Metagenome Family F042402

Basic Information
Family ID	F042402
Family Type	Metagenome
Number of Sequences	158
Average Sequence Length	36 residues
Representative Sequence	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFD
Number of Associated Samples	23
Number of Associated Scaffolds	158

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	79.31 %
% of genes near scaffold ends (potentially truncated)	64.56 %
% of genes from short scaffolds (< 2000 bps)	67.72 %
Associated GOLD sequencing projects	17
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (77.215 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut (100.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 158 Family Scaffolds
PF00787	PX	0.63
PF01359	Transposase_1	0.63
PF00788	RA	0.63

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
All Organisms	root	All Organisms	22.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
cellular organisms	root	All Organisms → cellular organisms	22.15 %
Viruses	superkingdom	All Organisms → Viruses	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	22.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	21.52 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	17.72 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	17.72 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	17.72 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	17.09 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.63 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	17.09 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.63 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	17.09 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.63 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	17.09 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.63 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	12.03 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.63 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	12.03 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.63 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	12.03 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.63 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	12.03 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.63 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	12.03 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.63 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	12.03 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.63 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	12.03 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	0.63 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	10.13 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	0.63 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	8.23 %
Phasmatodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea	1.27 %
Sterculioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae	0.63 %
Osteoglossocephala	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	8.23 %
Timematodea	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea	1.27 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Osteoglossomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	6.33 %
Timematoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea	1.27 %
Blaberoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	5.06 %
Timematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae	1.27 %
Ectobiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Kalotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae	4.43 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.27 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	0.63 %
Blattellinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Cryptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae	4.43 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.27 %
Blattella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella	0.63 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Cryptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes	4.43 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.27 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.63 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.22 %
Cryptotermes secundus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	4.43 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1.27 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.63 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.63 %
Osteoglossiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	0.63 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.63 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.63 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001544\|JGI20163J15578_10041724	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2465	Open in IMG/M
3300001544\|JGI20163J15578_10046869	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2361	Open in IMG/M
3300001544\|JGI20163J15578_10074597	Not Available	1990	Open in IMG/M
3300001544\|JGI20163J15578_10090724	Not Available	1848	Open in IMG/M
3300001544\|JGI20163J15578_10112385	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1683	Open in IMG/M
3300001544\|JGI20163J15578_10148431	Not Available	1482	Open in IMG/M
3300001544\|JGI20163J15578_10177321	Not Available	1362	Open in IMG/M
3300001544\|JGI20163J15578_10313817	Not Available	1010	Open in IMG/M
3300001544\|JGI20163J15578_10386010	Not Available	894	Open in IMG/M
3300001544\|JGI20163J15578_10581156	Not Available	685	Open in IMG/M
3300001544\|JGI20163J15578_10604980	Not Available	666	Open in IMG/M
3300001544\|JGI20163J15578_10606497	Not Available	664	Open in IMG/M
3300001544\|JGI20163J15578_10747252	Not Available	569	Open in IMG/M
3300001544\|JGI20163J15578_10757599	Not Available	563	Open in IMG/M
3300001544\|JGI20163J15578_10763961	Not Available	560	Open in IMG/M
3300001544\|JGI20163J15578_10789415	Not Available	545	Open in IMG/M
3300001544\|JGI20163J15578_10796299	Not Available	542	Open in IMG/M
3300002125\|JGI20165J26630_10073433	Not Available	1341	Open in IMG/M
3300002125\|JGI20165J26630_10128135	Not Available	1099	Open in IMG/M
3300002125\|JGI20165J26630_10167854	Not Available	995	Open in IMG/M
3300002125\|JGI20165J26630_10201241	Not Available	929	Open in IMG/M
3300002125\|JGI20165J26630_10265824	Not Available	833	Open in IMG/M
3300002125\|JGI20165J26630_10597195	Not Available	584	Open in IMG/M
3300002125\|JGI20165J26630_10737934	Not Available	526	Open in IMG/M
3300002127\|JGI20164J26629_10186252	Not Available	800	Open in IMG/M
3300002175\|JGI20166J26741_10090515	Not Available	532	Open in IMG/M
3300002175\|JGI20166J26741_10109382	Not Available	2716	Open in IMG/M
3300002175\|JGI20166J26741_10111661	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	2713	Open in IMG/M
3300002175\|JGI20166J26741_10268205	Not Available	2541	Open in IMG/M
3300002175\|JGI20166J26741_10383660	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2431	Open in IMG/M
3300002175\|JGI20166J26741_10697916	Not Available	2185	Open in IMG/M
3300002175\|JGI20166J26741_11445407	Not Available	5670	Open in IMG/M
3300002175\|JGI20166J26741_11451762	Not Available	1709	Open in IMG/M
3300002175\|JGI20166J26741_11464493	Not Available	1659	Open in IMG/M
3300002175\|JGI20166J26741_11493603	Not Available	1559	Open in IMG/M
3300002175\|JGI20166J26741_11856952	Not Available	898	Open in IMG/M
3300002175\|JGI20166J26741_12143441	Not Available	658	Open in IMG/M
3300002185\|JGI20163J26743_10524979	Not Available	565	Open in IMG/M
3300002185\|JGI20163J26743_10572551	Not Available	583	Open in IMG/M
3300002185\|JGI20163J26743_10581515	Not Available	587	Open in IMG/M
3300002185\|JGI20163J26743_10614299	Not Available	600	Open in IMG/M
3300002185\|JGI20163J26743_10624272	Not Available	604	Open in IMG/M
3300002185\|JGI20163J26743_10741173	Not Available	659	Open in IMG/M
3300002185\|JGI20163J26743_10769851	Not Available	674	Open in IMG/M
3300002185\|JGI20163J26743_10794303	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	687	Open in IMG/M
3300002185\|JGI20163J26743_10823263	Not Available	704	Open in IMG/M
3300002185\|JGI20163J26743_10835294	Not Available	711	Open in IMG/M
3300002185\|JGI20163J26743_11119625	Not Available	939	Open in IMG/M
3300002185\|JGI20163J26743_11197126	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1037	Open in IMG/M
3300002185\|JGI20163J26743_11213514	Not Available	1061	Open in IMG/M
3300002185\|JGI20163J26743_11218928	Not Available	1069	Open in IMG/M
3300002185\|JGI20163J26743_11219470	All Organisms → Viruses → Predicted Viral	1070	Open in IMG/M
3300002185\|JGI20163J26743_11285825	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1189	Open in IMG/M
3300002185\|JGI20163J26743_11368947	Not Available	1407	Open in IMG/M
3300002185\|JGI20163J26743_11371676	Not Available	1417	Open in IMG/M
3300002185\|JGI20163J26743_11442656	Not Available	1754	Open in IMG/M
3300002185\|JGI20163J26743_11519687	Not Available	3030	Open in IMG/M
3300002185\|JGI20163J26743_11534161	Not Available	4857	Open in IMG/M
3300002238\|JGI20169J29049_10607374	Not Available	551	Open in IMG/M
3300002508\|JGI24700J35501_10408122	Not Available	695	Open in IMG/M
3300002508\|JGI24700J35501_10747798	Not Available	1312	Open in IMG/M
3300002508\|JGI24700J35501_10851495	Not Available	1983	Open in IMG/M
3300002508\|JGI24700J35501_10873351	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2293	Open in IMG/M
3300002508\|JGI24700J35501_10882389	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2475	Open in IMG/M
3300006226\|Ga0099364_10125190	Not Available	2902	Open in IMG/M
3300006226\|Ga0099364_10125264	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2901	Open in IMG/M
3300006226\|Ga0099364_10146667	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	2656	Open in IMG/M
3300006226\|Ga0099364_10182586	Not Available	2346	Open in IMG/M
3300006226\|Ga0099364_10250084	Not Available	1950	Open in IMG/M
3300006226\|Ga0099364_10264103	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	1887	Open in IMG/M
3300006226\|Ga0099364_10486975	Not Available	1275	Open in IMG/M
3300006226\|Ga0099364_10516854	Not Available	1224	Open in IMG/M
3300006226\|Ga0099364_10538417	Not Available	1190	Open in IMG/M
3300006226\|Ga0099364_10570682	Not Available	1143	Open in IMG/M
3300006226\|Ga0099364_10644919	Not Available	1048	Open in IMG/M
3300006226\|Ga0099364_10658093	Not Available	1032	Open in IMG/M
3300006226\|Ga0099364_10669965	Not Available	1019	Open in IMG/M
3300006226\|Ga0099364_10687639	Not Available	1000	Open in IMG/M
3300006226\|Ga0099364_10688633	Not Available	999	Open in IMG/M
3300006226\|Ga0099364_10742976	Not Available	943	Open in IMG/M
3300006226\|Ga0099364_10871134	Not Available	829	Open in IMG/M
3300006226\|Ga0099364_10877409	Not Available	824	Open in IMG/M
3300006226\|Ga0099364_10894617	Not Available	809	Open in IMG/M
3300006226\|Ga0099364_11153957	Not Available	641	Open in IMG/M
3300009784\|Ga0123357_10077517	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4383	Open in IMG/M
3300009826\|Ga0123355_10786600	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1065	Open in IMG/M
3300010049\|Ga0123356_13746196	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	525	Open in IMG/M
3300010162\|Ga0131853_10002973	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	30436	Open in IMG/M
3300010162\|Ga0131853_10024116	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	10980	Open in IMG/M
3300010162\|Ga0131853_10042023	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	7925	Open in IMG/M
3300010162\|Ga0131853_10128890	Not Available	3509	Open in IMG/M
3300010162\|Ga0131853_10268931	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1861	Open in IMG/M
3300010162\|Ga0131853_10722140	Not Available	820	Open in IMG/M
3300010167\|Ga0123353_11556000	Not Available	838	Open in IMG/M
3300010369\|Ga0136643_10686069	All Organisms → cellular organisms → Eukaryota → Opisthokonta	621	Open in IMG/M
3300027558\|Ga0209531_10059772	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Osteoglossocephala → Osteoglossomorpha → Osteoglossiformes	1030	Open in IMG/M
3300027558\|Ga0209531_10115040	Not Available	834	Open in IMG/M
3300027558\|Ga0209531_10209557	Not Available	650	Open in IMG/M
3300027558\|Ga0209531_10242006	Not Available	608	Open in IMG/M
3300027558\|Ga0209531_10342472	Not Available	505	Open in IMG/M
3300027670\|Ga0209423_10590560	Not Available	510	Open in IMG/M
3300027864\|Ga0209755_10011746	Not Available	9134	Open in IMG/M
3300027891\|Ga0209628_10036592	Not Available	4594	Open in IMG/M
3300027891\|Ga0209628_10044582	Not Available	4229	Open in IMG/M
3300027891\|Ga0209628_10062733	Not Available	3656	Open in IMG/M
3300027891\|Ga0209628_10069790	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3487	Open in IMG/M
3300027891\|Ga0209628_10108651	Not Available	2847	Open in IMG/M
3300027891\|Ga0209628_10112325	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2803	Open in IMG/M
3300027891\|Ga0209628_10167035	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2312	Open in IMG/M
3300027891\|Ga0209628_10270681	Not Available	1794	Open in IMG/M
3300027891\|Ga0209628_10292289	Not Available	1718	Open in IMG/M
3300027891\|Ga0209628_10406358	Not Available	1405	Open in IMG/M
3300027891\|Ga0209628_10622674	Not Available	1059	Open in IMG/M
3300027891\|Ga0209628_10952099	Not Available	774	Open in IMG/M
3300027904\|Ga0209737_10037031	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	4228	Open in IMG/M
3300027904\|Ga0209737_10066853	Not Available	3327	Open in IMG/M
3300027904\|Ga0209737_10090588	Not Available	2926	Open in IMG/M
3300027904\|Ga0209737_10121568	Not Available	2574	Open in IMG/M
3300027904\|Ga0209737_10268518	Not Available	1771	Open in IMG/M
3300027904\|Ga0209737_10377399	Not Available	1474	Open in IMG/M
3300027904\|Ga0209737_10510785	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1236	Open in IMG/M
3300027904\|Ga0209737_10521490	Not Available	1221	Open in IMG/M
3300027904\|Ga0209737_10647148	Not Available	1069	Open in IMG/M
3300027904\|Ga0209737_10828518	Not Available	913	Open in IMG/M
3300027904\|Ga0209737_11070785	Not Available	765	Open in IMG/M
3300027904\|Ga0209737_11153593	Not Available	725	Open in IMG/M
3300027904\|Ga0209737_11180675	Not Available	713	Open in IMG/M
3300027904\|Ga0209737_11226776	Not Available	693	Open in IMG/M
3300027904\|Ga0209737_11326068	Not Available	654	Open in IMG/M
3300027984\|Ga0209629_10017163	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	6321	Open in IMG/M
3300027984\|Ga0209629_10056949	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	3820	Open in IMG/M
3300027984\|Ga0209629_10100269	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2915	Open in IMG/M
3300027984\|Ga0209629_10129726	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2553	Open in IMG/M
3300027984\|Ga0209629_10295628	Not Available	1571	Open in IMG/M
3300027984\|Ga0209629_10311025	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1516	Open in IMG/M
3300027984\|Ga0209629_10393119	Not Available	1280	Open in IMG/M
3300027984\|Ga0209629_10407997	Not Available	1245	Open in IMG/M
3300027984\|Ga0209629_10473218	Not Available	1109	Open in IMG/M
3300027984\|Ga0209629_10494957	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1070	Open in IMG/M
3300027984\|Ga0209629_10735523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	750	Open in IMG/M
3300027984\|Ga0209629_10790345	Not Available	696	Open in IMG/M
3300027984\|Ga0209629_10806278	Not Available	681	Open in IMG/M
3300027984\|Ga0209629_10962894	Not Available	555	Open in IMG/M
3300028325\|Ga0268261_10041598	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	3860	Open in IMG/M
3300028327\|Ga0268262_10492391	Not Available	569	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Arthropoda	Host-Associated → Arthropoda	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Arthropoda → Digestive System	100.00%

Habitat	Taxonomy	Distribution
Gut	Host-Associated → Arthropoda → Digestive System → Gut	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	100.00%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI20163J15578_100417243	3300001544	Termite Gut	MFSVITNIYNKKAKGPNLMELFTATGKLKKFFFDN*
JGI20163J15578_100468691	3300001544	Termite Gut	MLSVIKNIYNKKTKGPALMEFFTATGKLKKFFFDN*
JGI20163J15578_100705672	3300001544	Termite Gut	MFSVITNIYNKKTKLPTLIEFFTATGKLKKVFFLHLE
JGI20163J15578_100745971	3300001544	Termite Gut	SVIXNIYNKKTKGPILMEFFTATGKLKKFFFFIYN*
JGI20163J15578_100907241	3300001544	Termite Gut	MNTECFIMFSVITNIYNKKTKGPTLTELFTATGKLKKFFFDN*
JGI20163J15578_101123855	3300001544	Termite Gut	MFSVITNIYNQKTKGPTLMEFFTATGKVKNIFFFLQ
JGI20163J15578_101484312	3300001544	Termite Gut	MFSVITNIYNKKTKGPTLKELFTATGKLKKFFFDN*
JGI20163J15578_101773212	3300001544	Termite Gut	MFSGITNIYNKKIKGPTLMEFFTATGKLKKVFFVDN*
JGI20163J15578_103138172	3300001544	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATEKTEKVFFFDN*
JGI20163J15578_103194361	3300001544	Termite Gut	MFSVNKNIYNKKTKGPTLMEFFTATGKLKKVFFLGG
JGI20163J15578_103860102	3300001544	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLEKFSFLTTSKNP*
JGI20163J15578_105811561	3300001544	Termite Gut	RDVRCVHHVITNIYNKKAKGPTLVKLFTATGKLKKFFFDN*
JGI20163J15578_106049802	3300001544	Termite Gut	MFSVVTNIYNKKTKGPTLMEFFTATGKLKKFF*QLEMF
JGI20163J15578_106064971	3300001544	Termite Gut	FXMFSVITNIYNKKTKGPTLMEFFTATGILKKFFFDN*
JGI20163J15578_107472521	3300001544	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKVKKFFFFYN
JGI20163J15578_107575993	3300001544	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKRGFFWQLE
JGI20163J15578_107639612	3300001544	Termite Gut	MFFVITNIYNKKTKGPTLMEFFTATGKLKKFFFLTTR
JGI20163J15578_107894151	3300001544	Termite Gut	MFSVITNIYNKKTKGPILIEFFTATGKLKKFFFFT
JGI20163J15578_107962991	3300001544	Termite Gut	MFSMITNIYNKKIKGPILMEMFTATGKLKKFFFFD
JGI20165J26630_100734331	3300002125	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFFWQ
JGI20165J26630_101281353	3300002125	Termite Gut	MFSVIINIYNKKTKGPTLMEFFTATGKVEFFFLTT
JGI20165J26630_101678542	3300002125	Termite Gut	MFSVITNIYNKKTKGTTLMEFFTATGKLKKILFHNYS*
JGI20165J26630_102012413	3300002125	Termite Gut	MFSLITNIYNKKTKGPTLMEFFTATGKVKKFFEN*
JGI20165J26630_102658242	3300002125	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFFLLE
JGI20165J26630_105971951	3300002125	Termite Gut	MFCVITNIYNKKTKGPNLMEFFTATGKLKKFFFGQV*
JGI20165J26630_106386631	3300002125	Termite Gut	MFSVITNIYNKKTKLPTLIEFFTATGKLKKVFFLHLEMF
JGI20165J26630_107379342	3300002125	Termite Gut	MFSVNTNVYNKKTKGPTLMEFFTAIGKLNMFTRVWQE
JGI20164J26629_101862521	3300002127	Termite Gut	MFSVITNIYNKKTKGSNLMEFFTATGKLKKFFFDN*
JGI20164J26629_102824722	3300002127	Termite Gut	MFSMIKNIYNKKTKGPTLMEFFIAKGKLKKFFFLT
JGI20166J26741_100905152	3300002175	Termite Gut	MFSVIINIYNKKTKGPILMEFFTATGKLKKFFFFIYN*
JGI20166J26741_101093821	3300002175	Termite Gut	MFSVIKNIYNKKTKGPTVMEFFTAIGKLKKFFFDN*
JGI20166J26741_101116617	3300002175	Termite Gut	MFSVITNIYNKKTRGPTIMEFFTATGKLKKFFFDD*
JGI20166J26741_102682056	3300002175	Termite Gut	GRFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFL*
JGI20166J26741_103836603	3300002175	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFSVF*
JGI20166J26741_106979161	3300002175	Termite Gut	GRFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFFF*
JGI20166J26741_114454078	3300002175	Termite Gut	MFSVITNIYNKKIKGPTLMEFFTATGKMKKFFFF*
JGI20166J26741_114517621	3300002175	Termite Gut	MFSVITNIYDKKTKGPTLMEFFTATGKLKKFFFFDN*
JGI20166J26741_114644931	3300002175	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKYQCVPC
JGI20166J26741_114936034	3300002175	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFYD*
JGI20166J26741_118569521	3300002175	Termite Gut	MLSMITNIYNKKTKGPTLMEFFTATGKLKKSFLTTR
JGI20166J26741_121434411	3300002175	Termite Gut	MFYVITNINNKKIKGPTLMEFFTATGKLKKIFYN*
JGI20163J26743_103502041	3300002185	Termite Gut	MFYVITNIYNKKTKGPTLMNFFTATGKLKKVFFL*QL
JGI20163J26743_105249792	3300002185	Termite Gut	RFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKIF*
JGI20163J26743_105725511	3300002185	Termite Gut	MFSVITNIYNKKPKGPTFMELFTAIGKLKKFFFF*
JGI20163J26743_105815152	3300002185	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFFLL
JGI20163J26743_106142991	3300002185	Termite Gut	MFSVITNIHSKKTKGPTLMEFFTATGKLKKFFGNY
JGI20163J26743_106242721	3300002185	Termite Gut	MFSVITNIYDKKTKGPTLMEFFTATGKLKKVFFFF
JGI20163J26743_107411733	3300002185	Termite Gut	MFSMITNIYNKKSKGPTLKDFFTATGKLKKFFFFYN*
JGI20163J26743_107698511	3300002185	Termite Gut	FCVITNIYNKKTKGPNLMEFFTATGKLKKFFFGQV*
JGI20163J26743_107943031	3300002185	Termite Gut	MLFVITNIYNKKIKGPTLMEFFTATGKLKKFFFFY
JGI20163J26743_108232631	3300002185	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKVKKFFFFYN*
JGI20163J26743_108352943	3300002185	Termite Gut	MFSMITNIYNKKIKGPILMEMFTATGKLKKFFFFDN
JGI20163J26743_111196251	3300002185	Termite Gut	TGRFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFFF*
JGI20163J26743_111971261	3300002185	Termite Gut	MFSVITNIYNQKTKGPTLMEFFTATGKVKNIFFFLQLELFD
JGI20163J26743_112135142	3300002185	Termite Gut	MFSVITNIYNKKTKGPALMEFFTATGKMKKKKFLA
JGI20163J26743_112189283	3300002185	Termite Gut	MFSAITNVYNKKTKGPTLMEFFTATGKLKKLFFFLT
JGI20163J26743_112194701	3300002185	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFVDN*
JGI20163J26743_112858254	3300002185	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFLTTRDV
JGI20163J26743_113689471	3300002185	Termite Gut	TGRFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFL*
JGI20163J26743_113716763	3300002185	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFY
JGI20163J26743_114426561	3300002185	Termite Gut	MLSMITNIYNKKTKGPTLMEFFTATGKMKKFFFFF
JGI20163J26743_115196871	3300002185	Termite Gut	MLSMITNIYNKKPKGTTLMEFFTATGKLKKFFFFD
JGI20163J26743_115341619	3300002185	Termite Gut	MFSVITNIYDKKTKGPTLMELFTATGKLKKFFFDN*
JGI20169J29049_106073741	3300002238	Termite Gut	MFSMITNIYNKKYKGPTLMELFTAIGKLKKFFFFF
JGI24700J35501_104081222	3300002508	Termite Gut	MFSVITNIYNKTTKGPTLMEFFTAIGKLKKFFFFLIFDN*
JGI24700J35501_107477981	3300002508	Termite Gut	MMFFVITNIYNKQTKGPILMELFTATGKLKKFFFFFLTN*
JGI24700J35501_108514952	3300002508	Termite Gut	MYTGRFIMFSVITNIYNKKTKGPTLMEFFTATGKLKKFFL*
JGI24700J35501_108733511	3300002508	Termite Gut	MIHTGRFIMFFVITNIYNKKTKGPTLMEFFTATGKLKKFFFLT
JGI24700J35501_108823891	3300002508	Termite Gut	RFIMFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFDN*
Ga0099364_101251901	3300006226	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFLTTR
Ga0099364_101252648	3300006226	Termite Gut	MFSVITNIYKKKTKGPTLIELFTATGKLKKFFFDN*
Ga0099364_101466671	3300006226	Termite Gut	MFSVITNIYKKKTKGPTLMELFTATGKLKKFFFDN*
Ga0099364_101825866	3300006226	Termite Gut	IMFSVITNIYKTKTKGPTIMELFTATGKLKKFFFDN*
Ga0099364_102500841	3300006226	Termite Gut	MFSVITNIYNKKTKGPILMELFTATGKLKKFFCLTAR
Ga0099364_102641031	3300006226	Termite Gut	GRFIMFSVITNIYNKKTKGPTLMEFFTATGKLKKFF*
Ga0099364_104869751	3300006226	Termite Gut	MFSVITNFYNKKTKGPTIMDLFTATGKLKKFFFFYN
Ga0099364_105168541	3300006226	Termite Gut	MFSVFTNIYNKKAKGPIIMELFTATGKLKKFFFDN
Ga0099364_105384171	3300006226	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFF*QLEI
Ga0099364_105706821	3300006226	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFLTA
Ga0099364_106449192	3300006226	Termite Gut	MFFVITNIYNKKTEGPTLMELFTATGKLKKFFFFFLQKKRFDFLTP
Ga0099364_106580931	3300006226	Termite Gut	MFSVITNVYNKKTKGPTLMEFFTATGKLKKFFFDN*
Ga0099364_106593191	3300006226	Termite Gut	MFSVITNIYNKKTKGPTLTEFFTATGKLKKVFFLTTR
Ga0099364_106699651	3300006226	Termite Gut	FIKYSMITNIYDKKTIGPALMELFTAIGKLKKFFFDI*
Ga0099364_106876391	3300006226	Termite Gut	CFIMFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFDN*
Ga0099364_106886334	3300006226	Termite Gut	MFSVITNIYNKKTKGPTSMEFFTATGKLKKFFFDN*
Ga0099364_107429762	3300006226	Termite Gut	MFSVITNIYHKKTKGSTLMEFFTATGKLKKFFFF*
Ga0099364_108711341	3300006226	Termite Gut	MFSVITNIYNKKTKGPILMEFFTATGKLKKFFLTT
Ga0099364_108774091	3300006226	Termite Gut	MFYMITNIYNKKTKGPTLMEFFTTTRKLKKFFFLTT
Ga0099364_108946171	3300006226	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFLRLELS
Ga0099364_111539572	3300006226	Termite Gut	MFSLITNIYNKKPKGPTLMELFTAIGKLKKVFF*QLD
Ga0123357_100775174	3300009784	Termite Gut	MFSVITNIYNKQTKGPTLMELFTAIGKLKKFFFDN*
Ga0123355_107866001	3300009826	Termite Gut	MFYVITNIYNKKTKGPTLMEFFTDTGKLEKFFFFFFYN
Ga0123355_119355871	3300009826	Termite Gut	MFYMIKNIYNKKTKGPTLMELFTAAGKLKFFFFFF
Ga0123356_137461961	3300010049	Termite Gut	FSVIANIYNKKTKGPTLMELFTAIGKLKKFFFNN*
Ga0131853_100029737	3300010162	Termite Gut	MFSVITNIYNKKTNGPILMELFTATGKLKKFFFDN*
Ga0131853_100241164	3300010162	Termite Gut	MFSVITNIYNKKTKGPILMELFTATGRLKNIFFDN*
Ga0131853_100420232	3300010162	Termite Gut	MFSLITNIYNKKTKGPILTELFTATGKLKKFFFDK*
Ga0131853_101288901	3300010162	Termite Gut	MFTVITSIYDKKTKGPTLIELFQATGKLKKFFSQL*
Ga0131853_102689311	3300010162	Termite Gut	MFSVITNIYNKKTEGPTLMEFFTATGKLKKFFFDN*
Ga0131853_107221401	3300010162	Termite Gut	MFSVTTNIHNKKTKGTKGPTLMEFFTATGKMKRII
Ga0123353_115560001	3300010167	Termite Gut	MFSVTTNIHNKKTKGTKGPTLMEFFTATGKMKRIIF
Ga0136643_106860691	3300010369	Termite Gut	MFSEITNIYNKKTKGPALVELFTATGKLKKFFFDN*
Ga0123354_102147651	3300010882	Termite Gut	MFSVITIIYNKKTKGPTLMELFTATGKLKKVFFLQ
Ga0209531_100597721	3300027558	Termite Gut	MFSVITNIYNKKTKGPTLMELFTATGILKKFFFDNGR
Ga0209531_101150402	3300027558	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFD
Ga0209531_101835751	3300027558	Termite Gut	MFSAITNIYNKKTKVPTLMELFTATGKLKKVFFXQLEN
Ga0209531_102095571	3300027558	Termite Gut	MFPVITNIYSYNKKTKGPTLMEFFTATGKLNKFFF
Ga0209531_102420061	3300027558	Termite Gut	MSSVITNIYNKKTEGPILMELFTATGKLKKFFFFF
Ga0209531_103424722	3300027558	Termite Gut	MFSVITNIYNKKTKGPTLMEFFIATGKLKKSFLTTRDVR
Ga0209423_105905601	3300027670	Termite Gut	MFFVIANCYKQKTKGPTLMELFTATGKLKKCVFFFF
Ga0209755_100117461	3300027864	Termite Gut	MLSVITNIYNKKTKGPILMELFTTTGKLKKFFLFFDS
Ga0209755_100664302	3300027864	Termite Gut	MFSVSRNIYNKKTKGHNLMEFFTATGKLKKVFFDN
Ga0209755_106781571	3300027864	Termite Gut	MSSVIKNIYNKKTKGPNVMELFISTGKLKKVFFFGGG
Ga0209628_100365923	3300027891	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFFLLEIVNVC
Ga0209628_100445821	3300027891	Termite Gut	MMFSVITNIYNKKIKGPTLMEFFTATGKMKKFFFLTTRD
Ga0209628_100627331	3300027891	Termite Gut	MFSVITNIYDKKTKGPTLMELFTATGKLKKFFFDN
Ga0209628_100697902	3300027891	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTTKTEKVFFKQLE
Ga0209628_101086513	3300027891	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFFWQLQMF
Ga0209628_101123252	3300027891	Termite Gut	MFSVITNIYNKKTKGPTLMELFTATKKLKKFFFFYN
Ga0209628_101670351	3300027891	Termite Gut	GRFIMFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFFF
Ga0209628_102706811	3300027891	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFVXQIG
Ga0209628_102922891	3300027891	Termite Gut	MFSVIANIYNKKTKGPTLMEFFTATGKLKKFFFVTTG
Ga0209628_104063581	3300027891	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTAIGKLKKFFFFXQ
Ga0209628_106226741	3300027891	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFFXQLEM
Ga0209628_109520991	3300027891	Termite Gut	MFSVITNIYDKKTKGPTLMEFFTATGKLKRVFFFF
Ga0209737_100370311	3300027904	Termite Gut	MLSVIKNIYNKKTKGPALMEFFTATGKLKKFFFDN
Ga0209737_100668531	3300027904	Termite Gut	MLSMITNIYNKKPKGTTLMEFFTATGKLKKFFFFY
Ga0209737_100905881	3300027904	Termite Gut	MFSVITNIYNKKTKGTTLMEFFTATGKLKKILFHNYS
Ga0209737_101215684	3300027904	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFFXQLETFD
Ga0209737_102685183	3300027904	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATEKTEKVFFFDN
Ga0209737_103773992	3300027904	Termite Gut	MFFVITNIYNKKTKGPTLMEFFTATGKLKKFFFXQ
Ga0209737_105107851	3300027904	Termite Gut	MFSMITNIYDKKTKGPTLMELFTATGKLKKFFLTT
Ga0209737_105214901	3300027904	Termite Gut	MFSVITNIHNKKIKGPTVMELFTATGKLKKFFFDKWG
Ga0209737_106471481	3300027904	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFLTT
Ga0209737_108285182	3300027904	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFGNRVV
Ga0209737_110707851	3300027904	Termite Gut	MFSVITNIYNNKNKGPILMELFTATGKLKKFFFFF
Ga0209737_111535931	3300027904	Termite Gut	MFSVITNIHNKKTKGPTLMEFFTATGKLKKFFFLLSF
Ga0209737_111806751	3300027904	Termite Gut	MFSMITNIYNKKTKGPTLMEFFTATGKLKKFFFLLEIVNV
Ga0209737_112267761	3300027904	Termite Gut	SEKHQVIYNKKTKGPTLMGLFTATGKLKKFFFFDN
Ga0209737_113260681	3300027904	Termite Gut	MFSMITNIYNKKTKGPNLIEFFTATGKLKKFFFLGGG
Ga0209629_100171636	3300027984	Termite Gut	MFSMITKIYNKKTKGPTLMEFFTATGKLKKFFFFXQLEM
Ga0209629_100569495	3300027984	Termite Gut	VITKVYNKKIKGPTLMEFFTATGKLKKFFFSQLEMF
Ga0209629_101002691	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKLFCLT
Ga0209629_101297266	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFDN
Ga0209629_102956281	3300027984	Termite Gut	MFSVITNIYDKKTKGPTLMEFFTATGKLKKFFFFDN
Ga0209629_103110251	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTAQENXKSFFFLDN
Ga0209629_103931191	3300027984	Termite Gut	MFPVITNIYNKKTKGPTLMEFFTATGKLKKFFFDN
Ga0209629_104079971	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKFFFLQLE
Ga0209629_104732181	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTATGKLKKLFFLTNR
Ga0209629_104949571	3300027984	Termite Gut	MFSVITNIYNKKTKGPILMEFFTATGKLKKFFFLQLEMLD
Ga0209629_105259351	3300027984	Termite Gut	MFSVNKNIYNKKTKGPTLMEFFTATGKLKKVFFGGGG
Ga0209629_107355231	3300027984	Termite Gut	MFSVITNIYNMKTKGPTLMEFFTATGKLKKFYLFIFF
Ga0209629_107903451	3300027984	Termite Gut	MFSMITKIYNKRSKGPTVMELFTATGKLKKFFFFST
Ga0209629_108062781	3300027984	Termite Gut	MFSVITNIYNKKSKGPTLMELFTATGKLKKFFFFD
Ga0209629_108385291	3300027984	Termite Gut	MFSVITNIYSKKIKGPNLMEFFTATGKLKKVFFFYN
Ga0209629_109628941	3300027984	Termite Gut	MFSVITNIYNKKTKGPTLMEFFTAIGKLKKSKSQGLK
Ga0268261_100415982	3300028325	Termite Gut	MFSVITNIYNKKTKGPTLMELFTATGKLNKVVFDN
Ga0268262_104923911	3300028327	Termite Gut	MFSVITNIYDKKTKGPTLMGLFTVTRKLKKKSFFFYY

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F042402

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001544	Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1	Host-Associated	Open in IMG/M
3300002125	Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4	Host-Associated	Open in IMG/M
3300002127	Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3	Host-Associated	Open in IMG/M
3300002175	Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5	Host-Associated	Open in IMG/M
3300002185	Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1	Host-Associated	Open in IMG/M
3300002238	Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1	Host-Associated	Open in IMG/M
3300002508	Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1	Host-Associated	Open in IMG/M
3300006226	Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3	Host-Associated	Open in IMG/M
3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Host-Associated	Open in IMG/M
3300010369	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)	Host-Associated	Open in IMG/M
3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Host-Associated	Open in IMG/M
3300027558	Cubitermes ugandensis crop segment gut microbial communities from Kakamega Forest, Kenya - Cu122C (SPAdes)	Host-Associated	Open in IMG/M
3300027670	Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes)	Host-Associated	Open in IMG/M
3300027864	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes)	Host-Associated	Open in IMG/M
3300027891	Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes)	Host-Associated	Open in IMG/M
3300027904	Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes)	Host-Associated	Open in IMG/M
3300027984	Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes)	Host-Associated	Open in IMG/M
3300028325	Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1 (SPAdes)	Host-Associated	Open in IMG/M
3300028327	Nasutitermes corniger P3 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P3 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign