NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042483

Metagenome / Metatranscriptome Family F042483

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042483
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 41 residues
Representative Sequence GGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKGA
Number of Associated Samples 132
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.73 %
% of genes from short scaffolds (< 2000 bps) 84.81 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.367 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.886 % of family members)
Environment Ontology (ENVO) Unclassified
(32.278 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.165 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF13654AAA_32 79.75
PF03551PadR 2.53
PF00106adh_short 0.63
PF01594AI-2E_transport 0.63
PF13091PLDc_2 0.63
PF14489QueF 0.63
PF05362Lon_C 0.63
PF04397LytTR 0.63
PF13646HEAT_2 0.63
PF12704MacB_PCD 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.53
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.53
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.53
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.63
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.63
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.63
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.63
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.63

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.37 %
UnclassifiedrootN/A0.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10935131All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300004082|Ga0062384_100150553All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300004091|Ga0062387_100267398All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300004633|Ga0066395_10399489All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300004635|Ga0062388_100194170All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300004635|Ga0062388_100741312All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300005178|Ga0066688_10509099All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005340|Ga0070689_101699530All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005434|Ga0070709_10985078All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005548|Ga0070665_102595748All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005574|Ga0066694_10420819All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005610|Ga0070763_10862940All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006174|Ga0075014_100607238All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006176|Ga0070765_100579490All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300006354|Ga0075021_10813546All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006358|Ga0068871_102359078All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006755|Ga0079222_11362726All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300006797|Ga0066659_11496906All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300006804|Ga0079221_10067107All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300006854|Ga0075425_101234734All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006893|Ga0073928_10120544All Organisms → cellular organisms → Bacteria → Acidobacteria2162Open in IMG/M
3300007076|Ga0075435_100235220All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300007265|Ga0099794_10078912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1622Open in IMG/M
3300009038|Ga0099829_10954299All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300009090|Ga0099827_11484352All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300009101|Ga0105247_11011894All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300009162|Ga0075423_10157563All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300009174|Ga0105241_11821627All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009174|Ga0105241_12546860All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009545|Ga0105237_10980788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300010043|Ga0126380_10492600All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300010043|Ga0126380_11192644All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300010360|Ga0126372_11956423All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010361|Ga0126378_10153719All Organisms → cellular organisms → Bacteria2345Open in IMG/M
3300010361|Ga0126378_13068959All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010362|Ga0126377_13346676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010376|Ga0126381_100061394All Organisms → cellular organisms → Bacteria → Acidobacteria4648Open in IMG/M
3300010376|Ga0126381_104465334All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300011120|Ga0150983_15728617All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300011269|Ga0137392_10406487All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300012205|Ga0137362_11038061All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012205|Ga0137362_11589728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300012207|Ga0137381_10048714All Organisms → cellular organisms → Bacteria3493Open in IMG/M
3300012356|Ga0137371_11328448All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012685|Ga0137397_10022629All Organisms → cellular organisms → Bacteria → Acidobacteria4433Open in IMG/M
3300012917|Ga0137395_10021000All Organisms → cellular organisms → Bacteria3798Open in IMG/M
3300012923|Ga0137359_10038191All Organisms → cellular organisms → Bacteria4148Open in IMG/M
3300012927|Ga0137416_11888643All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012944|Ga0137410_11592778All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300012948|Ga0126375_10767164All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012971|Ga0126369_10560828All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300012971|Ga0126369_12174266All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300012971|Ga0126369_12921188All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300014159|Ga0181530_10031409All Organisms → cellular organisms → Bacteria3776Open in IMG/M
3300014166|Ga0134079_10286434All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300014501|Ga0182024_12348799Not Available579Open in IMG/M
3300015054|Ga0137420_1205251All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300015082|Ga0167662_1043779All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300015374|Ga0132255_100148428All Organisms → cellular organisms → Bacteria3265Open in IMG/M
3300016270|Ga0182036_10468849All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300016294|Ga0182041_10913159All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300016319|Ga0182033_10487905All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300016357|Ga0182032_10665622All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300017972|Ga0187781_11160065All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300018033|Ga0187867_10079345All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300018034|Ga0187863_10842396All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300019361|Ga0173482_10451391All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300020170|Ga0179594_10308785All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300020579|Ga0210407_10595642All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300020579|Ga0210407_10708126All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300020579|Ga0210407_10719807All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300020580|Ga0210403_11328734All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300020581|Ga0210399_10044241All Organisms → cellular organisms → Bacteria → Acidobacteria3570Open in IMG/M
3300020583|Ga0210401_11254723All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021168|Ga0210406_10977841All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021170|Ga0210400_10515044All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300021180|Ga0210396_11491720All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300021403|Ga0210397_11566650All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300021405|Ga0210387_10820119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300021405|Ga0210387_11054460All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300021406|Ga0210386_10750016All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300021406|Ga0210386_11611243All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300021407|Ga0210383_10140522All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300021407|Ga0210383_10489495All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300021433|Ga0210391_10098174All Organisms → cellular organisms → Bacteria2309Open in IMG/M
3300021474|Ga0210390_10035279All Organisms → cellular organisms → Bacteria → Acidobacteria4085Open in IMG/M
3300021474|Ga0210390_10708259All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300021475|Ga0210392_10108281All Organisms → cellular organisms → Bacteria1841Open in IMG/M
3300021477|Ga0210398_10885016All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300021479|Ga0210410_10009037All Organisms → cellular organisms → Bacteria8599Open in IMG/M
3300021560|Ga0126371_10062199All Organisms → cellular organisms → Bacteria3605Open in IMG/M
3300024249|Ga0247676_1007923All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300024288|Ga0179589_10332026All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025439|Ga0208323_1049282All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300025911|Ga0207654_11332979All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300025915|Ga0207693_10815792All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300026078|Ga0207702_11204119All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300026215|Ga0209849_1015055All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300026320|Ga0209131_1320209All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300026482|Ga0257172_1087012All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300026551|Ga0209648_10294931All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300026557|Ga0179587_10285234All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300026557|Ga0179587_10434959All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300026557|Ga0179587_10473649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300026557|Ga0179587_10873532All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300026557|Ga0179587_10916829All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300027035|Ga0207776_1022331All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300027071|Ga0209214_1002918All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300027629|Ga0209422_1063040All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300027671|Ga0209588_1204161All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300027725|Ga0209178_1392860All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027775|Ga0209177_10172693All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300027812|Ga0209656_10107891All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300027812|Ga0209656_10187876All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300027842|Ga0209580_10595066All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027846|Ga0209180_10242717All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300027874|Ga0209465_10332663All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300027908|Ga0209006_10975281All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300028536|Ga0137415_10040472All Organisms → cellular organisms → Bacteria → Acidobacteria4558Open in IMG/M
3300028536|Ga0137415_10080540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3116Open in IMG/M
3300028746|Ga0302233_10034070All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300028789|Ga0302232_10492141All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300028906|Ga0308309_10676121All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300029636|Ga0222749_10154272All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300031057|Ga0170834_112256373All Organisms → cellular organisms → Bacteria1314Open in IMG/M
(restricted) 3300031150|Ga0255311_1062242All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300031446|Ga0170820_12816346All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031469|Ga0170819_15725543All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300031546|Ga0318538_10391305All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031564|Ga0318573_10595287All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031679|Ga0318561_10430101All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300031708|Ga0310686_117896322All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031718|Ga0307474_10943940All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300031719|Ga0306917_11023509All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031740|Ga0307468_102382278All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031744|Ga0306918_10835216All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300031753|Ga0307477_10345546All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300031754|Ga0307475_10180507All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300031754|Ga0307475_10387803All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300031754|Ga0307475_11184025All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031768|Ga0318509_10442852All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300031799|Ga0318565_10110565All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300031820|Ga0307473_10191597All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300031820|Ga0307473_10386804All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300031890|Ga0306925_10090858All Organisms → cellular organisms → Bacteria → Acidobacteria3242Open in IMG/M
3300031910|Ga0306923_10148464All Organisms → cellular organisms → Bacteria → Acidobacteria2675Open in IMG/M
3300031910|Ga0306923_11002247All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031910|Ga0306923_12262624All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031962|Ga0307479_11831504All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300032001|Ga0306922_10031222All Organisms → cellular organisms → Bacteria5419Open in IMG/M
3300032009|Ga0318563_10711633All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032025|Ga0318507_10157016All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300032059|Ga0318533_10321617All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300032180|Ga0307471_101692851All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300032180|Ga0307471_102159342All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300032205|Ga0307472_100066957All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300032782|Ga0335082_10831548All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300032955|Ga0335076_10159158All Organisms → cellular organisms → Bacteria2171Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.53%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.27%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.27%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.63%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.63%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.63%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1093513113300004080Bog Forest SoilGLEVFGLLGLVAGPTIVAAAMGVFRVYQDRRDEMTAQEL*
Ga0062384_10015055313300004082Bog Forest SoilFIGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAARAS*
Ga0062387_10026739813300004091Bog Forest SoilGGLEVFGLLGLVAGPTILAAALGVFRVYTEHRDEIEREAA*
Ga0066395_1039948913300004633Tropical Forest SoilGGIKIFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEVASA*
Ga0062388_10019417013300004635Bog Forest SoilGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAATEP*
Ga0062388_10074131213300004635Bog Forest SoilGLEVFGLLGLVAGPTIVAAAMGVFRVYQDRRDEMTAQES*
Ga0066688_1050909913300005178SoilLLFVSVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDDLETARV*
Ga0070689_10169953023300005340Switchgrass RhizosphereVLGGIKVFGLLGIVAGPTIVAAAMGVFRVYMDHRDRVEASQA*
Ga0070709_1098507813300005434Corn, Switchgrass And Miscanthus RhizosphereVLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMDHRDQVAARET*
Ga0070665_10259574823300005548Switchgrass RhizosphereFGLLGIVAGPTIVAAAMGVFRVYMDHRDRVEASQA*
Ga0066694_1042081923300005574SoilGIEVFGLLGLVAGPTILAAAMGVFRVYMQHRDELEAAQV*
Ga0070763_1086294023300005610SoilQVFGLLGLVAGPTIVAAALGVFRVYMQHRDELEGANA*
Ga0075014_10060723813300006174WatershedsSILGGLDVFGLLGLILGPTIVAAALGVLRVHMEHQEELQREQA*
Ga0070765_10057949033300006176SoilGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA*
Ga0075021_1081354623300006354WatershedsLGLVAGPTIVAAAMGVFRVYMDHRDEIAASSAAKTG*
Ga0068871_10235907823300006358Miscanthus RhizosphereGLDAFGLLGLVVGPTIVAAALGVFRVYMEHRERLERATA*
Ga0079222_1136272623300006755Agricultural SoilVSVLGGLHLFGLLGLVIGPTIIAAALAVYRVYMERRDQLQDLAA*
Ga0066659_1149690613300006797SoilVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA*
Ga0079221_1006710723300006804Agricultural SoilQVFGLLGLVIGPTIIAAALAVYRVYMERRDQLEDSAA*
Ga0075425_10123473423300006854Populus RhizosphereFISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMEHRDKVEAAQA*
Ga0073928_1012054453300006893Iron-Sulfur Acid SpringEVFGLLGLVAGPTIIAAAMGIFRVYMDRRDAMVAPEA*
Ga0075435_10023522023300007076Populus RhizosphereFVSVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA*
Ga0099794_1007891213300007265Vadose Zone SoilGLLGLVIGPTIVAAAMGVFRVYVEHRDGMPAAVA*
Ga0099829_1095429923300009038Vadose Zone SoilLGGLQTFGLLGLVIGPTIVAAAMGVFRVYAEHRDRQAALPA*
Ga0099827_1148435223300009090Vadose Zone SoilGGISLFGLLGLVAGPAIIAAAMGIFRVYMEHREPQAATSA*
Ga0105247_1101189413300009101Switchgrass RhizosphereLLFISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA*
Ga0075423_1015756313300009162Populus RhizosphereIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDKVEAAQA*
Ga0105241_1182162723300009174Corn RhizosphereFISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA*
Ga0105241_1254686013300009174Corn RhizosphereIEVFGLLGIVAGPTVVAAAMGVFRVYMDHRDRAEASQA*
Ga0105237_1098078823300009545Corn RhizosphereGLLGLVAGPTIVAAAMGVFRVYMDRRDAVTTQEA*
Ga0126380_1049260013300010043Tropical Forest SoilIEVFGLLGLVAGPTVLAAAMGVFRVYMEHRDRIEQARA*
Ga0126380_1119264423300010043Tropical Forest SoilFISVLGGLEVFGLLGLVAGPTIVAAAMGIFRVYMDHRDEIAASEPVKSG*
Ga0126372_1195642323300010360Tropical Forest SoilGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEGAGA*
Ga0126378_1015371913300010361Tropical Forest SoilVFGLLGIVAGPTIVAAAMGVFRVYMDHRDRMVEASQA*
Ga0126378_1306895913300010361Tropical Forest SoilGIEVFGLLGLVAGPTVVAAAMGVFRVYMEHRDRLEESSA*
Ga0126377_1334667623300010362Tropical Forest SoilFIGVLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMDHRDQIARREA*
Ga0126381_10006139413300010376Tropical Forest SoilGIAVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA*
Ga0126381_10446533413300010376Tropical Forest SoilFGLLGLVAGPTIVAAAMGIFRVYTEHRDRLEEIRA*
Ga0150983_1572861723300011120Forest SoilAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELATKGA*
Ga0137392_1040648723300011269Vadose Zone SoilLGGIEVFGLLGLVAGPTILAAAMGIFRVYTHHREHLEAVRA*
Ga0137362_1103806123300012205Vadose Zone SoilFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA*
Ga0137362_1158972823300012205Vadose Zone SoilGLQAFGLLGLVAGPTIVAAAMGVFRVYMEHRDEMSAKGA*
Ga0137381_1004871433300012207Vadose Zone SoilLFVSVLGGISLFGLLGLVAGPAIVAAAMGIFRVYMEHREPQAATSA*
Ga0137371_1132844823300012356Vadose Zone SoilEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVRA*
Ga0137397_1002262943300012685Vadose Zone SoilNELLLFISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDELEAAQL*
Ga0137395_1002100043300012917Vadose Zone SoilVFGLMGIVAGPTIMAAAMGVFRVYMEHRDELEEARA*
Ga0137359_1003819143300012923Vadose Zone SoilGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRVAATVT*
Ga0137416_1188864313300012927Vadose Zone SoilGLEVFGLLGLVIGPPILAAAMGVFRVYVEHRDRVAATAT*
Ga0137410_1159277823300012944Vadose Zone SoilGGLQTFGLLGLVIGPTIVAAAMGVFRVYAEHRDRQAALAA*
Ga0126375_1076716423300012948Tropical Forest SoilISVVGGIAVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA*
Ga0126369_1056082813300012971Tropical Forest SoilGIQVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA*
Ga0126369_1217426623300012971Tropical Forest SoilFISVLGGIQVFGLLGLVAGPTILAAAMGVFRIYMEHRDQIEATEA*
Ga0126369_1292118823300012971Tropical Forest SoilGGIQVFGLLGLVAGPTIVAAAMGVFRVYMEHRDQVEASQA*
Ga0181530_1003140913300014159BogSILGGLDVFGLLGLVAGPTIMAAALGVFRVYMVHREKMEKELRN*
Ga0134079_1028643423300014166Grasslands SoilEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDDLETARV*
Ga0182024_1234879923300014501PermafrostLEVFGLLGLVAGPTIVAAAMGIFRVYMDRRDAMTAQES*
Ga0137420_120525113300015054Vadose Zone SoilFGLLGLVIGPTIVAAAMGVFRVYMDHRDREAALPA*
Ga0167662_104377923300015082Glacier Forefield SoilSVLGGIEVFGLLGLVAGPTILAAAMGVFRVYTQHRDELEAASG*
Ga0132255_10014842833300015374Arabidopsis RhizosphereLLLFISVLGGIQVFGLLGLVAGPTILAAAMGVFRVYMDHRDKVEAAQG*
Ga0182036_1046884913300016270SoilLNDLLLFISILGGLDAFGLLGLVVGPTIVAAALGVFRVYMEHRERLEQATA
Ga0182041_1091315923300016294SoilQVFGLLGLVVGPTIVAAALGVFRVYTEHREELEGVNV
Ga0182033_1048790513300016319SoilGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA
Ga0182032_1066562213300016357SoilGGIEVFGLLGLVAGPTIVAAAMGIFRVYMEHRDRLGEIGA
Ga0187781_1116006513300017972Tropical PeatlandGGLGAFGLLGLVAGPTILAAALAVFRVHMEHRDRLEKESA
Ga0187867_1007934523300018033PeatlandLFISILGGLDVFGLLGLVAGPTIMAAALGVFRVYMVHREKMEKELRN
Ga0187863_1084239613300018034PeatlandEMFGLLGLVAGPTIVAAALGVFRVYMANRDELASGPKVGG
Ga0173482_1045139123300019361SoilVLGGIEVFGLLGIVAGPTVVAAAMGVFRVYMDRRDRAETSQA
Ga0179594_1030878513300020170Vadose Zone SoilGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMTMPEA
Ga0210407_1059564213300020579SoilLFIGVLGGLEVFGLLGIVAGPTIVAAAMGVFRVYMDRRDAMVTPEA
Ga0210407_1070812623300020579SoilELLLFISVLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDHRDEIAAKEA
Ga0210407_1071980713300020579SoilFISILGGLQVFGLLGLVAGPTIVAAALGVFRVYMEHRDELDGADA
Ga0210403_1132873413300020580SoilFIGVLGGLEVFGLLGLVAGPTIVAAAMGIFRVYMDRRDAMATAQA
Ga0210399_1004424133300020581SoilILGGLQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA
Ga0210401_1125472323300020583SoilFISILGGLEVFGLLGLVAGPIIVAAALGVFRVYMEHRDELDGADA
Ga0210406_1097784113300021168SoilGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRQAALSA
Ga0210400_1051504413300021170SoilDFGLLGLVAGPTIVAAALGVFRVYMEHRDELDAANA
Ga0210396_1149172023300021180SoilLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMAAPAA
Ga0210397_1156665023300021403SoilNDLLLFISILGGLDVFGLLGLVAGPTIVAAALGVFQVYMNSRDETERKREPVEGKA
Ga0210387_1082011913300021405SoilIGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKDA
Ga0210387_1105446023300021405SoilLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDGLASKNA
Ga0210386_1075001623300021406SoilVLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA
Ga0210386_1161124323300021406SoilGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA
Ga0210383_1014052223300021407SoilLGGLEVFGLLGLVAGPTILAAALGVFRVYTEHRDEIEREAA
Ga0210383_1048949533300021407SoilNELLLFIGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMDRRDAVATQE
Ga0210391_1009817413300021433SoilVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDALAAKGT
Ga0210390_1003527943300021474SoilLQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA
Ga0210390_1070825913300021474SoilVLGGLEVFGLLGLVAGPTIIAAAMGIFRVYMERRDAMVAPDA
Ga0210392_1010828123300021475SoilNDLLLFIGVIGGLEVFGLVGLVAGPTIVAAAVGVFRVHMERREGLAAPPA
Ga0210398_1088501623300021477SoilGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKGA
Ga0210410_1000903713300021479SoilISILGGLQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA
Ga0126371_1006219933300021560Tropical Forest SoilLLLFISILGGLDAFGLLGLVVGPTVVAAALGVFRVYMERREQQAVVENQVA
Ga0247676_100792323300024249SoilRGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRGELEESNA
Ga0179589_1033202613300024288Vadose Zone SoilSILGGLQVFGLLGLVAGPTIVAAALGVFRVYTQHRDERDEANA
Ga0208323_104928213300025439PeatlandDLLLFISILGGLEAFGLLGLVAGPTILAAAMGVFRVYMEHREQMEKEAA
Ga0207654_1133297913300025911Corn RhizosphereSVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA
Ga0207693_1081579223300025915Corn, Switchgrass And Miscanthus RhizosphereIEVFGLLGLVAGPTILAAAMGIFRVYTQHRDNLEAARA
Ga0207702_1120411913300026078Corn RhizosphereELLLFIGVLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMEHRDRIAREA
Ga0209849_101505513300026215SoilFGLLGLVVGPAIVAAAMGVFRVHMLHREDVAAARMSPGASI
Ga0209131_132020913300026320Grasslands SoilGGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGAGA
Ga0257172_108701213300026482SoilFISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMERRDELAPTSA
Ga0209648_1029493113300026551Grasslands SoilLFISILGGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGAGA
Ga0179587_1028523413300026557Vadose Zone SoilNELLLFIGVLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMTMPEA
Ga0179587_1043495923300026557Vadose Zone SoilQVFGLLGLVAGPTIVAAALGVFQVYMEHRDELEGAKA
Ga0179587_1047364913300026557Vadose Zone SoilGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVGA
Ga0179587_1087353213300026557Vadose Zone SoilGVIGGLEAFGLLGLVAGPTIVAAAMGVFRVYMDRNEGRTSRAAPA
Ga0179587_1091682923300026557Vadose Zone SoilLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVRA
Ga0207776_102233123300027035Tropical Forest SoilFGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA
Ga0209214_100291823300027071Forest SoilLKVFGLLGLVIGPTVVAAALGVFRVYMESRERQETEQA
Ga0209422_106304023300027629Forest SoilQVFGLLGLVAGPTIVAAALGVFRVYMEHRDELDVANV
Ga0209588_120416113300027671Vadose Zone SoilVFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGADA
Ga0209178_139286023300027725Agricultural SoilFGLLGLVIGPTIVAAAMGVFRVYVDHRDRQAAVAA
Ga0209177_1017269323300027775Agricultural SoilVLGGLQVFGLLGLVIGPTIIAAALAVYRVYMERRDQLEDSAA
Ga0209656_1010789123300027812Bog Forest SoilVFGLLGLVAGPTILAAALGVFRVYMQHREKLEARERLLELKA
Ga0209656_1018787613300027812Bog Forest SoilEVFGLLGLVAGPTILAAAMGVFRVYMDRRDEMLASGP
Ga0209580_1059506623300027842Surface SoilVLGGLGAFGLLGLVAGPTIIAAAMGVFRVYMDHRDALVIRKA
Ga0209180_1024271713300027846Vadose Zone SoilNELLLFISVVGGIEVFGLLGLVAGPTIVAAAMGVFRVYMEHRDELASTSAVPTI
Ga0209465_1033266313300027874Tropical Forest SoilTFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEVASA
Ga0209006_1097528113300027908Forest SoilLGGLQVFGLLGLVAGPIIVAAALGVFRVYMEHRDELDGANA
Ga0137415_1004047243300028536Vadose Zone SoilLFLGVLGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDTQAALPT
Ga0137415_1008054033300028536Vadose Zone SoilLFLGVLGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRVAATVT
Ga0302233_1003407023300028746PalsaGGIEVFGLLGLVAGPTILAAAMGVFRVYMDRRDELLAAAPDDP
Ga0302232_1049214123300028789PalsaGIEVFGLLGLVAGPTILAAAMGVFRVYMDRRDELLAAAPDDP
Ga0308309_1067612113300028906SoilEVFGLVGLVAGPTIVAAAVGVFRVHMERREGLAAPPA
Ga0222749_1015427233300029636SoilGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAGKGA
Ga0170834_11225637313300031057Forest SoilVFGLLGLVAGPTIVAAAMGVFRVYMQHRDELEAAQS
(restricted) Ga0255311_106224213300031150Sandy SoilLLFISILGGLQAFGLLGLVVGPTVVAAALGVFRVYMEHREAVEEGAA
Ga0170820_1281634623300031446Forest SoilFISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDEIENARV
Ga0170819_1572554313300031469Forest SoilLLFISILGGLDAFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA
Ga0318538_1039130513300031546SoilFISVLGGIQVFGLLGLVAGPTIVAGAMAIFRVYMERRDRLEETGA
Ga0318573_1059528723300031564SoilFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA
Ga0318561_1043010113300031679SoilLGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA
Ga0310686_11789632223300031708SoilGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKEA
Ga0307474_1094394023300031718Hardwood Forest SoilGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAVATQEA
Ga0306917_1102350913300031719SoilLSILGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA
Ga0307468_10238227823300031740Hardwood Forest SoilAFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA
Ga0306918_1083521623300031744SoilISVLGGIQVFGLLGLVAGPTIVAGAMAIFRVYMERRDRLEETGA
Ga0307477_1034554613300031753Hardwood Forest SoilQVFGLLGLVIGPTIVAAAMGVFRVYVEHRDREAALPT
Ga0307475_1018050713300031754Hardwood Forest SoilVFGLLGLVAGPTIVAAAMGVFRVYMERRDELAAPG
Ga0307475_1038780323300031754Hardwood Forest SoilGVLGGLEVFGLLGLVIGPAILAAAMGVFRVYAGHRDRQAALPA
Ga0307475_1118402513300031754Hardwood Forest SoilFGLLGLVIGPTIVAAAMGVFRVYVEHRDTEAALPT
Ga0318509_1044285213300031768SoilIQVFGLLGLVAGPTIVAAGMGIFRVYMEHRDRLEEIGG
Ga0318565_1011056513300031799SoilLGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA
Ga0307473_1019159733300031820Hardwood Forest SoilGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAEA
Ga0307473_1038680413300031820Hardwood Forest SoilFGLLGLVAGPTIVAAALGVFRVYMEHRDELDAAKA
Ga0306925_1009085833300031890SoilISVLGGIAFFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA
Ga0306923_1014846413300031910SoilSVLGGIQVFGLLGLVAGPTIVAAGMGIFRVYMEHRDRLEEIGG
Ga0306923_1100224723300031910SoilGIEVFGLLGLVAGPTIVAAAMGIFRVYMEHRDRLGEIGA
Ga0306923_1226262423300031910SoilLGGLGAFGLLGLVAGPTITAAALAVFRVYMERRERLERATA
Ga0307479_1183150413300031962Hardwood Forest SoilFISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMLHRDELEAAQS
Ga0306922_1003122253300032001SoilFGLLGLVAGPTVLAAALGVLRVHMEHREQLERGTA
Ga0318563_1071163313300032009SoilLFISVLGGIAFFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA
Ga0318507_1015701623300032025SoilQVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA
Ga0318533_1032161723300032059SoilFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEPA
Ga0307471_10169285123300032180Hardwood Forest SoilSVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAEA
Ga0307471_10215934213300032180Hardwood Forest SoilLLFISVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAKV
Ga0307472_10006695723300032205Hardwood Forest SoilILGGLNAFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA
Ga0335082_1083154823300032782SoilLLFLSILGGLDVFGLLGLVAGPIIVAAGLGVFRVYTQRMDEVEAAES
Ga0335076_1015915833300032955SoilGVLGGLGAFGLLGLVMGPTVIAAAMGVFRVYMDHRDALAARKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.