NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042368

Metagenome / Metatranscriptome Family F042368

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042368
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 172 residues
Representative Sequence ARHHIQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Number of Associated Samples 103
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.63 %
% of genes near scaffold ends (potentially truncated) 95.57 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(31.646 % of family members)
Environment Ontology (ENVO) Unclassified
(83.544 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(62.025 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.73%    β-sheet: 0.00%    Coil/Unstructured: 38.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003303|Ga0006246J48908_1066239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300006356|Ga0075487_1317199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300006397|Ga0075488_1621405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300009543|Ga0115099_10718488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300009599|Ga0115103_1473946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300009599|Ga0115103_1537401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300009599|Ga0115103_1662047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300009606|Ga0115102_10498104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300009606|Ga0115102_10770786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum867Open in IMG/M
3300009677|Ga0115104_10044458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300009677|Ga0115104_11179337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300009679|Ga0115105_10421540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300009679|Ga0115105_10677988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300009679|Ga0115105_11332217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300010987|Ga0138324_10476440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300012470|Ga0129329_1035957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300012504|Ga0129347_1271317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300012518|Ga0129349_1018861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300012518|Ga0129349_1397083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300012523|Ga0129350_1236531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum790Open in IMG/M
3300012523|Ga0129350_1321563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300012954|Ga0163111_10975916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300012969|Ga0129332_1135358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300016735|Ga0182074_1101364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300016747|Ga0182078_10855060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300016751|Ga0182062_1509123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300017730|Ga0181417_1077012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300017746|Ga0181389_1130918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300018647|Ga0192913_1034719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018761|Ga0193063_1065795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018765|Ga0193031_1073903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300018823|Ga0193053_1043950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300018823|Ga0193053_1047957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300018830|Ga0193191_1082003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300018862|Ga0193308_1058182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300018905|Ga0193028_1112483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300018922|Ga0193420_10075630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300018926|Ga0192989_10109521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300018928|Ga0193260_10084089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300018974|Ga0192873_10252710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300018977|Ga0193353_10165274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300018982|Ga0192947_10155984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300018982|Ga0192947_10162171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300018982|Ga0192947_10166294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300018982|Ga0192947_10207829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018989|Ga0193030_10149392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300018989|Ga0193030_10156685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300018989|Ga0193030_10181314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300018989|Ga0193030_10233950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300018989|Ga0193030_10235225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019001|Ga0193034_10142211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300019009|Ga0192880_10093214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300019022|Ga0192951_10273381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300019025|Ga0193545_10085748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300019036|Ga0192945_10139245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300019036|Ga0192945_10153671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300019036|Ga0192945_10208326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300019039|Ga0193123_10450708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019045|Ga0193336_10277364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300019051|Ga0192826_10243790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300019051|Ga0192826_10247065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300019051|Ga0192826_10345898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300019095|Ga0188866_1018707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300019095|Ga0188866_1018887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300019095|Ga0188866_1018888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300019095|Ga0188866_1018933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300019095|Ga0188866_1020484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300019095|Ga0188866_1020543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300019095|Ga0188866_1021293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300019095|Ga0188866_1021426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300019103|Ga0192946_1045110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300019117|Ga0193054_1043930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300019117|Ga0193054_1053641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300019125|Ga0193104_1054366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300019149|Ga0188870_10093202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300019149|Ga0188870_10093406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300019149|Ga0188870_10097188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300019149|Ga0188870_10097878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300019149|Ga0188870_10099278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300019150|Ga0194244_10067509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300019274|Ga0182073_1355879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300019282|Ga0182075_1228508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300021350|Ga0206692_1304687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300021353|Ga0206693_1714852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300021872|Ga0063132_110939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300021872|Ga0063132_113728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300021905|Ga0063088_1047080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300021921|Ga0063870_1041901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300021922|Ga0063869_1021207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300021935|Ga0063138_1105768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300021940|Ga0063108_1057851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300021954|Ga0063755_1023387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300026500|Ga0247592_1128698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300026503|Ga0247605_1115719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300028137|Ga0256412_1187695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300028137|Ga0256412_1288366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300028137|Ga0256412_1288828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300028282|Ga0256413_1216126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300030781|Ga0073982_11744664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300030788|Ga0073964_11734122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300030788|Ga0073964_11737469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300030788|Ga0073964_11761946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300030856|Ga0073990_10007389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300030856|Ga0073990_10013373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300030857|Ga0073981_11722126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300030865|Ga0073972_11299757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300030871|Ga0151494_1113586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300030871|Ga0151494_1219776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300030912|Ga0073987_11227594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300030912|Ga0073987_11229988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300030919|Ga0073970_11283202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300030948|Ga0073977_1553719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300030954|Ga0073942_11705947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300030961|Ga0151491_1363577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300031032|Ga0073980_11320165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300031032|Ga0073980_11377620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300031038|Ga0073986_12040404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300031038|Ga0073986_12040651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300031062|Ga0073989_10022177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300031062|Ga0073989_13584652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300031062|Ga0073989_13608597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300031126|Ga0073962_11901012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300031126|Ga0073962_12004941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300031445|Ga0073952_12018626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300031445|Ga0073952_12081001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300031445|Ga0073952_12090099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300031725|Ga0307381_10268945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300031739|Ga0307383_10627040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300031743|Ga0307382_10369280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300032463|Ga0314684_10503885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300032463|Ga0314684_10532436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300032470|Ga0314670_10440107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300032481|Ga0314668_10396721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300032481|Ga0314668_10658717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300032491|Ga0314675_10333863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300032491|Ga0314675_10569968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300032492|Ga0314679_10331569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300032517|Ga0314688_10491943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300032518|Ga0314689_10423246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300032518|Ga0314689_10471571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300032519|Ga0314676_10481972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300032520|Ga0314667_10477503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300032615|Ga0314674_10429234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300032650|Ga0314673_10740232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300032666|Ga0314678_10268979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300032666|Ga0314678_10323466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300032713|Ga0314690_10411422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300032725|Ga0314702_1247816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300032728|Ga0314696_10439702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300032732|Ga0314711_10450095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300032732|Ga0314711_10525521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300032733|Ga0314714_10487277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300032733|Ga0314714_10606210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300032744|Ga0314705_10491770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300032744|Ga0314705_10520911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300032750|Ga0314708_10436178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300032752|Ga0314700_10448253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300032754|Ga0314692_10445280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine31.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.32%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater18.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.23%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.70%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.90%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.27%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003303Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300018647Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000833 (ERX1782439-ERR1712057)EnvironmentalOpen in IMG/M
3300018761Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030961Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0006246J48908_106623913300003303SeawaterLVAMLTPGASAIARRRHVADVTFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0075487_131719913300006356AqueousDADIAAHEAAREEAAKVAVNPANEFFGTVRANLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIARAIFYDVQLQDAMAGLGVAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0075488_162140513300006397AqueousHNYEYVSTLPDVRDDTVADADIAAHEAARAEAAKVKQNPQNAMFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIARAIFYDVQLQDAMAGLGVAGNTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0115099_1071848813300009543MarineKFLVSLAVAMLVSETCAHRHHHNYEYVSTLPDVRDDTVADADIAAHEVARAEAAKVKKNPQNEMFETVRLNLDTINKDMSFGISYSQTSRNEHARGVAADTAALLLAYANAVIAKTESGPNESLTEQNAHNIAKAIFFDVQLQDAMAGLGAAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_147394613300009599MarineLVSLAVAMLVSETCAHRHHHNYEYVSTLPDVRDDTVADSDIAAHEVARAEAAKVKKNPQNEMFETVRLNLDTINKDMSFGISYSQTSRNEHARGVAADTAALLLAYANAVIAKTESGPNESLTEQNAHNIAKAIFFDVQLQDAMAGLGAAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_153740113300009599MarineKLVSAIAALMLIGSTEAVQRHHHHRDVTFVETLPDERPATVSDADIAAHEAARDEAAKVKKNPQTSFFEDIRANLNQISKDLSFGVSFSQKTRNDHARGLVTDTAKSLKKYADGMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_166204713300009599MarineMKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDTDIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0115102_1049810423300009606MarineFIALFAAAAYARHHVQDVTFLQTLPDERAETISDVDIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRSRNEHARETATTTAGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0115102_1077078613300009606MarineMKFLVSLAVAMLVSETCAHRHHHNYEYVSTLPDVRDDTVADADIAAHEVARAEAAKVKKNPQNEMFETVRLNLDTINKDMSFGISYSQTSRNEHARGVAADTAALLLAYANAVIAKTESGPNESLTEQNAHNIAKAIFFDVQLQDAMAGLGAAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0115104_1004445813300009677MarineFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0115104_1117933723300009677MarineFIMKFFALAFLAAAEARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDMATTTSTLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG*
Ga0115105_1042154013300009679MarineAVVMLMTPDASAIARRRHHQDVTFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG*
Ga0115105_1067798813300009679MarineRRIHVGDVTLIQTLPDERPESVSDEEIAEHEAAREEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLVTSTATLIKDYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDFQAGLGMAGDEDLVLAINRLKSLQKLYLFEQKGGEDYLG*
Ga0115105_1133221713300009679MarineRRIHVGDVTLIQTLPDERPESVSDEEIAEHEAAREEAAKVAVNPANEFFSSVRSNLDQINKDMSFGISYSQRTRNEHARDLCTSTADLIKDYAEQMIDKTESGPNETLTEQNAHNIASTIFFDVQLQDFMAGLGMAGDDDLVLAINRLKSLQKLYLFEQVGGEDYLG*
Ga0138324_1047644013300010987MarineFFAATLAVAVAMHQRHIQIGDVTLVQELPDERMETVSDEEIAEHEEARAEAAKVAVNPANEYFASVRENLDQINKDMSFGISYSQRTRNEHARDLCTSTATLIKDYADEMISKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAGDEDLVLAMNRLKSLQKLYLFEQKGGEDYLG*
Ga0129329_103595713300012470AqueousFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0129347_127131713300012504AqueousVWFLATLAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGVSYSQKARNEHARGLVNDTAAALLAYANAIIAKTESGANESLTEQNAHNIAKAIFFDVQLQDAAAGLGMAENTALSLSINRLKSLQKLYLFEQKGGENYLG*
Ga0129349_101886113300012518AqueousDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADADLILAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0129349_139708313300012518AqueousKFLATLAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGVSYSQKARNEHARGLVNDTAAALLAYANAIIAKTESGANESLTEQNAHNIAKAIFFDVQLQDAAAGLGMAENTALSLSINRLKSLQKLYLFEQKGGENYLG*
Ga0129350_123653113300012523AqueousFLATLAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGVSYSQKARNEHARGLVNDTAAALLAYANAIIAKTESGANESLTEQNAHNIAKAIFFDVQLQDAAAGLGMAENTALSLSINRLKSLQKLYLFEQKGGENYLG*
Ga0129350_132156313300012523AqueousFFAAAIAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGTVRANLDQINKDMSFGISYSQRARNEHAREIATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADADLILAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0163111_1097591613300012954Surface SeawaterITRRIQVGDVTLIQTLPDERPESVSDEEIAEHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG*
Ga0129332_113535813300012969AqueousFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGASENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0182074_110136413300016735Salt MarshADIAAHEAARAEAAKVKQNPQNAMFETVRKNLDQINKDMSFGISYSQTSRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182078_1085506013300016747Salt MarshVADADIAAHEAARAEAAKVKANPQNAMFETVRKNLDQINKDMSFGISYSQTSRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182062_150912313300016751Salt MarshTVADADIAAHEAARAEAAKVKKNPQNDMFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIITKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0181417_107701213300017730SeawaterMKFLAAAIAVVAARHQVPDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0181389_113091813300017746SeawaterMKFLAAIIAAAAARHVQIGDVTLIQTLPDERAETVSDADIAAHESARAEAAKVAVNPANEFFATIRENLDQINKDMSFGISYSQRTRNEAARDLCTTTATEIKTYADTMISVTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLVLAVNRLKSLQKLYLFEQKGGEDYLG
Ga0192913_103471913300018647MarineSAIARRRHVADVTFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0193063_106579513300018761MarineVSDEEIAEHEAAREEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLATATSTLIKDYAQQMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAGDEDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0193031_107390313300018765MarineADIASHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0193053_104395013300018823MarineAASAIAVVMLLTQESAAVNRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0193053_104795713300018823MarineVVMLVTPAEAVQRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0193191_108200313300018830MarineAALMLIGSTEAIQRHHHHVADVTFVETLPDERPATVSDADIAAHEAARDEAAKVKKNPQTAFFADVRENLNQISKDLSFGVSFSQKTRNDHARTLVTSTAKDLKKYADQMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFE
Ga0193308_105818213300018862MarineFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0193028_111248313300018905MarineDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0193420_1007563013300018922MarineDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESCPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0192989_1010952113300018926MarineKFLAALAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAAREEAAKVKKNPQDTLFTTVKENLEKINTDMSFGVSYSQKARNEHARGVITETSAALLAYANSMIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAAKGLGMADDTALGLSINRLKSLQKLYLFEQKGGENYLG
Ga0193260_1008408913300018928MarineLTPGASAIARRRHVADVTFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0192873_1025271023300018974MarineMKFFAAAIAVVAARHQVPDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDFQAGLGMAGDEDLVLAINRLKSLQKLYLFEQKGGEDYLG
Ga0193353_1016527413300018977MarineDVRDDTVADADIAAHEAAREEAAKVKKNPQTDMFATVKKNLDQISKDVSFGISYSQKTRNEHAKTLATDTATLLKTYANAVIAKTEGGPNEALTEQNAHNIAMAIFYDVQLQDFMGGLGMAADDALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0192947_1015598413300018982MarineMRFIALFAAAAYARHHVQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192947_1016217113300018982MarineMGNLFIMKFFALAFLAAAEARHITIGDVTLIQTLPDERAETISDADIAAHESARAEAAKVAVNPANEFFASVRGNLDQINKDMSFGISYSQRTRNEAARDMATTTSTLIKTYADRMIEKTELGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0192947_1016629413300018982MarineMGNLFIMKFFALAFLAAAEARHITIGDVTLIQTLPDERAETISDADIAAHESARAEAAKVAVNPANEFFASVRGNLDQINKDMSFGISYSQRTRNEAARDMATTTSTLIKTYADRMIEKTELGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192947_1020782913300018982MarineTLPDERAETISDADIASHESARSEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDMCTDTSTLIKTYSDRMIEKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0193030_1014939213300018989MarineHGIIYSMKFAASAIAVVMLLTQESAAVSRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0193030_1015668513300018989MarineMGNLFIMKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0193030_1018131413300018989MarineMGNLFIMKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAEDEDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0193030_1023395013300018989MarineEAAREEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLCTSTADLIKDYAEQMIDKTESGPNETLTEQNAHNIASTIFFDVQLQDFMAGLGMAGDDDLVLAINRLKSLQKLYLFEQVGGEDYLG
Ga0193030_1023522513300018989MarineVQELPDERMETVSDEEIAEHEAARAEAAKVAVNPANEYFASVRENLDQINKDMSFGISYSQRTRNEHARDLCTSTATLIKDYADEMLAKTEAGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0193034_1014221113300019001MarineDVRDDTVADADIAAHESAREEAAKVKKNPQTDMFATVRKNLDQISKDVSFGISYSQKTRNDAAKTLATTTATLLKTYATAVIAKTEGGPNESLTEQNAHNIAMAIFYDVQLQDFMGGLGMAADDDLSLSVNRLKSLQKLYLFEQKGGENYLGXAXXEVLTNLIEAI
Ga0192880_1009321413300019009MarineTWDYNLFIMKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192951_1027338113300019022MarineDVTLIQTLPDERAETISDADIAAHESARAEAAKVAVNPANEFFASVRGNLDQINKDMSFGISYSQRTRNEAARDMATTTSTLIKTYADRMIEKTELGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0193545_1008574813300019025MarineAFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0192945_1013924523300019036MarineTWGYNLFIMRFIALFAAAAYARHHVQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192945_1015367113300019036MarineTWGYNLFIMRFIALFAAAAYARHHVQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192945_1020832613300019036MarineLIQTLPDERAETISDADIAAHESARAEAAKVAVNPANEFFASVRGNLDQINKDMSFGISYSQRTRNEAARDMATTTSTLIKTYADRMIEKTELGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0193123_1045070813300019039MarineRAETISDADIAAHESARAEAAKVAVNPANEFFASVRGNLDQINKDMSFGISYSQRTRNEAARDLATTTSTLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0193336_1027736413300019045MarineMKFFAAAIAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192826_1024379013300019051MarinePDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIQKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0192826_1024706513300019051MarineAIQRRIQVGDVTLIQTLPDERPESVSDEEIAEHEAAREEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLCTSTSTLIKDYAQQMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAADEDLILAMNRMKSLQKLYLFEQKGGEDYLG
Ga0192826_1034589813300019051MarineAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIQKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0188866_101870713300019095Freshwater LakeKFAASAIAVVMLLTQESAAVSRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEDARDLCTTTAGLIKTYADTMIDKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0188866_101888713300019095Freshwater LakeLVSAIAALMLIGSTEAVQRHHHHRDVTFVETLPDERPATVSDADIAAHEAARDEAAKVKKNPQTSFFEDIRANLNQISKDLSFGVSFSQKTRNDHARGLVTDTAKSLKKYADGMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0188866_101888813300019095Freshwater LakeLVSAIAALMLVGSTEAVQRHHHHRDVTFVETLPDERPATVSDADIAAHEAARDEAAKVKKNPQTAFFETVRAQLNQIGQDLSFGVSFSQKTRNDNARTLVTKTAKDLKDYADKMIKKTEGSPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0188866_101893313300019095Freshwater LakeKFLASTIAVVMLMTPAEAVQRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEDARDLCTTTAGLIKTYADTMIDKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0188866_102048413300019095Freshwater LakeKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHETARAEAAKVAVNPANEFFATVRLNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0188866_102054313300019095Freshwater LakeFLATLAVVAAVQRRSFPDVTFIQTLPDERAETVSDADIAAHESARAEAAKVAVNPANEFFATIRENLDQINKDMSFGISYSQRTRNEAARDLCTTTATEIKTYADTMISVTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLVLAVNRLKSLQKLYLFEQKGGEDYLG
Ga0188866_102129313300019095Freshwater LakeFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0188866_102142613300019095Freshwater LakeFFAAAIAVVAARHQVPDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0192946_104511013300019103MarineQVPDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMASDSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0193054_104393013300019117MarineTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0193054_105364113300019117MarineTVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0193104_105436613300019125MarineTVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0188870_1009320213300019149Freshwater LakeMKFAASAIAVVMLLTQESAAVSRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEDARDLCTTTAGLIKTYADTMIDKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0188870_1009340613300019149Freshwater LakeKLVSAIAALMLIGSTEAVQRHHHHRDVTFVETLPDERPATVSDADIAAHEAARDEAAKVKKNPQTSFFEDIRANLNQISKDLSFGVSFSQKTRNDHARGLVTDTAKSLKKYADGMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0188870_1009718813300019149Freshwater LakeVNPANEFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHETARAEAAKVAVNPANEFFATVRLNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0188870_1009787813300019149Freshwater LakeKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0188870_1009927813300019149Freshwater LakeFFAAAIAVVAARHQVPDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0194244_1006750913300019150MarineTLPDERPETIFDADIAAHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0182073_135587913300019274Salt MarshEAARAEAAKVKANPQNAMFETVRKNLDQINKDMSFGISYSQTSRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182075_122850813300019282Salt MarshLAVAMLVSDASAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQDDLFKSVKANLEQINKDMSFGVSYSQTARNEHARGLATQTAAALNSYANAIIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMKGLGMADDAGLVLNFNRLKSLQKLYLFEQKGGENYLG
Ga0206692_130468713300021350SeawaterKFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0206693_171485213300021353SeawaterDERPETVSDEEIADHEAAREEAAKVSINPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLATSTSTLIKDYAQQMIDKTESGPNEVLTEQNAHNIAATIFFDVQLQDFMAGLGMAGDEDLVLAMNRMKSLQKLYLFEQKGGEDYLG
Ga0063132_11093913300021872MarineFAASAIAVVMLLTQESAAVSRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0063132_11372813300021872MarineAVVMLMTPAEAVQRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTESGPNETLTEQNAHNIAGTIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0063088_104708013300021905MarineFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0063870_104190113300021921MarineARHHIQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0063869_102120713300021922MarineFFVAAIAAVAARHHIQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0063138_110576813300021935MarineHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEDARDLCTTTAGLIKTYADTMIDKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0063108_105785113300021940MarineFFVAAIAAVAARHHIQDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYL
Ga0063755_102338713300021954MarineDVTFLQTLPDERAETISDADIASHEAAREEAAKVAVNPANEFFGTVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0247592_112869813300026500SeawaterFFAAAIAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0247605_111571913300026503SeawaterFIALFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0256412_118769513300028137SeawaterLFAAAVYARHRHVEDVTFLQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0256412_128836613300028137SeawaterAVVMLLTQESAAVSRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLG
Ga0256412_128882813300028137SeawaterETVSDADIAAHEAARAEAAKVAVNPANEFFATIRENLDQINKDMSFGISYSQRTRNEAARDLCTTTATEIKTYADTMISVTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQAGGEDYLGF
Ga0256413_121612613300028282SeawaterFFAAAIAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0073982_1174466413300030781MarineIAVVMLMTPAEAVQRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLG
Ga0073964_1173412213300030788MarineFYALAFLAAVQARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073964_1173746913300030788MarineAVVMLLTQESAAVNRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLG
Ga0073964_1176194613300030788MarineRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073990_1000738913300030856MarineMKFVSSAIAVVMLMTQDASAAQRRHFKDVTFIQTLPDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073990_1001337313300030856MarineKFVSSAIAVVMLMTQDASAAQRRHFKDVTFIQTLPDERPETISDEDIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIQKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0073981_1172212613300030857MarineFIATLAAVMLMTPSASAVQRRHFKDVTFIQTLPDERAETISDEDIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAGDEDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0073972_1129975713300030865MarineFLAAVQARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0151494_111358613300030871MarineAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0151494_121977613300030871MarineLVASIAALMLIGSTEAIQRHHQHVADVTFVETLPDERPATVSDSDIAAHEAARDEAAKVKKNPQTAFFADVRENLNQISKDLSFGVSFSQKTRNDHARTLVTSTAKDLKKYADQMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQNAHNIATA
Ga0073987_1122759413300030912MarineEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073987_1122998813300030912MarineFVSSAIAVVMLMTQDASAAQRRHFKDVTFIQTLPDERPETISDEDIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIQKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0073970_1128320213300030919MarineFIALAAMVAARHITIGDVTLVQTLPDERAETISDEDIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073977_155371913300030948MarineVAFYALAFLAAVQARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLILAMNRLKSLQKLYLFEQKGGEDYL
Ga0073942_1170594713300030954MarineLVASIAALMLIGSTEAIQRHHQHVADVTFVETLPDERPATVSDSDIAAHEAARDEAAKVKKNPQTAFFADVRENLNQISKDLSFGVSFSQKTRNDHARTLVTSTAKDLKKYADQMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0151491_136357713300030961MarineMKFYALAFLAAVQARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQ
Ga0073980_1132016513300031032MarineALVAMLTPGASAIARRRHVADVTFVQTLPDERPESVSDEEIAEHEAARAEAAKVAVNPANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADGMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAADEDLVLAMNRMKSLQKLYLFEQKGGEDYL
Ga0073980_1137762013300031032MarineFFAAAIAVVAARHQVPDVTFIQTLPDERPETISDADIAAHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0073986_1204040413300031038MarineIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073986_1204065113300031038MarineDERPETISDEDIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0073989_1002217713300031062MarineIALAAMVAARHITIGDVTLVQTLPDERAETISDEDIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIQKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073989_1358465213300031062MarineFFASAIAVGMLMTPNASAITRRIHVGDVTLIQTLPDERPETVSDEEIAEHEAAREEAAKVAVNPANEYFASVRANLDQINKDMSFGISYSQRTRNEHARDLCTSTSTLIKDYAQQMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAADEDLILSMNRLKSLQKLYLFEQKGGEDYLG
Ga0073989_1360859713300031062MarinePDERPETVSDEDIALHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073962_1190101213300031126MarineYALAFLAAVQARHITIGDVTLIQTLPDERAETISDADIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073962_1200494113300031126MarineDADIAAHENARAEAAKVKKNPQTAMFTTVRANLDQISKDLSFGVSYSQRTRNEHARGICTATAKILKDYGNAMIKKTEGSPNESLTEQNAHNIATAIFYDVQLQDFMAGLGMAADGDLTLSINRLKSLQKLYLFEQKGGENYLG
Ga0073952_1201862613300031445MarineFIATLAAVMLMTPSASAVQRRHFKDVTFIQTLPDERAETISDEDIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0073952_1208100113300031445MarineIALAAVVAARHITIGDVTLIQTLPDERAETISDEDIAAHEAARAEAAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073952_1209009913300031445MarineISDEDIAAHEAARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0307381_1026894513300031725MarinePDVTFLQTLPDERAETISDADIASHASAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAQDDDLVLAMNRLKSLQKLYLFDQKGGEDYLG
Ga0307383_1062704013300031739MarineRFIALFAAAAYARHHVQDVTFLQTLPDERAETISDADIASHESAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADSDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0307382_1036928013300031743MarineRQFEDVTLIQTLPDERAETISDADIASHESARAEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDMCTDTSTLIKTYADRMIEKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0314684_1050388513300032463SeawaterYELFIMRFIALFAAAAVARHHVQDVTFLQTLPDERAETISDADIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314684_1053243613300032463SeawaterFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRLNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314670_1044010713300032470SeawaterFIALFAAAAVARHHVQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314668_1039672113300032481SeawaterPALDYNKKMKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314668_1065871713300032481SeawaterFIALFAAAAVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGED
Ga0314675_1033386313300032491SeawaterKKMKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314675_1056996813300032491SeawaterDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314679_1033156913300032492SeawaterKKMKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRLNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314688_1049194313300032517SeawaterAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314689_1042324613300032518SeawaterFFSAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314689_1047157113300032518SeawaterFIALFAAAAVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314676_1048197213300032519SeawaterFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314667_1047750313300032520SeawaterKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314674_1042923413300032615SeawaterKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314673_1074023213300032650SeawaterFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLF
Ga0314678_1026897913300032666SeawaterFIALFAAAAVARHHVQDVTFLQTLPDERAETISDADIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314678_1032346613300032666SeawaterFFAAAIAVVAARHQVPDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314690_1041142213300032713SeawaterYNKKMKFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314702_124781613300032725SeawaterIALFAAAAVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314696_1043970213300032728SeawaterAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314711_1045009513300032732SeawaterRFIALFAAAAVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314711_1052552113300032732SeawaterSDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314714_1048727713300032733SeawaterLSLVCARAPPVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314714_1060621013300032733SeawaterFAAAIAVVAARHQVPDVTFLQTLPDERPETISDADIASHEAAREEAAKVAVNPANEFFGSVRANLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314705_1049177013300032744SeawaterFAAAAVARHHVQDVTFLQTLPDECAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314705_1052091113300032744SeawaterQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314708_1043617813300032750SeawaterAVARHHVQDVTFLQTLPDERAETISDTDIASHETAREEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314700_1044825313300032752SeawaterFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHETARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314692_1044528013300032754SeawaterFFAAAIAAVAARHHIQDVTFLQTLPDERAETISDTDIASHESARAEAAKVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLDLFEQKGGEDYLGF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.