Basic Information | |
---|---|
Family ID | F041917 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 43 residues |
Representative Sequence | SEMSALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAQDIEQKLQR |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.46 % |
% of genes near scaffold ends (potentially truncated) | 80.50 % |
% of genes from short scaffolds (< 2000 bps) | 86.16 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.421 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.126 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.075 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.396 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF13662 | Toprim_4 | 52.83 |
PF04055 | Radical_SAM | 3.77 |
PF01872 | RibD_C | 2.52 |
PF00380 | Ribosomal_S9 | 1.89 |
PF13517 | FG-GAP_3 | 1.89 |
PF10431 | ClpB_D2-small | 1.89 |
PF01966 | HD | 1.26 |
PF05368 | NmrA | 0.63 |
PF00903 | Glyoxalase | 0.63 |
PF00535 | Glycos_transf_2 | 0.63 |
PF13302 | Acetyltransf_3 | 0.63 |
PF00005 | ABC_tran | 0.63 |
PF12367 | PFO_beta_C | 0.63 |
PF02405 | MlaE | 0.63 |
PF16826 | DUF5076 | 0.63 |
PF13460 | NAD_binding_10 | 0.63 |
PF01479 | S4 | 0.63 |
PF04241 | DUF423 | 0.63 |
PF13673 | Acetyltransf_10 | 0.63 |
PF06283 | ThuA | 0.63 |
PF04237 | YjbR | 0.63 |
COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.52 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.52 |
COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 1.89 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.63 |
COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.63 |
COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.42 % |
Unclassified | root | N/A | 12.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886013|SwBSRL2_contig_12355323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1032 | Open in IMG/M |
3300004463|Ga0063356_103747053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 655 | Open in IMG/M |
3300004479|Ga0062595_100068249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1731 | Open in IMG/M |
3300005187|Ga0066675_10044473 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
3300005337|Ga0070682_100542394 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 909 | Open in IMG/M |
3300005435|Ga0070714_101890511 | Not Available | 583 | Open in IMG/M |
3300005440|Ga0070705_101390859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
3300005451|Ga0066681_10920148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300005468|Ga0070707_100050720 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3978 | Open in IMG/M |
3300005471|Ga0070698_101013711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 777 | Open in IMG/M |
3300005536|Ga0070697_101465109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
3300005540|Ga0066697_10707649 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 551 | Open in IMG/M |
3300005542|Ga0070732_10332124 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 914 | Open in IMG/M |
3300005545|Ga0070695_101711437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
3300005552|Ga0066701_10279255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1035 | Open in IMG/M |
3300005557|Ga0066704_10231644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1253 | Open in IMG/M |
3300005558|Ga0066698_10148781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1580 | Open in IMG/M |
3300005561|Ga0066699_10929576 | Not Available | 605 | Open in IMG/M |
3300005566|Ga0066693_10241191 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300005569|Ga0066705_10446348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 810 | Open in IMG/M |
3300005574|Ga0066694_10393271 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005764|Ga0066903_107229132 | Not Available | 574 | Open in IMG/M |
3300005937|Ga0081455_10609075 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 710 | Open in IMG/M |
3300006034|Ga0066656_10686156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 659 | Open in IMG/M |
3300006175|Ga0070712_100574655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 952 | Open in IMG/M |
3300006176|Ga0070765_101508099 | Not Available | 633 | Open in IMG/M |
3300006794|Ga0066658_10435335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 714 | Open in IMG/M |
3300006797|Ga0066659_10692770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 832 | Open in IMG/M |
3300006800|Ga0066660_11648967 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
3300006871|Ga0075434_101082711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 815 | Open in IMG/M |
3300006904|Ga0075424_101167068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 820 | Open in IMG/M |
3300009088|Ga0099830_11523120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
3300009137|Ga0066709_100048861 | All Organisms → cellular organisms → Bacteria | 4750 | Open in IMG/M |
3300009176|Ga0105242_12415646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
3300010036|Ga0126305_11182463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
3300010048|Ga0126373_10468842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1297 | Open in IMG/M |
3300010304|Ga0134088_10420585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
3300010320|Ga0134109_10021733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1974 | Open in IMG/M |
3300010321|Ga0134067_10364243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
3300010323|Ga0134086_10304749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
3300010326|Ga0134065_10081876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1045 | Open in IMG/M |
3300010329|Ga0134111_10461706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
3300010336|Ga0134071_10419700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 683 | Open in IMG/M |
3300010337|Ga0134062_10716821 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010376|Ga0126381_100202361 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300010376|Ga0126381_105081324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
3300010396|Ga0134126_12848522 | Not Available | 524 | Open in IMG/M |
3300010398|Ga0126383_10107221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2512 | Open in IMG/M |
3300010398|Ga0126383_10257273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1717 | Open in IMG/M |
3300010401|Ga0134121_13058882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
3300011411|Ga0153933_1000986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 8641 | Open in IMG/M |
3300012045|Ga0136623_10274905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 716 | Open in IMG/M |
3300012198|Ga0137364_10094476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 2094 | Open in IMG/M |
3300012198|Ga0137364_10835866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
3300012199|Ga0137383_10049574 | All Organisms → cellular organisms → Bacteria | 2998 | Open in IMG/M |
3300012199|Ga0137383_11013005 | Not Available | 605 | Open in IMG/M |
3300012201|Ga0137365_10011520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6978 | Open in IMG/M |
3300012201|Ga0137365_10055492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2993 | Open in IMG/M |
3300012201|Ga0137365_10915331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 639 | Open in IMG/M |
3300012201|Ga0137365_11173210 | Not Available | 550 | Open in IMG/M |
3300012202|Ga0137363_10415283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1122 | Open in IMG/M |
3300012202|Ga0137363_11821777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
3300012205|Ga0137362_10344687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1290 | Open in IMG/M |
3300012205|Ga0137362_10812220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 801 | Open in IMG/M |
3300012207|Ga0137381_10646628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 920 | Open in IMG/M |
3300012207|Ga0137381_10805794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 814 | Open in IMG/M |
3300012208|Ga0137376_10111148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 2331 | Open in IMG/M |
3300012208|Ga0137376_10341893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1299 | Open in IMG/M |
3300012208|Ga0137376_10640603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 918 | Open in IMG/M |
3300012208|Ga0137376_11017060 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300012209|Ga0137379_11361293 | Not Available | 614 | Open in IMG/M |
3300012210|Ga0137378_11005341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 748 | Open in IMG/M |
3300012285|Ga0137370_10990833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300012356|Ga0137371_10273293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1318 | Open in IMG/M |
3300012356|Ga0137371_11386166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
3300012362|Ga0137361_10763419 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR10 | 881 | Open in IMG/M |
3300012582|Ga0137358_10037161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3216 | Open in IMG/M |
3300012882|Ga0157304_1102018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300012923|Ga0137359_10942178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 743 | Open in IMG/M |
3300012927|Ga0137416_11896739 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
3300012944|Ga0137410_11128388 | Not Available | 672 | Open in IMG/M |
3300012957|Ga0164303_11502480 | Not Available | 509 | Open in IMG/M |
3300012958|Ga0164299_10841804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 659 | Open in IMG/M |
3300012986|Ga0164304_10031718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2710 | Open in IMG/M |
3300013096|Ga0157307_1013236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1297 | Open in IMG/M |
3300014968|Ga0157379_10354654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1343 | Open in IMG/M |
3300015053|Ga0137405_1418683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1253 | Open in IMG/M |
3300015371|Ga0132258_10886072 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
3300015372|Ga0132256_100080742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3111 | Open in IMG/M |
3300015372|Ga0132256_100424357 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300015372|Ga0132256_100551414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1265 | Open in IMG/M |
3300015373|Ga0132257_102161556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300015374|Ga0132255_100467236 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
3300015374|Ga0132255_100534343 | All Organisms → cellular organisms → Bacteria → PVC group | 1726 | Open in IMG/M |
3300015374|Ga0132255_105631995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
3300016270|Ga0182036_10603040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 881 | Open in IMG/M |
3300016404|Ga0182037_11460375 | Not Available | 606 | Open in IMG/M |
3300017654|Ga0134069_1196847 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
3300018027|Ga0184605_10162750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1007 | Open in IMG/M |
3300018051|Ga0184620_10109023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 862 | Open in IMG/M |
3300018433|Ga0066667_10637312 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300019870|Ga0193746_1004047 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1350 | Open in IMG/M |
3300019870|Ga0193746_1013607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 831 | Open in IMG/M |
3300019877|Ga0193722_1082528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 787 | Open in IMG/M |
3300019879|Ga0193723_1024936 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300019879|Ga0193723_1088512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 883 | Open in IMG/M |
3300019881|Ga0193707_1105912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 834 | Open in IMG/M |
3300020001|Ga0193731_1089674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 798 | Open in IMG/M |
3300020015|Ga0193734_1032883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 972 | Open in IMG/M |
3300020022|Ga0193733_1000453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 13753 | Open in IMG/M |
3300020062|Ga0193724_1036065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1051 | Open in IMG/M |
3300020579|Ga0210407_10850183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 702 | Open in IMG/M |
3300021078|Ga0210381_10316347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
3300021344|Ga0193719_10177008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 915 | Open in IMG/M |
3300021344|Ga0193719_10476630 | Not Available | 504 | Open in IMG/M |
3300021418|Ga0193695_1015890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1548 | Open in IMG/M |
3300021432|Ga0210384_10586235 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300021432|Ga0210384_10810514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 834 | Open in IMG/M |
3300021510|Ga0222621_1059575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 803 | Open in IMG/M |
3300025290|Ga0207673_1008482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 1302 | Open in IMG/M |
3300025898|Ga0207692_11162760 | Not Available | 512 | Open in IMG/M |
3300025923|Ga0207681_10799428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 788 | Open in IMG/M |
3300025939|Ga0207665_11616692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
3300025941|Ga0207711_11971380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
3300025986|Ga0207658_11742898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 569 | Open in IMG/M |
3300026095|Ga0207676_11254343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 735 | Open in IMG/M |
3300026300|Ga0209027_1041318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1738 | Open in IMG/M |
3300026326|Ga0209801_1340253 | Not Available | 528 | Open in IMG/M |
3300026327|Ga0209266_1002702 | All Organisms → cellular organisms → Bacteria | 11049 | Open in IMG/M |
3300026329|Ga0209375_1016936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4279 | Open in IMG/M |
3300026334|Ga0209377_1091519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1277 | Open in IMG/M |
3300026334|Ga0209377_1347506 | Not Available | 500 | Open in IMG/M |
3300026523|Ga0209808_1104088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1193 | Open in IMG/M |
3300026523|Ga0209808_1285526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
3300026529|Ga0209806_1091501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1320 | Open in IMG/M |
3300026536|Ga0209058_1140724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1156 | Open in IMG/M |
3300026547|Ga0209156_10012036 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 5569 | Open in IMG/M |
3300026548|Ga0209161_10310584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 747 | Open in IMG/M |
3300026552|Ga0209577_10207885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1499 | Open in IMG/M |
3300026689|Ga0208579_103145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
3300026771|Ga0207552_100591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1090 | Open in IMG/M |
3300027512|Ga0209179_1076311 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300027727|Ga0209328_10207605 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300028047|Ga0209526_10090870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2150 | Open in IMG/M |
3300028379|Ga0268266_10372793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1345 | Open in IMG/M |
3300028791|Ga0307290_10385176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
3300028811|Ga0307292_10274686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
3300030945|Ga0075373_11507618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 816 | Open in IMG/M |
3300031720|Ga0307469_12538552 | Not Available | 501 | Open in IMG/M |
3300031740|Ga0307468_100999541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 736 | Open in IMG/M |
3300031740|Ga0307468_102035549 | Not Available | 551 | Open in IMG/M |
3300031754|Ga0307475_10435956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1053 | Open in IMG/M |
3300031754|Ga0307475_11397885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
3300031910|Ga0306923_11791201 | Not Available | 631 | Open in IMG/M |
3300031944|Ga0310884_10313032 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 879 | Open in IMG/M |
3300032205|Ga0307472_101427429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
3300033289|Ga0310914_11170125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 671 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.03% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.14% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.26% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.63% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.63% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.63% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.63% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026689 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN581 (SPAdes) | Environmental | Open in IMG/M |
3300026771 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4-12 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwBSRL2_0773.00007100 | 2162886013 | Switchgrass Rhizosphere | EMSALVEKKTGFDGSRTLIQGGLCAWCRAGSIFAHDIKQRLQR |
Ga0063356_1037470532 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ALVEKKTGLDGNRTLIQGGFCPWCNAGLIFAQDIEQNLQR* |
Ga0062595_1000682491 | 3300004479 | Soil | TVCNRRSEMSALVEKKTGLDGNRTLIQGGFCPWCNAGSIFTHDMSKEC* |
Ga0066675_100444733 | 3300005187 | Soil | LVEKKMGFDGSRTLIQGGFCAWCRAGSIFAQDIEQKLQR* |
Ga0070682_1005423943 | 3300005337 | Corn Rhizosphere | ALSQTVCNRKSEMSALVEKKTGFDGSRTFIQGGLCAWCRAGSIFAHDIEQKLQR* |
Ga0070714_1018905112 | 3300005435 | Agricultural Soil | MSALVEKKTGLDGKRTLIQDGLCAWCRAGSIFAQDMGQSYN |
Ga0070705_1013908591 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSQTVCKRKSEMRALVEKKTGFDGSRTLIQGGFRAWCRAGSIFAQDIVKSS* |
Ga0066681_109201482 | 3300005451 | Soil | KSEISALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAQDIE* |
Ga0070707_1000507204 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALVEKKMGFEGNRTLIHGGLFGWCNAGSIFAQDTLEQR* |
Ga0070698_1010137111 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SAFVEKKTGFEGSRTLIQGGFCAWWSAGSIFAQDIVPKLAHR* |
Ga0070697_1014651091 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EMSAFVEKKTGLDGSRTLIQGGLCGWCNAGSIFAQDMFALTLAQR* |
Ga0066697_107076492 | 3300005540 | Soil | SAFVEKKTGFDGSRTLIQAGFCAWCKAGSIFAHDIEQKLQR* |
Ga0070732_103321241 | 3300005542 | Surface Soil | ISALVEKKTGFDGKRTLIQGGLCAWCNAGSIFAHDILD* |
Ga0070695_1017114372 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LSQTVCKRKSEISALVEKKTGFDGSRTLIQGGFCAWCSAGSIFALGM* |
Ga0066701_102792552 | 3300005552 | Soil | EKKTGFDGSRTLIQGGFCAWCNAGSIFAQDIEQKLQR* |
Ga0066704_102316441 | 3300005557 | Soil | FVEKKTGFDGSRTFIQDGFCAWCNAGSIFAHDIFN* |
Ga0066698_101487811 | 3300005558 | Soil | EISALVEKKTGLDGSRTLIHGGFWTWCRAGSILARDMASQL* |
Ga0066699_109295762 | 3300005561 | Soil | VCNRKSEINAFVEKKTGFDGNRTLIQGGFWAWWSEGSIFAQDIE* |
Ga0066693_102411912 | 3300005566 | Soil | CALSQTVCNRKSEMSALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAHDIEPKLQR* |
Ga0066705_104463482 | 3300005569 | Soil | VEKKTGFEGNRTLIQGGFCAWWSVGSIFAQDIVRKLTHR* |
Ga0066694_103932711 | 3300005574 | Soil | EISALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAHDIEPKLQR* |
Ga0066903_1072291322 | 3300005764 | Tropical Forest Soil | ALVEKKTGFDGSRTLIQGGFCAWCRAESIFAHDIERKLQR* |
Ga0081455_106090751 | 3300005937 | Tabebuia Heterophylla Rhizosphere | FGHCALSQTVCKRRSEMSAFVEKKIGLDGKRTLIQLGLCGWCRAGSIFAHDME* |
Ga0066656_106861562 | 3300006034 | Soil | KRKSEMSAFVEKKTGFDGSRTLIQGGFCARCNAGSIFAQDMQES* |
Ga0070712_1005746553 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVEKKTGFDGSRTLIQGGFRAWCRTGSIFAQDIVKSSWL* |
Ga0070765_1015080991 | 3300006176 | Soil | LVEKKTGLDGSLTFIQLGFVAWCRAGSIFEQDIA* |
Ga0066658_104353352 | 3300006794 | Soil | SEISALVEKKTGFEGNRTLIQGGFCAWWSVGSIFAQDIVRKLTHR* |
Ga0066659_106927702 | 3300006797 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGSIFAQDIE* |
Ga0066660_116489672 | 3300006800 | Soil | SAFVEKKTGFDGSRTLIQGGFCAWCSAGSIFAQDIVPKLVYR* |
Ga0075434_1010827111 | 3300006871 | Populus Rhizosphere | ALVEKKTGFDGSRTLIQDGFCAWCNVGSILAHDIVQKLQR* |
Ga0075424_1011670682 | 3300006904 | Populus Rhizosphere | MSALVEKKIGLDGKRTLIQAGLCAWCKAGSIFAHDILDEC* |
Ga0099830_115231202 | 3300009088 | Vadose Zone Soil | LSQTVCKRKSEMSALVEKKTGFDGKRTLIQGGLCAWCNAGSIFAQDI* |
Ga0066709_1000488611 | 3300009137 | Grasslands Soil | KSEISALVEKKTGFDGNRTLIHGGFCAWCRAGSILAQDISKKSYNV* |
Ga0105242_124156461 | 3300009176 | Miscanthus Rhizosphere | KTGCDGNRTLIQGGFCAWWSAGSIFAQDIAPKLAHR* |
Ga0126305_111824631 | 3300010036 | Serpentine Soil | MSALVEKKTGLDGNLTLIQGGFCPWCNAGSIFAHDMSKEC* |
Ga0126373_104688421 | 3300010048 | Tropical Forest Soil | HCALSQTVCNRKSEMSALVEKKTGFDGNRTLIQAGLCGWCKAGSIFAHDMTKCFKC* |
Ga0134088_104205851 | 3300010304 | Grasslands Soil | SEMSAFVEKKTGFDGSRTFIQDGFCAWCNAGSIFAHDIFN* |
Ga0134109_100217331 | 3300010320 | Grasslands Soil | QTVCNRKSEISALVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIK* |
Ga0134067_103642431 | 3300010321 | Grasslands Soil | SEMSALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAQDIEQKLQR* |
Ga0134086_103047492 | 3300010323 | Grasslands Soil | GLDGNRTLIQDGFCPWCNAGSIFAHDMEQNLQRKKSYKS* |
Ga0134065_100818761 | 3300010326 | Grasslands Soil | SEISALVEKKTGLDGNLTLIHGGFFSWCNAGSIFAQDIE* |
Ga0134111_104617062 | 3300010329 | Grasslands Soil | LSQTVCKRKSEMSAFVEKKTGFDGSRTLIQGGFCARCNAGSIFAQDMQES* |
Ga0134071_104197002 | 3300010336 | Grasslands Soil | MRAFVEKKTGFDGSLTLIQGGFCAWCSAGSIFAQDM* |
Ga0134062_107168211 | 3300010337 | Grasslands Soil | LSQTVCNRKSEISALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAHDIEPKLQR* |
Ga0126381_1002023611 | 3300010376 | Tropical Forest Soil | ALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAQDMEEKLQR* |
Ga0126381_1050813241 | 3300010376 | Tropical Forest Soil | KKTGFDGSRTLIQGGFCGWCRAGSIFAQDIEQKLQR* |
Ga0134126_128485221 | 3300010396 | Terrestrial Soil | LSQTVCNRKSEMSALVEKKTGFDGNRTLIQGGLCAWCRAGSIFAHDIEQKLQR* |
Ga0126383_101072214 | 3300010398 | Tropical Forest Soil | MSAFVEKKTGFDGSRTLIQGGFWAWCNAGSIFAHDIEQKLQR* |
Ga0126383_102572731 | 3300010398 | Tropical Forest Soil | KTEFDGSLTLIQGGLCAWCRAGSIFGHDIKQKLQR* |
Ga0134121_130588821 | 3300010401 | Terrestrial Soil | MSALVEKKTGFDGSRTFIQGGLCAWCRAGSIFAHDIKQKLQR* |
Ga0153933_10009862 | 3300011411 | Attine Ant Fungus Gardens | VEKKTGLDGNLTFIQLGFLAWCRAGSIFEQDIAYF* |
Ga0136623_102749052 | 3300012045 | Polar Desert Sand | MSALVEKNLGFDGNRTLIQGGFCAWCNAGSIFAQDMSLKV* |
Ga0137364_100944763 | 3300012198 | Vadose Zone Soil | MRAFVEKKTGFDGSRTLIQGGFRAWCSAGSIFAQDM* |
Ga0137364_108358661 | 3300012198 | Vadose Zone Soil | LVEKKIGFDGSRTLIQGGFWSWWSEGSIFAQDIE* |
Ga0137383_100495741 | 3300012199 | Vadose Zone Soil | HCALSQTVCRRKSEMSALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAHDIE* |
Ga0137383_110130052 | 3300012199 | Vadose Zone Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAHDIE* |
Ga0137365_100115201 | 3300012201 | Vadose Zone Soil | MSAFVEKKTGFDGSRTFIQGGFCAWCSAGSIFAHDMINE |
Ga0137365_100554921 | 3300012201 | Vadose Zone Soil | TVCNRKSEISALVEKKTGLDGSRTLIHGGFWTWCRAGSILARDMASQL* |
Ga0137365_109153311 | 3300012201 | Vadose Zone Soil | LSQTVCNRKSEISALVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIEQKLQL* |
Ga0137365_111732102 | 3300012201 | Vadose Zone Soil | MSALVEKKTGLDGNRTLIQDGFCPWCNAGSIFAHDMEQNLQRKKSYKS* |
Ga0137363_104152832 | 3300012202 | Vadose Zone Soil | SALVEKKTGLDGNRTLIQGGLCAWCRAGLIFAQDIEQNLQR* |
Ga0137363_105144023 | 3300012202 | Vadose Zone Soil | LVEKKTGFDGSRTLIQGGFCVWCRAGSIFAQDISRKVTTLKKLQK* |
Ga0137363_118217771 | 3300012202 | Vadose Zone Soil | EKKTGFDGNRTLIQGGFCAWCNAGSIFAQDIEQKLQR* |
Ga0137362_103446873 | 3300012205 | Vadose Zone Soil | KSEISALVEKKTGFDGSRTLIQGGFRAWCRVGSIFAQDIEEKLQR* |
Ga0137362_108122201 | 3300012205 | Vadose Zone Soil | KKTGFDGNRTLIQGGFCARCRAGSIFAHDIEQKLQR* |
Ga0137381_106466281 | 3300012207 | Vadose Zone Soil | TGFEGNRTLIQGGFCAWWSVGSIFAQDIVRKLTHR* |
Ga0137381_108057942 | 3300012207 | Vadose Zone Soil | QTVCSRKSEMSAFVEKKTGFDGSRTLIQGGFCAWCSAGSILAQDI* |
Ga0137376_101111481 | 3300012208 | Vadose Zone Soil | MSAFVEKKTGFDGSRTFIQGGFCAWWSAGSIFAHDMINKS* |
Ga0137376_103418931 | 3300012208 | Vadose Zone Soil | KKTGFDGNRTLIQGGFCAWCSVGSIFAQDISKKSYNV* |
Ga0137376_106406031 | 3300012208 | Vadose Zone Soil | TVCNRKSEISALVEKKTGFDGNRTLIQGGLLGWCNAGSIFAQDIASES* |
Ga0137376_110170602 | 3300012208 | Vadose Zone Soil | TVCNRKSEISALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAHDIEPKLQR* |
Ga0137379_113612932 | 3300012209 | Vadose Zone Soil | MSALVEKKTGLDGNRTLIQGGFCPWCNAGSIFAHDM |
Ga0137378_110053412 | 3300012210 | Vadose Zone Soil | MSAFVEKKTGFDGRRTFIQGGFCAWWSAGSIFAHDMINES* |
Ga0137370_109908332 | 3300012285 | Vadose Zone Soil | VEKKIGFDGSRTLIQGGFCAWCNAGSIFAQDIQQSYNR* |
Ga0137371_102732933 | 3300012356 | Vadose Zone Soil | LVEKKTGFDGSRTLIQGGFWAWWSEGSIFVQGIG* |
Ga0137371_113861661 | 3300012356 | Vadose Zone Soil | TVCNRKSEISALVEKKTGFDGSRTLIQGGFCTWCKAGSIFAQDMFALTLAQR* |
Ga0137361_107634191 | 3300012362 | Vadose Zone Soil | ALSQTVCRRKSEMSALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAQDMEQKLQR* |
Ga0137358_100371614 | 3300012582 | Vadose Zone Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAHDMLVLR* |
Ga0157304_11020182 | 3300012882 | Soil | CALSQTVCNRKSEINAFVEKNTGFDGSRTLIQGGFWAWWSEGSIFAQDIE* |
Ga0137359_109421782 | 3300012923 | Vadose Zone Soil | VCNRKSEMSALVEKKTGFEGNRTLIQGGLFGWCNAGSIFAQDM* |
Ga0137416_118967391 | 3300012927 | Vadose Zone Soil | RSEMSALVEKKTGFDGNRTLIQGGFCAWCNAGSIFAQDM* |
Ga0137410_111283882 | 3300012944 | Vadose Zone Soil | MSALVEKKTGLDGNRTLIQGGFCPWCNAGLIFAQDIEQNLQR* |
Ga0164303_115024801 | 3300012957 | Soil | MSALVEKKIGFDGSRTLIQGGFWAWWSEGSIFAQDI |
Ga0164299_100646903 | 3300012958 | Soil | MSAFVEKKTGLEGSLTLIHGGFCGWCNAGSIFAQDISMKLQPLKKLQK* |
Ga0164299_108418043 | 3300012958 | Soil | SQTVCNRKSEINALVEKKTGFDGNRTLIQGGFCAWCNVGSMFAQDIEQKLQR* |
Ga0164304_100317181 | 3300012986 | Soil | RKSEINAFGEKKTGLEGSRTLIHSGFCRWCNAGAIFAQDMAKSFKC* |
Ga0157307_10132363 | 3300013096 | Soil | ALVEKKTGLDGNRTLIQGGFCPWCNAGSIFTHDMSKEC* |
Ga0157379_103546543 | 3300014968 | Switchgrass Rhizosphere | RKSEISAFVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE* |
Ga0137405_14186831 | 3300015053 | Vadose Zone Soil | TVCNRRSEISALVEKKTGLDGNRTLIQGGFCPWCNAGLIFAQDIEQNLQR* |
Ga0132258_108860723 | 3300015371 | Arabidopsis Rhizosphere | EISALVEKKTGFDGNRTLIQGGLCAWCKAGSIFAHDIKQKLQRYKRYKS* |
Ga0132256_1000807421 | 3300015372 | Arabidopsis Rhizosphere | HCALSQTVCNRRSEMSALVEKKTGLDGNRTLIQGGFCPWCNAGSIFAHDMSQEC* |
Ga0132256_1004243574 | 3300015372 | Arabidopsis Rhizosphere | CNRKSEMRALVEKKTGFDGSRTLIQGGFCARCRAGSIFAQDIKQKLQR* |
Ga0132256_1005514143 | 3300015372 | Arabidopsis Rhizosphere | EMSALVEKKTGFDGSRTLIQGGLCAWCRAGSIFAHDIKQRLQR* |
Ga0132257_1021615561 | 3300015373 | Arabidopsis Rhizosphere | KKTGFDGSRTLIHGGFCAWCNVGSIFAQDIKQKLQC* |
Ga0132255_1004672361 | 3300015374 | Arabidopsis Rhizosphere | SQTVCNRKSEMRALVEKKTGFDGSRTLIQGGFCAWCRAASIFAHDIKQKLQR* |
Ga0132255_1005343431 | 3300015374 | Arabidopsis Rhizosphere | KKTGFDGNRTLIQGGLCAWCKAGSIFAHDIKQKLQRYKRYKS* |
Ga0132255_1056319952 | 3300015374 | Arabidopsis Rhizosphere | SQTVCNRKSEISALVEKKTGFDGSRTLIQGGFWARWSEGSIFAQDIE* |
Ga0182036_106030401 | 3300016270 | Soil | RKSEISAFVEKNTGFDGRRTLIQGGFCVWWSAGSIFAQDIKKSLTQR |
Ga0182037_114603752 | 3300016404 | Soil | LVEKKTGLDGNLTFIQLGFFAWCRAGSIFEQDIPYF |
Ga0134069_11968472 | 3300017654 | Grasslands Soil | VCSRKSEMRAFVEKKTGFDGSLTLIQGGFCAWCSAGSIFAQDM |
Ga0184605_101627502 | 3300018027 | Groundwater Sediment | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAQDMLVLR |
Ga0184620_101090231 | 3300018051 | Groundwater Sediment | NRKSEISAFVEKKTGFDGSRTLIQGGFWAWCRAGSILFAHDMASQL |
Ga0066667_106373122 | 3300018433 | Grasslands Soil | VEKKTGFDGSRTLIQDGFCVWCNAGSIFAHDIAQKLQR |
Ga0193746_10040471 | 3300019870 | Soil | MSALVEKKTGFDGNRTLIQAGFCAWCRAGSIFAQDIEQKLQR |
Ga0193746_10136071 | 3300019870 | Soil | FVEKKTGFDGNRTLIQGGFCAWCNAGSIFAEDTREA |
Ga0193722_10825282 | 3300019877 | Soil | ALVEKKTGLDGNRTLIQGGFCPWCNAGSIFAHDMLPEC |
Ga0193723_10249364 | 3300019879 | Soil | MSALVEKKTGLDGNRTLIQGGFCPWCNAGLIFAQDIEQNLQR |
Ga0193723_10885121 | 3300019879 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCKAGSIFAQDIEQRYKVKK |
Ga0193707_11059121 | 3300019881 | Soil | VCNRKSEISAFVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0193731_10896742 | 3300020001 | Soil | CKRKSEMSALVEKKTGFDGSRTLIQGGLFGWCNEGSIFAQDIANED |
Ga0193734_10328833 | 3300020015 | Soil | TVCNRRSEMSALVEKKTGLDGKRTLIQGGFCPWCNAGSIFAHDMSKEC |
Ga0193733_10004531 | 3300020022 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAQNMLVLR |
Ga0193724_10360653 | 3300020062 | Soil | AFVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0210407_108501832 | 3300020579 | Soil | EISALVEKKTGFDGRRTLIHGGLCAWCNTGSIFAQDMRAKVLITTY |
Ga0210381_103163472 | 3300021078 | Groundwater Sediment | SRKSEMSAFVEKKTGFDGSRTFIQGGFCAWWSAGSIFAHDMINKS |
Ga0193719_101770082 | 3300021344 | Soil | SQTVCNRKSEISAFVEKKMGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0193719_104766302 | 3300021344 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAQDMFALTLAQR |
Ga0193695_10158903 | 3300021418 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAHDMLVLR |
Ga0210384_105862351 | 3300021432 | Soil | SEMSALVEKKTGFDGSRTLIHDGLCGWCSAGSIFAQDMVGQN |
Ga0210384_108105141 | 3300021432 | Soil | MSALVEKKTGLDGKRTLIQGGFCPWWKAGSIFAHDMEQSYNV |
Ga0222621_10595751 | 3300021510 | Groundwater Sediment | SAFVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0207673_10084823 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | TGCSRKSEMSALVEKKTGFDGSRTLIQGGFCAWCRAGSIFAHDIDQKLQR |
Ga0207692_111627601 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAFVEKKTGLEGNRTLIQSGFLAWCNVGSIFEQDINEAKLPFERGKAT |
Ga0207681_107994282 | 3300025923 | Switchgrass Rhizosphere | SEMRALVEKKTGFDGSRTLIQGGFCAWCNAGSILAQDIFRTVET |
Ga0207665_116166922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | HCALSQTVCNRKSEINAFVEKKTGFDGNRTLIQGGFCAWWSEGSIFARDIE |
Ga0207711_119713802 | 3300025941 | Switchgrass Rhizosphere | ISALVEKKTGFDGSRTLIQGGLCAWCSAGSIFALGM |
Ga0207658_117428981 | 3300025986 | Switchgrass Rhizosphere | HWALSQTVCSRKSEINALVEKKTGLDGNRTLIQEGFCARCSAGSIFEQDMMKL |
Ga0207676_112543432 | 3300026095 | Switchgrass Rhizosphere | KTGFDGSRTLIQGGFCAWCSAGSIFAHDIDQKLQR |
Ga0209027_10413181 | 3300026300 | Grasslands Soil | MSAFVEKKTGFDGSRTLIHGGFCAWCNAGSIFAQDVDKSFKG |
Ga0209801_13402532 | 3300026326 | Soil | MSALVEKKIGFDGSRTLIQGGFRAWCNAGSIFAQGIEQNYK |
Ga0209266_10027021 | 3300026327 | Soil | QTVCKRKSEMSALVEKKTGFDGSRTLIQGGFCAWCNAGSIFAQDIE |
Ga0209375_10169365 | 3300026329 | Soil | SEMSAFVEKKTGFDGSRTLIQGGFCARCNAGSIFAQDMQES |
Ga0209377_10915193 | 3300026334 | Soil | SEINAFVEKKTGFDGNRTLIQGGFWAWWSEGSIFAQDIE |
Ga0209377_13475061 | 3300026334 | Soil | FGHWALSQTVCKCKSEMSALVEKKTGFDGSRTLIHGGLCAWCNAGSIFAQDIQ |
Ga0209808_11040883 | 3300026523 | Soil | ALVEKKTGFEGNRTLIQGGFCAWWSVGSIFAQDIVRKLTHR |
Ga0209808_12855262 | 3300026523 | Soil | VEKKTGFDGNRTLIQGGFCAWCSVGSILAHGIAQR |
Ga0209806_10915011 | 3300026529 | Soil | KSEISALVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0209058_11407243 | 3300026536 | Soil | MRAFVEKKTGFDGSLTLIQGGFCAWCSAGSIFAQDM |
Ga0209156_100120363 | 3300026547 | Soil | VCNRKSEISALVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIK |
Ga0209161_103105841 | 3300026548 | Soil | HCALSQTVCNRKSEISALVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0209577_102078851 | 3300026552 | Soil | RKSEISAFVEKKTGFDGSRTLIQGGFCAWWSAGSIFAQDIVPKLAHR |
Ga0208579_1031452 | 3300026689 | Soil | NRKSEISAFVEKKTGLDGSRTLIQGGFCAWCNAGSIFAQDIEQSYNR |
Ga0207552_1005913 | 3300026771 | Soil | MSALVEKKTGFDGNRTLIQGGFCAWCRVGSIFAQDISKKSYNVK |
Ga0209179_10763112 | 3300027512 | Vadose Zone Soil | ISAFVEKKMGFDGSRTLIQGGFWAWWSEGSIFAQDIE |
Ga0209328_102076052 | 3300027727 | Forest Soil | SQTVCNRRSEMSALVEKKTGFDGKRTLIHDGLCGWCSAGSIFAQDMVGQN |
Ga0209526_100908705 | 3300028047 | Forest Soil | EISALVEKKTGFDGSRTLIHDGLCGWWSAGSIFAHDIV |
Ga0268266_103727933 | 3300028379 | Switchgrass Rhizosphere | NRKSEISALVEKKTGFDGNRTLIQGGFCAWCKAGSIFAHDISTKSYNV |
Ga0307290_103851761 | 3300028791 | Soil | ALVEKKIGFDGSRTLIQGGFRAWCNAGLIFAQDMFALTLAQR |
Ga0307292_102746861 | 3300028811 | Soil | EMSANQEKKTGLDGSRTLIQGGFCAWCNAGSIFAQDIEQSYNR |
Ga0075373_115076181 | 3300030945 | Soil | ALSQTVCNRRSEMSALVEKKTGLDGKRTLIQGGFCPWWRAGSIFVQDITAKLQL |
Ga0307469_125385522 | 3300031720 | Hardwood Forest Soil | MSALVEKKIGFDGSRTLIQGGFRGWCNAGSIFAHDMFALMLAQR |
Ga0307468_1009995412 | 3300031740 | Hardwood Forest Soil | FVEKKTGLEGNRTLIQGGFCPWCNAGSIFAHDMVDQC |
Ga0307468_1020355492 | 3300031740 | Hardwood Forest Soil | MSALVEKKTGLDGNRTLIQGGFCPWCSCGSIFAHDMEQSYNVK |
Ga0307475_104359563 | 3300031754 | Hardwood Forest Soil | SEIRAFVEKKTGFDGSLTFIQLGFFAWCRAGSIFEQDIA |
Ga0307475_113978851 | 3300031754 | Hardwood Forest Soil | KSEISAFVEKKTGFDGSRTLIQGGFCAWWSAGSIIVQDIVPKLAHR |
Ga0306923_117912011 | 3300031910 | Soil | NRKSEISALVEKKTGFDGSRTLIQGGFCAWCRAGSIFAHDIKQKLQR |
Ga0310884_103130321 | 3300031944 | Soil | ALSQTVCNRKSEISALVEKKTGFDGSRTFIQGGLCAWCRAGSIFAHDIEQKLQR |
Ga0307472_1014274291 | 3300032205 | Hardwood Forest Soil | SAFVEKKTGFDGSRTLIQGGFWAWWSEGSIFAQDIEQKLQR |
Ga0310914_111701252 | 3300033289 | Soil | TVCNRKSEISALVEKKTGFDGSRTLIHGGFCAWCNVGSIFAQDIKQKLQC |
⦗Top⦘ |