NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041951

Metagenome / Metatranscriptome Family F041951

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041951
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 40 residues
Representative Sequence LKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGAAASAAKA
Number of Associated Samples 125
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.37 %
% of genes from short scaffolds (< 2000 bps) 91.19 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(36.478 % of family members)
Environment Ontology (ENVO) Unclassified
(39.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.541 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.13%    β-sheet: 0.00%    Coil/Unstructured: 60.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF02597ThiS 74.21
PF03795YCII 4.40
PF01327Pep_deformylase 2.52
PF02870Methyltransf_1N 1.89
PF01035DNA_binding_1 1.89
PF02894GFO_IDH_MocA_C 1.26
PF03992ABM 1.26
PF13520AA_permease_2 1.26
PF00069Pkinase 1.26
PF01243Putative_PNPOx 1.26
PF08241Methyltransf_11 0.63
PF07690MFS_1 0.63
PF02566OsmC 0.63
PF07593UnbV_ASPIC 0.63
PF00759Glyco_hydro_9 0.63
PF01740STAS 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 74.21
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 74.21
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 5.03
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 4.40
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 3.77
COG0242Peptide deformylaseTranslation, ribosomal structure and biogenesis [J] 2.52
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 1.89
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.26
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.63
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.04 %
UnclassifiedrootN/A33.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001431|F14TB_102739648All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300002562|JGI25382J37095_10124510Not Available875Open in IMG/M
3300002914|JGI25617J43924_10308473All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300002916|JGI25389J43894_1061141Not Available639Open in IMG/M
3300005171|Ga0066677_10248595All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300005332|Ga0066388_100591962All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300005434|Ga0070709_10998214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae666Open in IMG/M
3300005440|Ga0070705_100508939All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005468|Ga0070707_100928347All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005532|Ga0070739_10294691All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005534|Ga0070735_10437267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus781Open in IMG/M
3300005559|Ga0066700_11064572All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300005568|Ga0066703_10821504All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005610|Ga0070763_10516938All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005764|Ga0066903_101852519All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300006173|Ga0070716_101230032Not Available603Open in IMG/M
3300006175|Ga0070712_100768721All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300006175|Ga0070712_101502126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae589Open in IMG/M
3300006176|Ga0070765_101051282Not Available770Open in IMG/M
3300006796|Ga0066665_10922990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300006800|Ga0066660_10971629Not Available685Open in IMG/M
3300006852|Ga0075433_11487424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae585Open in IMG/M
3300006871|Ga0075434_100012463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8063Open in IMG/M
3300006903|Ga0075426_10938803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae653Open in IMG/M
3300006904|Ga0075424_100106682All Organisms → cellular organisms → Bacteria2956Open in IMG/M
3300009012|Ga0066710_104012073Not Available551Open in IMG/M
3300009088|Ga0099830_10207254Not Available1537Open in IMG/M
3300009088|Ga0099830_10391581All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300009088|Ga0099830_10485816All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300009088|Ga0099830_11641919Not Available536Open in IMG/M
3300009089|Ga0099828_10992916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300009098|Ga0105245_10859274Not Available948Open in IMG/M
3300009162|Ga0075423_11136615All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300009177|Ga0105248_13207251All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300010321|Ga0134067_10403311Not Available549Open in IMG/M
3300010341|Ga0074045_10868663Not Available569Open in IMG/M
3300010343|Ga0074044_10909573Not Available575Open in IMG/M
3300010343|Ga0074044_11134195Not Available511Open in IMG/M
3300010358|Ga0126370_10748849All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300010360|Ga0126372_10302341All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300010360|Ga0126372_12437201Not Available574Open in IMG/M
3300010361|Ga0126378_12236812Not Available624Open in IMG/M
3300010366|Ga0126379_13014147Not Available564Open in IMG/M
3300010376|Ga0126381_103539363All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010396|Ga0134126_12488216Not Available563Open in IMG/M
3300010398|Ga0126383_11233555All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300011120|Ga0150983_14640366Not Available538Open in IMG/M
3300011269|Ga0137392_10831066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium762Open in IMG/M
3300011269|Ga0137392_11566845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300011270|Ga0137391_10264137All Organisms → cellular organisms → Bacteria → Acidobacteria1490Open in IMG/M
3300011270|Ga0137391_10485280All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1048Open in IMG/M
3300011271|Ga0137393_10183636All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300012096|Ga0137389_10752389All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300012189|Ga0137388_10047801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3451Open in IMG/M
3300012189|Ga0137388_10409842All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300012189|Ga0137388_10525346All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300012189|Ga0137388_10660273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300012189|Ga0137388_11281255All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae671Open in IMG/M
3300012189|Ga0137388_11802127Not Available544Open in IMG/M
3300012199|Ga0137383_11199421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300012202|Ga0137363_10839744Not Available779Open in IMG/M
3300012202|Ga0137363_11106694All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300012203|Ga0137399_11273395Not Available619Open in IMG/M
3300012203|Ga0137399_11474712Not Available567Open in IMG/M
3300012206|Ga0137380_10286012All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300012206|Ga0137380_10438513All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300012206|Ga0137380_10798432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300012208|Ga0137376_11473503Not Available572Open in IMG/M
3300012211|Ga0137377_10123796All Organisms → cellular organisms → Bacteria2466Open in IMG/M
3300012211|Ga0137377_11896775All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300012349|Ga0137387_10462220All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300012349|Ga0137387_10500167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium882Open in IMG/M
3300012351|Ga0137386_11069904Not Available571Open in IMG/M
3300012357|Ga0137384_10375961All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300012357|Ga0137384_10679690All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300012361|Ga0137360_10787990Not Available818Open in IMG/M
3300012362|Ga0137361_10106662All Organisms → cellular organisms → Bacteria2446Open in IMG/M
3300012363|Ga0137390_11480781Not Available620Open in IMG/M
3300012363|Ga0137390_11947235Not Available515Open in IMG/M
3300012683|Ga0137398_10701433Not Available703Open in IMG/M
3300012918|Ga0137396_10563683All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012923|Ga0137359_10405512All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300012923|Ga0137359_11001641Not Available717Open in IMG/M
3300012924|Ga0137413_10166633All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300012925|Ga0137419_10224362All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300012925|Ga0137419_11172679Not Available642Open in IMG/M
3300012925|Ga0137419_11831643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300012927|Ga0137416_10059556All Organisms → cellular organisms → Bacteria2720Open in IMG/M
3300012927|Ga0137416_10103636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2144Open in IMG/M
3300012927|Ga0137416_10297659All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300012930|Ga0137407_10827797All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300012931|Ga0153915_12698634All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300012971|Ga0126369_11469261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium771Open in IMG/M
3300012972|Ga0134077_10423292All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300012975|Ga0134110_10007816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4010Open in IMG/M
3300012988|Ga0164306_11933802Not Available513Open in IMG/M
3300013307|Ga0157372_13190701Not Available523Open in IMG/M
3300014154|Ga0134075_10041765All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300014166|Ga0134079_10060488All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300015052|Ga0137411_1154595All Organisms → cellular organisms → Bacteria4083Open in IMG/M
3300015052|Ga0137411_1360000All Organisms → cellular organisms → Bacteria → Acidobacteria1182Open in IMG/M
3300015054|Ga0137420_1111018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300015054|Ga0137420_1214240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300015054|Ga0137420_1307857All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300015245|Ga0137409_11279979Not Available575Open in IMG/M
3300016341|Ga0182035_11137859All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300017947|Ga0187785_10166686All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300017959|Ga0187779_10472816All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300017994|Ga0187822_10364888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300018431|Ga0066655_10840042Not Available625Open in IMG/M
3300018482|Ga0066669_12299303Not Available514Open in IMG/M
3300020579|Ga0210407_10863233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300020580|Ga0210403_10437306All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300020580|Ga0210403_11344434Not Available544Open in IMG/M
3300020581|Ga0210399_10593381All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300020582|Ga0210395_10172401All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300020583|Ga0210401_10066867All Organisms → cellular organisms → Bacteria → Acidobacteria3386Open in IMG/M
3300021170|Ga0210400_11555444Not Available523Open in IMG/M
3300021178|Ga0210408_10914163Not Available682Open in IMG/M
3300021180|Ga0210396_11745609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300021432|Ga0210384_10096568All Organisms → cellular organisms → Bacteria2652Open in IMG/M
3300021477|Ga0210398_10998546Not Available668Open in IMG/M
3300021479|Ga0210410_10647429All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300021559|Ga0210409_10568768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1000Open in IMG/M
3300022726|Ga0242654_10345865All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300022726|Ga0242654_10386647Not Available534Open in IMG/M
3300024245|Ga0247677_1044530Not Available645Open in IMG/M
3300024284|Ga0247671_1016629All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300024288|Ga0179589_10512412Not Available557Open in IMG/M
3300025916|Ga0207663_10680531All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026089|Ga0207648_10297815All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300026342|Ga0209057_1246811Not Available508Open in IMG/M
3300026482|Ga0257172_1105140Not Available519Open in IMG/M
3300026514|Ga0257168_1123039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300026528|Ga0209378_1292308Not Available520Open in IMG/M
3300026552|Ga0209577_10120459All Organisms → cellular organisms → Bacteria → Acidobacteria2101Open in IMG/M
3300027326|Ga0209731_1052796Not Available617Open in IMG/M
3300027655|Ga0209388_1071945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium996Open in IMG/M
3300027795|Ga0209139_10183257Not Available741Open in IMG/M
3300027867|Ga0209167_10730751Not Available540Open in IMG/M
3300027875|Ga0209283_10917657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300027911|Ga0209698_10113210All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300027986|Ga0209168_10315987Not Available766Open in IMG/M
3300029636|Ga0222749_10168149All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300030058|Ga0302179_10557198All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300030906|Ga0302314_10783350All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300031057|Ga0170834_100647332Not Available561Open in IMG/M
3300031057|Ga0170834_113527727All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300031679|Ga0318561_10448330Not Available710Open in IMG/M
3300031715|Ga0307476_11315503Not Available527Open in IMG/M
3300031718|Ga0307474_11619987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300031720|Ga0307469_10644717Not Available953Open in IMG/M
3300031720|Ga0307469_11672425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300031720|Ga0307469_12424856Not Available512Open in IMG/M
3300031753|Ga0307477_10068514All Organisms → cellular organisms → Bacteria2450Open in IMG/M
3300031823|Ga0307478_10671818All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300032174|Ga0307470_11958078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300032180|Ga0307471_102467673All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300033158|Ga0335077_11716583All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil36.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.14%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.14%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.52%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.26%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.63%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TB_10273964813300001431SoilGLKTTDALVAEFPATEAIAPKLEAFEAYLDAQLAAPAAGKA*
JGI25382J37095_1012451013300002562Grasslands SoilTTDAIAAEFPAAEAIAPRLEAFEAYIDAQLGVTASRAKA*
JGI25617J43924_1030847323300002914Grasslands SoilTGNGLKTTDAIAAEFPAXEAIAPRLDAFEAYLDAQLGATAASAKA*
JGI25389J43894_106114113300002916Grasslands SoilTGNGLKTTDAIVSEFPATEAIAPRLEAFEAYLDARLGTAAASAKA*
Ga0066677_1024859533300005171SoilKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGVTVAGAKA*
Ga0066388_10059196253300005332Tropical Forest SoilGNGLKTTDAIAAEFPLTEAIAPRLDAFEAYLESAVPAAATANV*
Ga0070709_1099821433300005434Corn, Switchgrass And Miscanthus RhizosphereNGLKTTDAIAADFPLTEAIAPRLEAFEAYLDAQLGTHAAAAAK*
Ga0070705_10050893933300005440Corn, Switchgrass And Miscanthus RhizosphereLKTTDAIAAEFPVTEAIEPRIDAFEAYLENQFTLAAATAGAK*
Ga0070707_10092834733300005468Corn, Switchgrass And Miscanthus RhizosphereGLKTTDAIAAEFPVTEAIAPRLEAFEAYLDAQLGATAAGAKA*
Ga0070739_1029469133300005532Surface SoilLKTTDAIAAEFPATEAIAPRLDAFEAYLDSQLSTAATA*
Ga0070735_1043726733300005534Surface SoilLSITGNGLKTTDAIANEFPLTEAIAPKLEAFEALLDSQLTAAGAAAGAK*
Ga0066700_1106457213300005559SoilTTDAIVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV*
Ga0066703_1082150433300005568SoilIVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV*
Ga0070763_1051693813300005610SoilKTTDAVTAEFPLAEAIAPRLDAFEAYLDNQFTAAAAAR*
Ga0066903_10185251953300005764Tropical Forest SoilAIAAEFPAAEAIPPRLDAFEAYLDNQLRTAAAAAR*
Ga0070716_10123003223300006173Corn, Switchgrass And Miscanthus RhizosphereDAIAADFPLTEAIAPRLEAFEAYLDAQMGTHATAAAK*
Ga0070712_10076872133300006175Corn, Switchgrass And Miscanthus RhizosphereGNGLKTTDAIVAEYPSSEAIEPKLAAFEAYLDTQMATSAAAKA*
Ga0070712_10150212613300006175Corn, Switchgrass And Miscanthus RhizosphereGLKTTDAIASEFPLTEAIAPKLEAFEAYLDGQLTAASAIAGAK*
Ga0070765_10105128233300006176SoilDAIAAEFPAIEAIAPRLEAFEAYLDNQLATTASTQA*
Ga0066665_1092299013300006796SoilDAIAAEFPATEAIAPRLDAFEAYLDAQLGATVAGAKA*
Ga0066660_1097162913300006800SoilTDAIADEFRATEAIAPRLEAFEAYLDAQIGATTRAARA*
Ga0075433_1148742423300006852Populus RhizosphereITGNGLKTTDAISAEYPATQAIAPKLEAFEAYLDSQMAAGATAGKA*
Ga0075434_100012463103300006871Populus RhizosphereAAEYPASEAIAPKLEAFEAYLDSQLAASAAVGKA*
Ga0075426_1093880313300006903Populus RhizosphereGLKTTDAIAAEFPAAEAIAPRLEAFEAYLDAQLGAATASAKA*
Ga0075424_10010668243300006904Populus RhizosphereLKTTDAIAAEYPPTEAIAPKLEAFEAYLDSQLAASTAVAGKA*
Ga0066710_10401207313300009012Grasslands SoilGNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR
Ga0099830_1020725413300009088Vadose Zone SoilTTDAIAAEFPATEAIAPRLEAFEAYLESQLPATAAARA*
Ga0099830_1039158113300009088Vadose Zone SoilAIAAEFPATEATAPRLDAFEAYLDAQLGTTAGSAKA*
Ga0099830_1048581633300009088Vadose Zone SoilLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGAAASAAKA*
Ga0099830_1164191913300009088Vadose Zone SoilEFPATEAIAPRLDAFEAYLDAQLGATAACNAVAKV*
Ga0099828_1099291613300009089Vadose Zone SoilAIVAEFPATEAIAPRLEAFEAYLDARLGTATANANA*
Ga0105245_1085927413300009098Miscanthus RhizosphereTDAIAADFPLTEAIAPRLEAFEAYLDAQLGTHAAAAAK*
Ga0075423_1113661533300009162Populus RhizosphereVKTTDAIAAEYPATEAIAPKLEAFEAYLDSQLAANAAVAGKT*
Ga0105248_1320725113300009177Switchgrass RhizosphereNGLKTTDAIAAEYPAAEAIAPKLEAFEAYLDSQLAAGAAAGRA*
Ga0134067_1040331123300010321Grasslands SoilTDAIVSEFPATEAIAPRLEAFEAYLDARLGTTAASAKA*
Ga0074045_1086866313300010341Bog Forest SoilTTDAIASEYPLTEAIAPRLDAFEAYLESQFAVAAAAK*
Ga0074044_1090957323300010343Bog Forest SoilKTTDAIAAEFPATEAIAPRLDAFEAYLDNQFTVAAIAAK*
Ga0074044_1113419513300010343Bog Forest SoilNGLKTTDAIASEFPVTEAIAPTLDAFEAYLDNQFSAPATAGAK*
Ga0126370_1074884913300010358Tropical Forest SoilGNGLKTTDAIAAEYPLTEAIAPKLEAFEAYVETQFAAAAAALVAGTRK*
Ga0126372_1030234133300010360Tropical Forest SoilKTTDAIAAEFPAAEAIAPKLEAFEAYLDSQLATGAAAGKA*
Ga0126372_1243720123300010360Tropical Forest SoilLKTTDAIAAEFPLTEAIPPRLDAFEAYLEAQLPAAAAAEA*
Ga0126378_1223681223300010361Tropical Forest SoilGNGLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAAKA*
Ga0126379_1301414723300010366Tropical Forest SoilLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQIGATAVAKA*
Ga0126381_10353936333300010376Tropical Forest SoilKTTDAIAAEYPAAEAIAPKLEAFEAYLDSQLATGAAAGKA*
Ga0134126_1248821623300010396Terrestrial SoilNEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK*
Ga0126383_1123355513300010398Tropical Forest SoilKTTDAIAAEFPATEAIAPRLEAFEAYLDAQIGATASAKA*
Ga0150983_1464036613300011120Forest SoilIAAEFPATEAIAPRLEAFEALLDQQFAATAGKGN*
Ga0137392_1083106613300011269Vadose Zone SoilIAAEFPAAEAIAPRLDAFEAYLDAQLGTAAASAKA*
Ga0137392_1156684513300011269Vadose Zone SoilLKTTDAIAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA*
Ga0137391_1026413743300011270Vadose Zone SoilIAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA*
Ga0137391_1048528033300011270Vadose Zone SoilTDAIAAEFPATEAIAPRLEAFEAYLDAQLGATASTAKV*
Ga0137393_1018363613300011271Vadose Zone SoilAIAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA*
Ga0137389_1075238913300012096Vadose Zone SoilNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA*
Ga0137388_1004780113300012189Vadose Zone SoilGLKTTDAIAAEFPVTEAIAPRLDAFEAYLESQLRVTAAARA*
Ga0137388_1040984213300012189Vadose Zone SoilNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTAAAGARA*
Ga0137388_1052534613300012189Vadose Zone SoilKTTDAIAAEFPAAEAIAPRLEAFETYLDAQLGTATASAKA*
Ga0137388_1066027313300012189Vadose Zone SoilGNGLKTPDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR*
Ga0137388_1128125523300012189Vadose Zone SoilLKTTDAIAAEFPATEAIAPLLDAFEAYLDAQLGATTAAAMA*
Ga0137388_1180212723300012189Vadose Zone SoilAAEFPATEAIAPRLDAFEAYLDAQLGTTTAAAKA*
Ga0137383_1119942113300012199Vadose Zone SoilTDAITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA*
Ga0137363_1083974423300012202Vadose Zone SoilKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR*
Ga0137363_1110669433300012202Vadose Zone SoilVSEYPLTEAIAPRLEAFEAYLDAQLGAAAEAAKA*
Ga0137399_1127339513300012203Vadose Zone SoilGLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAAGARP*
Ga0137399_1147471223300012203Vadose Zone SoilLKTTDAIAAEFPAPEAIAPRLDAFEAYLESQLPAAATARA*
Ga0137380_1028601213300012206Vadose Zone SoilAITAEFPATEAIAPRLEAFEAYLDAQLGAAAASGKA*
Ga0137380_1043851313300012206Vadose Zone SoilGNGLKTTDAIAAEFPVTEAIAPRLEAFEAYLDAQLGATAAGAKA*
Ga0137380_1079843213300012206Vadose Zone SoilIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR*
Ga0137376_1147350323300012208Vadose Zone SoilTDAIVAEYPATEAIAPKLEVFEAYLDAQLAAAKA*
Ga0137377_1012379613300012211Vadose Zone SoilITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA*
Ga0137377_1189677523300012211Vadose Zone SoilVAEFPATEAIPPRLEAFAAYLDAQLGTTTASARA*
Ga0137387_1046222013300012349Vadose Zone SoilKTTDALAGEFPAEEAIAPRLDAFEAYLEGRLAGAATAT*
Ga0137387_1050016733300012349Vadose Zone SoilAIVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV*
Ga0137386_1106990423300012351Vadose Zone SoilTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR*
Ga0137384_1037596113300012357Vadose Zone SoilNGLKTTDAITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA*
Ga0137384_1067969013300012357Vadose Zone SoilTDAIAAEFPATEAIAPRLDAFEAYLDAQYGTTEESAKR*
Ga0137360_1078799013300012361Vadose Zone SoilLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR*
Ga0137361_1010666253300012362Vadose Zone SoilLKTTDAIATEFPATEAIAPRLEAFEAYLDAQLGATAAGAKT*
Ga0137390_1148078113300012363Vadose Zone SoilTGNGLKTTDAIATEFPATEAIAPRLEAFEAYLDAQLGATAASAKT*
Ga0137390_1194723523300012363Vadose Zone SoilDAIAAEFPATEAIAPRLDAFEAYLDAQLGAAASAAAGKR*
Ga0137398_1070143313300012683Vadose Zone SoilTTDAIAADFPLSEAIAPRIEAFEAYLDGQLPTTAAARA*
Ga0137396_1056368333300012918Vadose Zone SoilAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAAGARA*
Ga0137359_1040551233300012923Vadose Zone SoilGLKTTDAIVADYPATEAIAPKLEAFEAYLDGQLAAVKA*
Ga0137359_1100164113300012923Vadose Zone SoilKTTDAIAADFPLSEAIAPRIEAFEAYLDSQLPTTAAARA*
Ga0137413_1016663343300012924Vadose Zone SoilAIAAEFPATDAIAPRLEAFEAYLDAQLGTATASAKA*
Ga0137419_1022436213300012925Vadose Zone SoilTTEAIAAEFPPTEAIAPHLDAFEAYLDAHLSTAAASAKA*
Ga0137419_1117267913300012925Vadose Zone SoilDAIAAEFPATDAIAPRLEAFEAYLDAQLGATAGSAKA*
Ga0137419_1183164313300012925Vadose Zone SoilNGLKTTDAIAADFPLSEAIAPRIEAFEAYIEAQLPAAAAARA*
Ga0137416_1005955663300012927Vadose Zone SoilVCITGNGLKTTEAIAAEFPPTEAIAPHLEAFEAYLDAHLGTAAASAKA*
Ga0137416_1010363633300012927Vadose Zone SoilITGNGLKTTDAIAAEFPAAEVIAPRLDAFEAYLDAQLGATTASAKA*
Ga0137416_1029765913300012927Vadose Zone SoilNGLKTTDAIAAEFPSTEAIAPRIEALEALLDSQLAAAAATKGN*
Ga0137407_1082779713300012930Vadose Zone SoilAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA*
Ga0153915_1269863413300012931Freshwater WetlandsKTTDALTGEFPATEAIAPRLDAFEAYLEGRLAAAVASK*
Ga0126369_1146926113300012971Tropical Forest SoilTDAIAPEYPATEAIAPRLEAFEAYLDAQLGTSAVAAKV*
Ga0134077_1042329213300012972Grasslands SoilGLKTTDAIVSEYPLTEAIAPRLEAFEAYLDAQLGAAAEAAKA*
Ga0134110_1000781613300012975Grasslands SoilGNGLKTTDAIATEFPATEAIAPRLEAFEAYLDAHIGAAAAAKA*
Ga0164306_1193380213300012988SoilTDAIAAEFPLAEAIAPRLEAFEAYLDSQLGAHAATAGK*
Ga0157372_1319070123300013307Corn RhizosphereITGNGLKTTDAIVNEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK*
Ga0134075_1004176543300014154Grasslands SoilATTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATAAGVRA*
Ga0134079_1006048843300014166Grasslands SoilGLKTTDAIAAEFPATEAIAPRLDAFEGYLDAQLGTAAAGAKA*
Ga0137411_115459583300015052Vadose Zone SoilGNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA*
Ga0137411_136000013300015052Vadose Zone SoilNGLKTTEAIAAEFPPTEAIAPHLDAFEAYLDAHLSTAAASAKA*
Ga0137420_111101823300015054Vadose Zone SoilGNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTAAVSAKA*
Ga0137420_121424023300015054Vadose Zone SoilGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAHLGTAAASAKA*
Ga0137420_130785713300015054Vadose Zone SoilPENHRKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATAAGVKA*
Ga0137409_1127997923300015245Vadose Zone SoilLKTTDAISAEFPLTEAIAPRLDAFEAYLDNQFTATAAAAK*
Ga0182035_1113785923300016341SoilKTTDAIVAEYPAKEAIAPKLEAFEAYLDAQLAAGAASGKA
Ga0187785_1016668633300017947Tropical PeatlandGNGLKTTDAIAADFPAADAIEPRLEAFEALLDLVVAPASGGQAAAQQP
Ga0187779_1047281613300017959Tropical PeatlandTGNGLKTTDALAAEFPFAEPIAPRLEAFEAALEGRLAAAATLSL
Ga0187822_1036488813300017994Freshwater SedimentAIAAEFPATEAIAPRLEAFEAYLDAQIGATAAAKA
Ga0066655_1084004223300018431Grasslands SoilTDGIGAEFPASEAIAPRLGAFEAYLDAHLGTAAASAKA
Ga0066669_1229930323300018482Grasslands SoilGNGLKTTDAIVSEFPATEAIAPRLEAFEAYLDARLGTAAASAKA
Ga0210407_1086323333300020579SoilNGLKTTDAIAAEFPVAEVIAPRLDAFEAYLGAQLPKTAAARA
Ga0210403_1043730633300020580SoilLKTTDAIAAEFPAAEAIAPRLDAFEALLDQQFAATAGKGN
Ga0210403_1134443413300020580SoilLKTTDAIAAEFPLAEAIAPRLDAFEAYIESQLPATAAARA
Ga0210399_1059338113300020581SoilDAIAAEFPATEAIAPRLEAFEALLDQQFAAAAGKGN
Ga0210395_1017240113300020582SoilITGNGLKTLDAISAEFPVSEAIAPRLDAFEAYLDNQFNAAPAAAVAK
Ga0210401_1006686763300020583SoilTTDAIASEFPVTEAIAPRLDAFEAYLDNQFTAAAAAK
Ga0210400_1155544413300021170SoilAIAAEFPVTEAIAPRLEAFEAYLDAQLGTTAAGAKA
Ga0210408_1091416333300021178SoilDAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAASAKA
Ga0210396_1174560923300021180SoilDAIAAEFPTIEAIAPRLEAFEAYLDNQLATTASAQR
Ga0210384_1009656833300021432SoilTGNGLKTTDAIAADYPATEAIAPRLDAFEAYLDDQLATTAKA
Ga0210398_1099854613300021477SoilNGLKTTDAIAAEFPLTEAIAPRLDAFEAYLDNQFSVAATAAK
Ga0210410_1064742933300021479SoilTTDAIAAEFPATEAIAPRLDAFEALLDQQFAATAGK
Ga0210409_1056876833300021559SoilTTDAIAADYPATEAIAPRLDAFEAYLDDQLATTAKA
Ga0242654_1034586523300022726SoilDAIAAEYPLTEAIAPRLEAFEAYLDSQLATAAVAKV
Ga0242654_1038664723300022726SoilAIAAEFPVTEAIAPRLDAFEAYLEAQLPVSAAARA
Ga0247677_104453013300024245SoilGLKTTDAIASEFPLTEAIAPKLEAFEAYLDGQLTAASAIAGAK
Ga0247671_101662913300024284SoilGNGLKTTDAIAAEFPVTEAIEPRIDAFEAYLENQFTLAAATAGAK
Ga0179589_1051241223300024288Vadose Zone SoilITGNGLKTTDALIAEYPLSEPIPPRLEAFEALLDQQLAVTAGAKGAVSTCP
Ga0207663_1068053133300025916Corn, Switchgrass And Miscanthus RhizosphereIVNEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK
Ga0207648_1029781513300026089Miscanthus RhizosphereTTDAIAAEYPFTEAIAPKLEAFEAYLDSQLAAGAAARA
Ga0209057_124681123300026342SoilIAAEFPATEAIAPRLEAFEAYLDAQLGATAAGAKT
Ga0257172_110514023300026482SoilLKTTEAIAAEFPATEAIAPRLEAFEAYLDAQLGVTAGSAKA
Ga0257168_112303913300026514SoilNGLKTTDAIAAEFPVAEAIAPRLEAFEAYLESQLPAAAAARA
Ga0209378_129230823300026528SoilTTDPIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR
Ga0209577_1012045913300026552SoilNGLKTTDAIAAEFPSSEAIAPRLEAFEAYLDAQLGAAAAKA
Ga0209731_105279633300027326Forest SoilGLKTTDAIAAEFPAAEAIAPRLDAFEAYLDAQLGATAAGAKA
Ga0209388_107194533300027655Vadose Zone SoilGNGLKTTDAIAAEFPLSEAIAPRLDAFEAYIESQLPATAAARA
Ga0209139_1018325713300027795Bog Forest SoilCITGNGLKTTDALVAEFPLPEAIAPRLDAFEALLDSQLAATAAQGN
Ga0209167_1073075113300027867Surface SoilKTTDAIAGEFPLTEAIAPKLEAFEALLDSQLTTASAVAAAK
Ga0209283_1091765733300027875Vadose Zone SoilDAIAAEFPATEAIAPRLDAFEAYLDAQLGAATAGAKA
Ga0209698_1011321053300027911WatershedsAAEFPATEAIAPRIEAFEAYLDAQIGIAKAAASSA
Ga0209168_1031598723300027986Surface SoilLSITGNGLKTTDAIANEFPLTEAIAPKLEAFEALLDSQLTAAGAAAGAK
Ga0222749_1016814913300029636SoilTTDAIAAEFPLAEAIAPRLDAFEAYLDSQFTAAAAAK
Ga0302179_1055719813300030058PalsaYPVTEAIAPRLDAFEAYLDRQLGTPAATAAVASRS
Ga0302314_1078335013300030906PalsaAIVAEYPVTEAIAPRLDAFEAYLDRQLGTPAATAAVASRS
Ga0170834_10064733223300031057Forest SoilLKTTDAIAAEFPVTEAIAPRLDAFKAYLEAQLPASAAARA
Ga0170834_11352772713300031057Forest SoilGNGLKTTDAIAAEFPVTEAIAPRLDAFEAYLDNQFSVAASAAK
Ga0318561_1044833033300031679SoilGNGLKTTDAIAAEFPATEAIAPRLEAFEAYLDTQMGAAAAAKA
Ga0307476_1131550313300031715Hardwood Forest SoilGNGLKTTDAIASEFPVTEAIAPRLDAFEAYLDSQFTAAAAAK
Ga0307474_1161998723300031718Hardwood Forest SoilTTDAIAAEFPVTEAIAPRLDAFEAYLEAQLPATAAARA
Ga0307469_1064471713300031720Hardwood Forest SoilLKTTDAIAAEYPATEAIAPRLDAFEAYLDAQLGTTAASAKA
Ga0307469_1167242513300031720Hardwood Forest SoilDAIAAEFPQAEAIAPRLEAFEAYLDAELGAATASAAAK
Ga0307469_1242485613300031720Hardwood Forest SoilAIVSEFPATEAIAPRLEAFEAYLDAQLGTAAASAKG
Ga0307477_1006851413300031753Hardwood Forest SoilAIAAEFPATEAIAPRLEAFEAYLDAQLGAHATAAK
Ga0307478_1067181833300031823Hardwood Forest SoilAIAADFPATEVIAPRLDAFEAYLDNQFNTVPAVAGAQ
Ga0307470_1195807823300032174Hardwood Forest SoilKTTDAIAAEFPVADAIPPRLDAFEAYLEARLPAVAVARA
Ga0307471_10246767313300032180Hardwood Forest SoilIAAEFPATEAIAPRLDAFEAYLDAQLGTTAAGARA
Ga0335077_1171658313300033158SoilKTTDAIVSEYPLTEAIAPRLEAFEAYLDTQLTTTAAVAKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.