ | 0.62 |
PF02781 | G6PD_C | 0.62 |
PF07366 | SnoaL | 0.62 |
PF06662 | C5-epim_C | 0.62 |
PF16864 | Dimerisation2 | 0.62 |
PF12833 | HTH_18 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 3.12 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.50 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.50 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.50 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.25 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 1.25 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.25 |
COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 1.25 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 1.25 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.62 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.62 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.62 |
COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.62 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.62 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.62 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.62 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.62 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.62 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.62 |
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.62 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.62 |
COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.62 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.62 |
COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 0.62 |
COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.25 % |
Unclassified | root | N/A | 23.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10024439 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. RBG_13_44_9 | 4192 | Open in IMG/M |
3300001593|JGI12635J15846_10044884 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
3300005166|Ga0066674_10188491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300005174|Ga0066680_10323778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
3300005176|Ga0066679_10313085 | Not Available | 1022 | Open in IMG/M |
3300005181|Ga0066678_10799497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300005445|Ga0070708_100211468 | Not Available | 1817 | Open in IMG/M |
3300005534|Ga0070735_10402013 | Not Available | 820 | Open in IMG/M |
3300005537|Ga0070730_10093782 | Not Available | 2085 | Open in IMG/M |
3300005538|Ga0070731_10013166 | All Organisms → cellular organisms → Bacteria | 5983 | Open in IMG/M |
3300005538|Ga0070731_10119426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaU1.Bin002 | 1746 | Open in IMG/M |
3300005540|Ga0066697_10411531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300005542|Ga0070732_10201823 | Not Available | 1188 | Open in IMG/M |
3300005552|Ga0066701_10597221 | Not Available | 673 | Open in IMG/M |
3300005556|Ga0066707_10519626 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005557|Ga0066704_10893814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300005576|Ga0066708_10558805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300005712|Ga0070764_10363741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 848 | Open in IMG/M |
3300005993|Ga0080027_10062184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1362 | Open in IMG/M |
3300006032|Ga0066696_10117342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus | 1623 | Open in IMG/M |
3300006050|Ga0075028_100007924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4266 | Open in IMG/M |
3300006052|Ga0075029_100056192 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300006052|Ga0075029_100162021 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300006052|Ga0075029_100259098 | Not Available | 1100 | Open in IMG/M |
3300006059|Ga0075017_100223385 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300006086|Ga0075019_10018883 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
3300006086|Ga0075019_10178621 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300006102|Ga0075015_100114701 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300006794|Ga0066658_10648853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 578 | Open in IMG/M |
3300006800|Ga0066660_10482513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300006881|Ga0068865_100300492 | Not Available | 1284 | Open in IMG/M |
3300006881|Ga0068865_101451670 | Not Available | 614 | Open in IMG/M |
3300007255|Ga0099791_10526033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300009089|Ga0099828_10000767 | All Organisms → cellular organisms → Bacteria | 20279 | Open in IMG/M |
3300009089|Ga0099828_10077134 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
3300009089|Ga0099828_10199972 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300009089|Ga0099828_11182403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300009089|Ga0099828_11287082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300009090|Ga0099827_11584061 | Not Available | 570 | Open in IMG/M |
3300009098|Ga0105245_10383477 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300009137|Ga0066709_103200515 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009177|Ga0105248_10520112 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300009524|Ga0116225_1079195 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300009547|Ga0116136_1148347 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009644|Ga0116121_1000699 | All Organisms → cellular organisms → Bacteria | 16204 | Open in IMG/M |
3300009644|Ga0116121_1185287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 660 | Open in IMG/M |
3300011444|Ga0137463_1058519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
3300012199|Ga0137383_10473224 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300012199|Ga0137383_10858008 | Not Available | 663 | Open in IMG/M |
3300012201|Ga0137365_10135605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1850 | Open in IMG/M |
3300012202|Ga0137363_10313253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
3300012205|Ga0137362_10733582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
3300012206|Ga0137380_10500773 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300012206|Ga0137380_11481994 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012208|Ga0137376_10256665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
3300012208|Ga0137376_10343160 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300012208|Ga0137376_10502785 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300012209|Ga0137379_11599108 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012210|Ga0137378_11027086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300012211|Ga0137377_10885568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
3300012356|Ga0137371_10837207 | Not Available | 700 | Open in IMG/M |
3300012361|Ga0137360_11853660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300012917|Ga0137395_10058917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2443 | Open in IMG/M |
3300012918|Ga0137396_10676471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300012918|Ga0137396_10899524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300012922|Ga0137394_10623549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
3300012925|Ga0137419_11049990 | Not Available | 677 | Open in IMG/M |
3300012930|Ga0137407_10273045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1538 | Open in IMG/M |
3300012944|Ga0137410_10317015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
3300012944|Ga0137410_11678527 | Not Available | 558 | Open in IMG/M |
3300012944|Ga0137410_12124886 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300013105|Ga0157369_10138412 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300013296|Ga0157374_10050365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3871 | Open in IMG/M |
3300013297|Ga0157378_10948397 | Not Available | 893 | Open in IMG/M |
3300014489|Ga0182018_10022369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4142 | Open in IMG/M |
3300014489|Ga0182018_10277839 | Not Available | 916 | Open in IMG/M |
3300014489|Ga0182018_10307215 | Not Available | 861 | Open in IMG/M |
3300014495|Ga0182015_10004697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14582 | Open in IMG/M |
3300014495|Ga0182015_10417268 | Not Available | 864 | Open in IMG/M |
3300014501|Ga0182024_10560894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1439 | Open in IMG/M |
3300014838|Ga0182030_10093584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4217 | Open in IMG/M |
3300014838|Ga0182030_10119503 | Not Available | 3516 | Open in IMG/M |
3300014968|Ga0157379_11987286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300015264|Ga0137403_10346862 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300015357|Ga0134072_10457320 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300017924|Ga0187820_1061914 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300017932|Ga0187814_10443159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300017933|Ga0187801_10328049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300017935|Ga0187848_10296678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 675 | Open in IMG/M |
3300017943|Ga0187819_10045987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2586 | Open in IMG/M |
3300017993|Ga0187823_10312430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300018033|Ga0187867_10196970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1146 | Open in IMG/M |
3300018033|Ga0187867_10251915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 995 | Open in IMG/M |
3300018033|Ga0187867_10281216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
3300018034|Ga0187863_10068998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1998 | Open in IMG/M |
3300018043|Ga0187887_10002169 | All Organisms → cellular organisms → Bacteria | 15942 | Open in IMG/M |
3300018043|Ga0187887_10212874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1148 | Open in IMG/M |
3300018047|Ga0187859_10110313 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300018433|Ga0066667_10244517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1355 | Open in IMG/M |
3300019887|Ga0193729_1040431 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300019999|Ga0193718_1023955 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300020004|Ga0193755_1159431 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300020581|Ga0210399_10316836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
3300020582|Ga0210395_10637430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300020583|Ga0210401_10776005 | Not Available | 818 | Open in IMG/M |
3300021168|Ga0210406_10699148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300021170|Ga0210400_10147866 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
3300021344|Ga0193719_10379631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300021402|Ga0210385_11359376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300021478|Ga0210402_10599698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
3300021479|Ga0210410_11313383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300025134|Ga0207416_1134592 | Not Available | 841 | Open in IMG/M |
3300025473|Ga0208190_1005454 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
3300025878|Ga0209584_10147968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 884 | Open in IMG/M |
3300025928|Ga0207700_10026989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4014 | Open in IMG/M |
3300025938|Ga0207704_11647799 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300025960|Ga0207651_10257861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1430 | Open in IMG/M |
3300026078|Ga0207702_10901104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300026095|Ga0207676_12069002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300026309|Ga0209055_1115788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
3300026318|Ga0209471_1009707 | All Organisms → cellular organisms → Bacteria | 5077 | Open in IMG/M |
3300026326|Ga0209801_1058805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1728 | Open in IMG/M |
3300026528|Ga0209378_1053794 | Not Available | 1936 | Open in IMG/M |
3300026529|Ga0209806_1271671 | Not Available | 570 | Open in IMG/M |
3300026538|Ga0209056_10084993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2649 | Open in IMG/M |
3300026552|Ga0209577_10821814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300027505|Ga0209218_1042004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300027575|Ga0209525_1049228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
3300027667|Ga0209009_1018304 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
3300027681|Ga0208991_1009168 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
3300027745|Ga0209908_10211813 | Not Available | 534 | Open in IMG/M |
3300027829|Ga0209773_10257030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300027853|Ga0209274_10303644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300027857|Ga0209166_10062132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2143 | Open in IMG/M |
3300027869|Ga0209579_10140171 | Not Available | 1287 | Open in IMG/M |
3300027875|Ga0209283_10210836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1290 | Open in IMG/M |
3300027889|Ga0209380_10834801 | Not Available | 520 | Open in IMG/M |
3300027908|Ga0209006_10766913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300028015|Ga0265353_1000819 | Not Available | 1875 | Open in IMG/M |
3300028380|Ga0268265_11174624 | Not Available | 764 | Open in IMG/M |
3300028381|Ga0268264_11215161 | Not Available | 763 | Open in IMG/M |
3300028746|Ga0302233_10338732 | Not Available | 569 | Open in IMG/M |
3300030047|Ga0302286_10658689 | Not Available | 534 | Open in IMG/M |
3300031231|Ga0170824_118089369 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300031231|Ga0170824_126567792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
3300031234|Ga0302325_11905288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300031344|Ga0265316_10927747 | Not Available | 607 | Open in IMG/M |
3300031525|Ga0302326_10287517 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
3300031711|Ga0265314_10539396 | Not Available | 608 | Open in IMG/M |
3300031715|Ga0307476_11369577 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031718|Ga0307474_10077546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2469 | Open in IMG/M |
3300032180|Ga0307471_100015753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5321 | Open in IMG/M |
3300032180|Ga0307471_100522044 | Not Available | 1338 | Open in IMG/M |
3300032180|Ga0307471_101383194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 864 | Open in IMG/M |
3300032180|Ga0307471_101417824 | Not Available | 854 | Open in IMG/M |
3300032180|Ga0307471_101702564 | Not Available | 784 | Open in IMG/M |
3300032180|Ga0307471_104226812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300032893|Ga0335069_11637335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 688 | Open in IMG/M |
3300033829|Ga0334854_010838 | Not Available | 2217 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.88% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.25% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.25% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.25% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.62% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_100244391 | 3300001356 | Peatlands Soil | SDDENPTEHGRMLPSNMLLLNLIPLIDVTFSTPTGDYTH* |
JGI12635J15846_100448841 | 3300001593 | Forest Soil | DENQTQHGRMPSSNMLPLNLILLIDVTFSTPTPVLVN* |
Ga0066674_101884911 | 3300005166 | Soil | HHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS* |
Ga0066680_103237783 | 3300005174 | Soil | QQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS* |
Ga0066679_103130853 | 3300005176 | Soil | DQQASDDQNQTEHGQMLSSNMLLLNLILLIDVTFSTPTPVLDS* |
Ga0066678_107994972 | 3300005181 | Soil | DQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPVDNS* |
Ga0070708_1002114684 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | HHDQQASDDQNPTEHEQMLSSSMLLLNLILLIDVTFSTPTGDSAHPLS* |
Ga0070735_104020132 | 3300005534 | Surface Soil | HDQQASGDRNQTEHGQTLSSTMLLPNPILPIDVTFSTPTADNNS* |
Ga0070730_100937821 | 3300005537 | Surface Soil | HDQQTSDDENPTEHGPMLPSNMLLLNLILLIDVTFSTPTVDSTQNL* |
Ga0070731_1001316611 | 3300005538 | Surface Soil | HHDQQASNDENPTEHARMLPSNTLLLNRILPIDVTFSTPTRFCNSD* |
Ga0070731_101194262 | 3300005538 | Surface Soil | QQASNDENPTEHARMLPSNTLLPNLILLIDVTFSTPTPDCTQNA* |
Ga0066697_104115311 | 3300005540 | Soil | ASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGVCTQNPDCE* |
Ga0070732_102018232 | 3300005542 | Surface Soil | PTEHERMLPSNTLLLNLIPLIDVTFSTPTRDFTH* |
Ga0066701_105972212 | 3300005552 | Soil | QNQTEHGQMLSSNMLLLNLILLIDVTFSTPTPVLDS* |
Ga0066707_105196262 | 3300005556 | Soil | DQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDYNS* |
Ga0066704_108938141 | 3300005557 | Soil | QASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS* |
Ga0066708_105588051 | 3300005576 | Soil | QASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTT* |
Ga0070764_103637411 | 3300005712 | Soil | QASDDENPTEHGRMLFSNMLLLSLILLIDVTFSTPTIYRQLS* |
Ga0080027_100621843 | 3300005993 | Prmafrost Soil | SDDQNQTEHGRMLSSNMLLLNLIPLIDVTFSTPTGDYTH* |
Ga0066696_101173421 | 3300006032 | Soil | HHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTT* |
Ga0075028_1000079241 | 3300006050 | Watersheds | NQTEHGRMLSSNMLLLNLILLIDVTFSTPTPHITH* |
Ga0075029_1000561921 | 3300006052 | Watersheds | QQASDDENPTEHAQMLLHSMLLLNLILPIDVTFSTPTPVNNSKS* |
Ga0075029_1001620215 | 3300006052 | Watersheds | DQQASDDENPTEHAQMLFHSMLLLNLILPIDVTFSTPTGLYAQNAEW* |
Ga0075029_1002590982 | 3300006052 | Watersheds | DQQASDDENPTQHAQMLFHSMLLLNLILPIDVTFSTPTPVFNSY* |
Ga0075017_1002233855 | 3300006059 | Watersheds | HHDQQASDDENPTEHAQMLFHSMLLLNLILPIDVTFSTPTGLYAQNAEW* |
Ga0075019_100188836 | 3300006086 | Watersheds | HDQQASDDENPTQHAQMLFHSMLLLNLILPIDVTFSTPTRYFANNRGPFL* |
Ga0075019_101786211 | 3300006086 | Watersheds | HHDQQASDDENPTEHAQMLLHSMLLLNLILPIDVTFSTPTGLYAQNAEW* |
Ga0075015_1001147011 | 3300006102 | Watersheds | HDQQASDDENPTEHAQMLLHSMLLLNLILPIDVTFSTPTGLYAQNAEW* |
Ga0066658_106488531 | 3300006794 | Soil | HDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTSYHL* |
Ga0066660_104825132 | 3300006800 | Soil | DENPTEHGRMLSSNMLLLNLIPLIVVTFSTPTPHYIY* |
Ga0068865_1003004921 | 3300006881 | Miscanthus Rhizosphere | HHDQQASDDRNQTKHGRMLPSNMLLLNLILPIDVTFSTPTGDYTQNPV* |
Ga0068865_1014516701 | 3300006881 | Miscanthus Rhizosphere | TEHGRMFPSNMLLLNLILLIDVTFSTPTPVLVNQP* |
Ga0099791_105260331 | 3300007255 | Vadose Zone Soil | DQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGDYTNYGS* |
Ga0099828_100007671 | 3300009089 | Vadose Zone Soil | QASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGFYTHNQVNERRYYANNAE* |
Ga0099828_100771344 | 3300009089 | Vadose Zone Soil | PHHDQQASDDRNQTEHGRMLSSNMLLLNLILLIDAPFSTPTGVYPIYER* |
Ga0099828_101999721 | 3300009089 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGVYAHNPVNE* |
Ga0099828_111824031 | 3300009089 | Vadose Zone Soil | SDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTPVYITYADALQ* |
Ga0099828_112870821 | 3300009089 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGDFTS* |
Ga0099827_115840612 | 3300009090 | Vadose Zone Soil | HDQQTSDDQNPTEHGRMLSSNLLLLNLILLIEVTFSTPTG* |
Ga0105245_103834772 | 3300009098 | Miscanthus Rhizosphere | PHHDQQASGDRNQTEHVRMLSSNMLSSNLILPIDVTFSTPTPDFDN* |
Ga0066709_1032005151 | 3300009137 | Grasslands Soil | PHHDQQASDDRNQTEHGRILSSNMLLPNLIPLIDVTFSTPTGDYTSEHEEFIDSR* |
Ga0105248_105201121 | 3300009177 | Switchgrass Rhizosphere | RNQTKQGRMLSSNMLLLNLILLIDVTFSTPTGDYTH* |
Ga0116225_10791951 | 3300009524 | Peatlands Soil | RAVVLPHHDQQTSDDQNQTKHGRMLSSNMLLLILILLIDVTFSTPTGDSAH* |
Ga0116136_11483472 | 3300009547 | Peatland | AAVVLPHHDQQASDDQNPTQHGQMFFSTMLLLNLIPLIDVTFSTPTRYYVN* |
Ga0116121_10006991 | 3300009644 | Peatland | QQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPDYAHHQ* |
Ga0116121_11852872 | 3300009644 | Peatland | DDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPGFASYAERMA* |
Ga0137463_10585193 | 3300011444 | Soil | DDQNQTEHGRMLPSNMLLLDLIPLIDVTFSTPTPVINN* |
Ga0137383_104732242 | 3300012199 | Vadose Zone Soil | PHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDYNS* |
Ga0137383_108580081 | 3300012199 | Vadose Zone Soil | TAVVLPHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTVDHNK* |
Ga0137365_101356053 | 3300012201 | Vadose Zone Soil | PHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIEVTFSTPTGEFTH* |
Ga0137363_103132532 | 3300012202 | Vadose Zone Soil | LPHHDQQASDDQNQTEHGRMLPSNMLLLNLIPLIDVTFSTPTPVIIH* |
Ga0137362_107335823 | 3300012205 | Vadose Zone Soil | DDQNQTEHGQMLSSSMLLLNLILLIEVTFSTPTGVSTQNPLR* |
Ga0137380_105007731 | 3300012206 | Vadose Zone Soil | AVVLPHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDYNS* |
Ga0137380_114819942 | 3300012206 | Vadose Zone Soil | DQQASDDQNQTEHGRMLPSNMLLQNLILLIEVTFSTPTPVLAK* |
Ga0137376_102566651 | 3300012208 | Vadose Zone Soil | DDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS* |
Ga0137376_103431601 | 3300012208 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDYNS* |
Ga0137376_105027851 | 3300012208 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPVINSQAPCE* |
Ga0137379_115991082 | 3300012209 | Vadose Zone Soil | PHHDQQASDDQNQTEHGRMLPSNMLLQNLILLIEVTFSTPTPVLAK* |
Ga0137378_110270861 | 3300012210 | Vadose Zone Soil | PTEHEQILSSSMLLLNLIPLIDVTFSTPTGHLTF* |
Ga0137377_108855682 | 3300012211 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDNDN* |
Ga0137371_108372071 | 3300012356 | Vadose Zone Soil | DQQTSDDQNPTEHGRMLSSNLLLLNLILLIEVTFSTPTG* |
Ga0137360_118536603 | 3300012361 | Vadose Zone Soil | ASDDRNQTEHGRMLPSNMLLLNFILLIDVTFSTPTSDSIDPF* |
Ga0137395_100589173 | 3300012917 | Vadose Zone Soil | QQSSDDRNQIKHGRMLSSNMLLLNLILLIDVTFSTPTRFIAN* |
Ga0137396_106764711 | 3300012918 | Vadose Zone Soil | DQQASEDRNQTEHGRMLSSNTLLLNLILLIDVTFSTPTPDCVN* |
Ga0137396_108995241 | 3300012918 | Vadose Zone Soil | DQQASEDRNQTEHGRMLSSNTLLLNLILLIDVTFSTPTPDFIN* |
Ga0137394_106235491 | 3300012922 | Vadose Zone Soil | DRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTPVYNN* |
Ga0137419_110499902 | 3300012925 | Vadose Zone Soil | DQQASDDENPTKHGQMLSSNMLQLNLILLIDVTFSTPTPVIVDRRDHCLRRY* |
Ga0137407_102730451 | 3300012930 | Vadose Zone Soil | HDQQASDDQNQTEHGQILPSSTLLLNLILLIKVTFSTPTPGFAN* |
Ga0137410_103170151 | 3300012944 | Vadose Zone Soil | PHHDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTGDYAH* |
Ga0137410_116785271 | 3300012944 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTPVNNS* |
Ga0137410_121248861 | 3300012944 | Vadose Zone Soil | HDQQASDDRNQTEHGRMLSSNMLLLNLILLIDVTFSTPTPVLTS* |
Ga0157369_101384123 | 3300013105 | Corn Rhizosphere | DQQASDDRNQTKHGRMLPSNMLLLNLILPIDVTFSTPTGDYTH* |
Ga0157374_100503651 | 3300013296 | Miscanthus Rhizosphere | PHHDQQASDDQNQTEHGRMFPSNMLLLNLILLIDVTFSTPTPVLVNQP* |
Ga0157378_109483972 | 3300013297 | Miscanthus Rhizosphere | QNPTEHAQMLSFSMLLLNLILLIDVTFSTPTGDYTH* |
Ga0182018_100223698 | 3300014489 | Palsa | HHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTLDYTH* |
Ga0182018_102778391 | 3300014489 | Palsa | PHHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTPHYAH* |
Ga0182018_103072152 | 3300014489 | Palsa | HDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTPVYNNQSGRKSIFRL* |
Ga0182015_1000469718 | 3300014495 | Palsa | PHHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTGVIIKIGYDARRRS* |
Ga0182015_104172682 | 3300014495 | Palsa | HHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTPVYNNQSGRKSIFRL* |
Ga0182024_105608941 | 3300014501 | Permafrost | RRQVSDDENPTEHGQMPSSNMLPLNLILLINVTFSTPTPVCDN* |
Ga0182030_100935841 | 3300014838 | Bog | PHHDQQASDNENQTKHVRMLSSNMLLPNLILLIDVTFSTPTPNITH* |
Ga0182030_101195031 | 3300014838 | Bog | HDQQASDNENQTKHVRMLSSNMLLPNLILLIDVTFSTPTGDSTF* |
Ga0157379_119872861 | 3300014968 | Switchgrass Rhizosphere | DDENPTEHGRMLSSNMLLLNLILLIHVTFSTPTA* |
Ga0137403_103468624 | 3300015264 | Vadose Zone Soil | PHHDQQSSDDRNQTEHGRMLSSSMLLLNLILLIDVTFSTPTLDFVNYQPISAQAAVG* |
Ga0134072_104573202 | 3300015357 | Grasslands Soil | HDQQASDDQNQTEHGRMLFSNMLLLNLIPLIDVTFSTPTPDFDSYVVENSS* |
Ga0132257_1018979531 | 3300015373 | Arabidopsis Rhizosphere | AVVLPHHDQQASDDRNQTKHGRMLPSNMLLLNLILPIDVTFSTPTPVYINYQRTVSD* |
Ga0187820_10619143 | 3300017924 | Freshwater Sediment | AVVLPHHDQQASDDENPTEHGQTLSSNMLPLNLILLIAVTFSTRTPDSDN |
Ga0187814_104431592 | 3300017932 | Freshwater Sediment | DQQSSDDRNQTEHVRMLSSNMLLLIFILPIDVTFSTPTGDYAHNPSWL |
Ga0187801_103280491 | 3300017933 | Freshwater Sediment | ASDDQNPTEHGQMLSSNMLPLNLILLIAVTFSTPTGDYTL |
Ga0187848_102966781 | 3300017935 | Peatland | HHDQQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPGFASYAERMA |
Ga0187819_100459874 | 3300017943 | Freshwater Sediment | PHHDQQASDDENPTEHGQMLSSNMLPLNLILLIAVTFSTPTPHYTHDRENNARPDC |
Ga0187823_103124301 | 3300017993 | Freshwater Sediment | NQTEHGQMLSSSMLLLNLILLIDVTFSTPTGGYTHCGVLSVMAI |
Ga0187867_101969701 | 3300018033 | Peatland | HHDQQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTGYFAN |
Ga0187867_102519151 | 3300018033 | Peatland | HDQQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPGFASYAERMA |
Ga0187867_102812163 | 3300018033 | Peatland | HHDQQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPDYAHHQ |
Ga0187863_100689981 | 3300018034 | Peatland | HHDQQASDDENPTEHGRMLSSNMLLPNLIPLIDVTFSTPTGDYTHPPQGA |
Ga0187887_100021691 | 3300018043 | Peatland | QQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPDYAHHQ |
Ga0187887_102128741 | 3300018043 | Peatland | PHHDQQPSDDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTGYFAN |
Ga0187859_101103131 | 3300018047 | Peatland | DDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPDYAHHQ |
Ga0066667_102445173 | 3300018433 | Grasslands Soil | QQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS |
Ga0193729_10404311 | 3300019887 | Soil | EDRNQTEHGRMLSSNTLLLNLILLIDVTFSTPTGHYAHNTVGA |
Ga0193718_10239551 | 3300019999 | Soil | HHDQQASDDQNQRQHVQMLSSSMLLLNLIPLIDVTFSTPTGDNTH |
Ga0193755_11594312 | 3300020004 | Soil | MLPHHDQQASDDQNQTEHGRMLPSNMLLLNLIPLIDVTFSTPTPDRQ |
Ga0210399_103168362 | 3300020581 | Soil | LPHHDQQASDDQNPTEHGRMLSSNMLLPNLILLIDVTFSTPTPVNVT |
Ga0210395_106374303 | 3300020582 | Soil | LPHHDQQASDDENPTKHGRMLFSNMLLPNLIPLIDVTFSTPTGFIAS |
Ga0210401_107760051 | 3300020583 | Soil | LPHHDQQASDDQNQTQHGRMLPSNMLLLNLIPLINVTFSTPTRYFNN |
Ga0210406_106991482 | 3300021168 | Soil | DQQSSDDQNQTQHRQMPSSNTLLLNLILLIDVTVSTPTPAINS |
Ga0210400_101478662 | 3300021170 | Soil | LPHHDQQASDDENQTEHGHSLSSNMLLLKLILLIDVTFSTPTDDYTNRPHVRGTRP |
Ga0193719_103796312 | 3300021344 | Soil | LPHHDQQTSDDENQTEHRRMPSSNMLLLNLILLIEVTFSTPTPVNVN |
Ga0210385_113593761 | 3300021402 | Soil | VLPHHEEQASDNRNPTKHGQTLSSNMLLLNFILLIDVTFSTPTFIANNP |
Ga0210402_105996982 | 3300021478 | Soil | PHHDQQASDDQNPTEHGQMFSSTMLLPNLIPLIDVTFSTPTGHYTY |
Ga0210410_113133831 | 3300021479 | Soil | LPHHDQQASDDRNPTKHGRMLSSNMLLLNLIPLIDVTFSTPTGHFTH |
Ga0207416_11345922 | 3300025134 | Iron-Sulfur Acid Spring | SHHDQQASGDRNQTEHVQMLSSNTLLLNLILLIDVTFSTPTGHFTQVPAGP |
Ga0208190_10054541 | 3300025473 | Peatland | DDQNQTEHGRMLSSNMLLPNLIPLIDVTFSTPTPGFASYAERMA |
Ga0209584_101479682 | 3300025878 | Arctic Peat Soil | HHDQQASEDENQPEHGRMLSSNMLLPNLIPLIDVTFSTPTPVLDS |
Ga0207700_100269894 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NQTEHEQIPSSSMLLLYLIPLIDVTFSTPTGFFTN |
Ga0207704_116477992 | 3300025938 | Miscanthus Rhizosphere | HDQQASDDRNQTKHGRMLSSNMLLLNLILLIDVTFSTPTPDFDN |
Ga0207651_102578613 | 3300025960 | Switchgrass Rhizosphere | LPHHDQQASDDQNQTEHGRMFPSNMLLLNLILLIDVTFSTPTPVYVNFPEGIL |
Ga0207702_109011041 | 3300026078 | Corn Rhizosphere | NPTEHAQMLSFSMLLLNLILLIDVTFSTPTGDYTH |
Ga0207676_120690022 | 3300026095 | Switchgrass Rhizosphere | LPHHDQQASDDRNQTKHGRMLPSNMLLLNLILPIDVTFSTPTPVYAN |
Ga0209055_11157881 | 3300026309 | Soil | LPHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTT |
Ga0209471_10097071 | 3300026318 | Soil | DQQASDDQNQTEHGQMLSSNMLLLNLILLIDVTFSTPTPVLDS |
Ga0209801_10588054 | 3300026326 | Soil | LPHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPVYINYWPTAPE |
Ga0209378_10537943 | 3300026528 | Soil | PHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTPDYNS |
Ga0209806_12716711 | 3300026529 | Soil | DDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDYAH |
Ga0209056_100849931 | 3300026538 | Soil | LPHHDQQASDDRNQTEHGRMLSSNMLLRNLILLIDVTFSTPTGDFTHDS |
Ga0209577_108218142 | 3300026552 | Soil | QASDDQNQTEHGQMLSSNMLLLNLILLIDVTFSTPTGDCAH |
Ga0209218_10420041 | 3300027505 | Forest Soil | HHDQQSSDDENRTEHGQMLSSNTLLLNLIPLIDVTFSTPTPVDNSEFE |
Ga0209525_10492282 | 3300027575 | Forest Soil | ENRNQTEHGRMLSSTMLPLNLILLIDVTFSTPTGDYTNYGQLV |
Ga0209009_10183043 | 3300027667 | Forest Soil | EDRNQTEHGRMLSSTMLLLNLILLIDVTFSTPTPGYVN |
Ga0208991_10091681 | 3300027681 | Forest Soil | NQTEHGRMLSSNMLLLNLILLIEVTFSTPTGNSAH |
Ga0209908_102118132 | 3300027745 | Thawing Permafrost | LPHHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTGDYTH |
Ga0209773_102570301 | 3300027829 | Bog Forest Soil | DQNQTEHVRMLSSNMLLPNLIPLIDVTFSTPTPGFNT |
Ga0209274_103036442 | 3300027853 | Soil | LPHHNQQASDDQNPTEHGRMLSSNMLLRNLIPLIDVTFSTPTGDFTH |
Ga0209166_100621321 | 3300027857 | Surface Soil | LPHHDQQTSDDENPTEHGPMLPSNMLLLNLILLIDVTFSTPTVDSTQNL |
Ga0209579_101401711 | 3300027869 | Surface Soil | QQASNDENPTEHARMLPSNTLLPNLILLIDVTFSTPTPDCTQNA |
Ga0209283_102108363 | 3300027875 | Vadose Zone Soil | PHHDQQASDDRNQTEHGRMLSSNMLLLNLILLIDAPFSTPTGVYPIYER |
Ga0209380_108348011 | 3300027889 | Soil | VLPHHDQQASDDENPTEHGRMLFSNMLLLNLILLIDVTFSTPTPDYNNNHRLNSH |
Ga0209006_107669131 | 3300027908 | Forest Soil | DENRTEHGQMLSSNTLLLNLIPLIDVTFSTPTPVDNSEFE |
Ga0265353_10008191 | 3300028015 | Soil | LPHHDQQASDDENPTEHGRMLSSNMLLPNLIPLIDVTFSTPTPVNVN |
Ga0268265_111746242 | 3300028380 | Switchgrass Rhizosphere | DDQNQTEHGRMFPSNMLLLNLILLIDVTFSTPTPVLVNQP |
Ga0268264_112151611 | 3300028381 | Switchgrass Rhizosphere | HHDQQASDDRNQTKHGRMLSSNMLLLNLILLIDVTFSTPTPVNNIWKKMDKCD |
Ga0302233_103387321 | 3300028746 | Palsa | LPHHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTPVFVN |
Ga0302286_106586892 | 3300030047 | Fen | PHHDQQASDDENPTEHGRILSSTTLLLILSLRIDVTFSTPTPVNNNYVREARLFT |
Ga0170824_1180893691 | 3300031231 | Forest Soil | HHDQQASDDQNPTEHGRMLSSNMLLPNLIPLIDVTFSTPTPDCIS |
Ga0170824_1265677922 | 3300031231 | Forest Soil | VVLPHHDQQASDDQNQTEHGQMLSSNMLLLILILLIEVTFSTPTGDYTH |
Ga0302325_119052881 | 3300031234 | Palsa | VVLPHHDQKSSDDQNQTEHGQMLSSNMLLLNLILLIEVTFSTPTGDYTH |
Ga0265316_109277471 | 3300031344 | Rhizosphere | SDNENQTKHVRMLSSNMLLPNLILLIDVTFSTPTPVFISKGV |
Ga0302326_102875171 | 3300031525 | Palsa | PHHDQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTLDYTH |
Ga0265314_105393962 | 3300031711 | Rhizosphere | QASDNENQTKHVRMLSSNMLLPNLILLIDVTFSTPTPVFISKGV |
Ga0307476_113695771 | 3300031715 | Hardwood Forest Soil | QVTDQQASDDQNQTEHGRMLSSSMLLLNLILLIQVTFSTPTGCNAN |
Ga0307474_100775463 | 3300031718 | Hardwood Forest Soil | DDQNQTEHGRMLSSSMLLLNLILLTEVTFSTPTGI |
Ga0307471_1000157538 | 3300032180 | Hardwood Forest Soil | QQASDDQNQTEHGLMPSSNTPLWNLILLIDVTFSTPTPVYINC |
Ga0307471_1005220443 | 3300032180 | Hardwood Forest Soil | QNQTEHGLMPSSNTPLWNLILLIDVTFSTPTPVYDSQLPVG |
Ga0307471_1013831942 | 3300032180 | Hardwood Forest Soil | SNDRNQTEHGRMLPSNMLLLNLILLIEVTFSTPTPDYINYQNRDGKVLTAP |
Ga0307471_1014178241 | 3300032180 | Hardwood Forest Soil | ASDDQNQTEHGLMPSSNTPLWNLILLIDVTFSTPTGVHTH |
Ga0307471_1017025641 | 3300032180 | Hardwood Forest Soil | VSHHDQQASDDQNQTEHGLMPSSNTPLWNLILLIDVTFSTPTPDYTNYAPDST |
Ga0307471_1042268121 | 3300032180 | Hardwood Forest Soil | HHDQQASDDENPTEHGRMLSSNMLLLNLILLIHVTFSTPTPVYNSNRQTARR |
Ga0335069_116373352 | 3300032893 | Soil | LPHHDQQASDNQNPTEHGRLIPSNMLLLILIPLIDVTFSTPTRFIAN |
Ga0334854_010838_2_133 | 3300033829 | Soil | DQKSSDDQNQTEHGQMLSSYMLLLNLILLIEVTFSTPTPVFVN |
⦗Top⦘ |