Metagenome / Metatranscriptome Family F042542

Basic Information
Family ID	F042542
Family Type	Metagenome / Metatranscriptome
Number of Sequences	158
Average Sequence Length	40 residues
Representative Sequence	LEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Number of Associated Samples	134
Number of Associated Scaffolds	158

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	26.97 %
% of genes near scaffold ends (potentially truncated)	54.43 %
% of genes from short scaffolds (< 2000 bps)	85.44 %
Associated GOLD sequencing projects	127
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.21

Most Common Taxonomy
Group	Bacteria (94.304 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.557 % of family members)
Environment Ontology (ENVO)	Unclassified (25.949 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.633 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 158 Family Scaffolds
PF12706	Lactamase_B_2	45.57
PF08042	PqqA	5.06
PF14588	YjgF_endoribonc	3.80
PF00496	SBP_bac_5	2.53
PF04173	DoxD	2.53
PF03070	TENA_THI-4	2.53
PF05402	PqqD	1.27
PF03950	tRNA-synt_1c_C	1.27
PF07681	DoxX	1.27
PF13186	SPASM	1.27
PF13360	PQQ_2	1.27
PF07995	GSDH	1.27
PF10282	Lactonase	1.27
PF13442	Cytochrome_CBB3	1.27
PF01613	Flavin_Reduct	0.63
PF14026	DUF4242	0.63
PF03773	ArsP_1	0.63
PF00497	SBP_bac_3	0.63
PF00149	Metallophos	0.63
PF04055	Radical_SAM	0.63
PF13948	DUF4215	0.63
PF00296	Bac_luciferase	0.63
PF01261	AP_endonuc_2	0.63
PF13683	rve_3	0.63

COG ID	Name	Functional Category	% Frequency in 158 Family Scaffolds
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	3.80
COG0008	Glutamyl- or glutaminyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	1.27
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	1.27
COG4270	Uncharacterized membrane protein	Function unknown [S]	1.27
COG0701	Uncharacterized membrane protein YraQ, UPF0718 family	Function unknown [S]	0.63
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.63
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.63

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.30 %
Unclassified	root	N/A	5.70 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.30 %
Unclassified	root	N/A	5.70 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.30 %
Unclassified	root	N/A	5.70 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	32.91 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	8.86 %
Unclassified	root	N/A	5.70 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.63 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	19.62 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	8.86 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	8.23 %
Unclassified	root	N/A	5.70 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.27 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.63 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.63 %

Name	Rank	Taxonomy	Distribution
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	18.99 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	8.86 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	8.23 %
Unclassified	root	N/A	5.70 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.27 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.63 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae	14.56 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	8.86 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	8.23 %
Unclassified	root	N/A	5.70 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.27 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea	14.56 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.86 %
unclassified Sinobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae	8.23 %
Unclassified	root	N/A	5.70 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	1.27 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.63 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	14.56 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.86 %
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	8.23 %
Unclassified	root	N/A	5.70 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	1.27 %
Candidatus Nitrospira nitrificans	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrificans	0.63 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	14.56 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.86 %
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	8.23 %
Unclassified	root	N/A	5.70 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	1.27 %
Candidatus Nitrospira nitrificans	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrificans	0.63 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	14.56 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.86 %
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	8.23 %
Unclassified	root	N/A	5.70 %
Chondromyces apiculatus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus	1.27 %
Candidatus Nitrospira nitrificans	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrificans	0.63 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	14.56 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.86 %
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	8.23 %
Unclassified	root	N/A	5.70 %
Chondromyces apiculatus DSM 436	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus → Chondromyces apiculatus DSM 436	1.27 %
Candidatus Nitrospira nitrificans	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrificans	0.63 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.63 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.63 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2065487018\|GPINP_F5MS3JC02H2XBT	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
2088090014\|GPIPI_17436456	All Organisms → cellular organisms → Bacteria	2807	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100581414	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	621	Open in IMG/M
3300000787\|JGI11643J11755_11605362	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300000881\|JGI10215J12807_1537315	Not Available	555	Open in IMG/M
3300002908\|JGI25382J43887_10133373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1279	Open in IMG/M
3300003152\|Ga0052254_1004830	All Organisms → cellular organisms → Bacteria → Proteobacteria	746	Open in IMG/M
3300004019\|Ga0055439_10116958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	804	Open in IMG/M
3300004025\|Ga0055433_10003675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	2026	Open in IMG/M
3300004267\|Ga0066396_10006154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1315	Open in IMG/M
3300004479\|Ga0062595_101098559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	695	Open in IMG/M
3300005167\|Ga0066672_10030755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	2931	Open in IMG/M
3300005180\|Ga0066685_10454129	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300005332\|Ga0066388_103992904	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300005332\|Ga0066388_104960121	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300005332\|Ga0066388_105324929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	652	Open in IMG/M
3300005332\|Ga0066388_107522562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	546	Open in IMG/M
3300005336\|Ga0070680_100839432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	792	Open in IMG/M
3300005353\|Ga0070669_101556199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	575	Open in IMG/M
3300005445\|Ga0070708_100051804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	3637	Open in IMG/M
3300005451\|Ga0066681_10216610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1150	Open in IMG/M
3300005558\|Ga0066698_10255733	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300005560\|Ga0066670_10295528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	985	Open in IMG/M
3300005561\|Ga0066699_11066383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	558	Open in IMG/M
3300005713\|Ga0066905_100377745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1142	Open in IMG/M
3300005713\|Ga0066905_100703227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	867	Open in IMG/M
3300005719\|Ga0068861_102552034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	515	Open in IMG/M
3300005764\|Ga0066903_100023705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	6668	Open in IMG/M
3300005844\|Ga0068862_102779380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	501	Open in IMG/M
3300005983\|Ga0081540_1027291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	3239	Open in IMG/M
3300006032\|Ga0066696_10601521	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300006846\|Ga0075430_100360656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1200	Open in IMG/M
3300006852\|Ga0075433_10077860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2921	Open in IMG/M
3300006852\|Ga0075433_10085514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	2784	Open in IMG/M
3300006852\|Ga0075433_10743571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	858	Open in IMG/M
3300006854\|Ga0075425_100330002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1756	Open in IMG/M
3300006871\|Ga0075434_101489476	All Organisms → cellular organisms → Bacteria → Proteobacteria	686	Open in IMG/M
3300009038\|Ga0099829_10876780	Not Available	745	Open in IMG/M
3300009090\|Ga0099827_10209728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1623	Open in IMG/M
3300009090\|Ga0099827_11607796	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	566	Open in IMG/M
3300009094\|Ga0111539_10487673	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1435	Open in IMG/M
3300009137\|Ga0066709_100578441	All Organisms → cellular organisms → Bacteria	1596	Open in IMG/M
3300009147\|Ga0114129_11214622	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300009156\|Ga0111538_14092309	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300009157\|Ga0105092_10014965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4073	Open in IMG/M
3300009162\|Ga0075423_10016873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	7175	Open in IMG/M
3300009162\|Ga0075423_10689631	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300009553\|Ga0105249_10820125	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300009610\|Ga0105340_1372110	All Organisms → cellular organisms → Bacteria → Proteobacteria	634	Open in IMG/M
3300009792\|Ga0126374_10679654	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300009813\|Ga0105057_1108164	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	521	Open in IMG/M
3300010043\|Ga0126380_10137317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1541	Open in IMG/M
3300010043\|Ga0126380_10352923	All Organisms → cellular organisms → Bacteria	1071	Open in IMG/M
3300010043\|Ga0126380_10836734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	757	Open in IMG/M
3300010046\|Ga0126384_10621270	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300010046\|Ga0126384_11275797	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	680	Open in IMG/M
3300010046\|Ga0126384_12066376	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300010047\|Ga0126382_10141745	All Organisms → cellular organisms → Bacteria	1631	Open in IMG/M
3300010047\|Ga0126382_10403995	All Organisms → cellular organisms → Bacteria	1067	Open in IMG/M
3300010047\|Ga0126382_10735740	All Organisms → cellular organisms → Bacteria → Proteobacteria	832	Open in IMG/M
3300010078\|Ga0127487_109706	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300010087\|Ga0127492_1032890	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300010095\|Ga0127475_1005417	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300010114\|Ga0127460_1057059	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300010119\|Ga0127452_1061421	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300010126\|Ga0127482_1165359	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300010322\|Ga0134084_10134663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	818	Open in IMG/M
3300010336\|Ga0134071_10077135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1555	Open in IMG/M
3300010358\|Ga0126370_11759985	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300010359\|Ga0126376_10074699	All Organisms → cellular organisms → Bacteria	2495	Open in IMG/M
3300010359\|Ga0126376_12511669	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300010360\|Ga0126372_10063339	All Organisms → cellular organisms → Bacteria	2585	Open in IMG/M
3300010362\|Ga0126377_10042541	All Organisms → cellular organisms → Bacteria	3918	Open in IMG/M
3300010362\|Ga0126377_12546190	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300010362\|Ga0126377_13242915	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus → Chondromyces apiculatus DSM 436	526	Open in IMG/M
3300010398\|Ga0126383_11587498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	744	Open in IMG/M
3300010400\|Ga0134122_10280793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1420	Open in IMG/M
3300010401\|Ga0134121_10492354	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300010896\|Ga0138111_1105350	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300011269\|Ga0137392_10055491	All Organisms → cellular organisms → Bacteria	2995	Open in IMG/M
3300011270\|Ga0137391_10764288	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300012096\|Ga0137389_10393274	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300012096\|Ga0137389_11685557	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300012205\|Ga0137362_11343462	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	600	Open in IMG/M
3300012206\|Ga0137380_10969655	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300012211\|Ga0137377_10468664	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300012212\|Ga0150985_101019672	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	548	Open in IMG/M
3300012350\|Ga0137372_10358842	All Organisms → cellular organisms → Bacteria	1114	Open in IMG/M
3300012354\|Ga0137366_10641368	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	760	Open in IMG/M
3300012362\|Ga0137361_10149424	All Organisms → cellular organisms → Bacteria	2086	Open in IMG/M
3300012380\|Ga0134047_1248236	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300012393\|Ga0134052_1163386	All Organisms → cellular organisms → Bacteria	1024	Open in IMG/M
3300012399\|Ga0134061_1246996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	723	Open in IMG/M
3300012900\|Ga0157292_10200264	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300012913\|Ga0157298_10396163	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	524	Open in IMG/M
3300012918\|Ga0137396_10651939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	778	Open in IMG/M
3300012923\|Ga0137359_10450240	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300012929\|Ga0137404_10156987	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1897	Open in IMG/M
3300012930\|Ga0137407_11767400	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300012948\|Ga0126375_10319353	All Organisms → cellular organisms → Bacteria	1087	Open in IMG/M
3300012948\|Ga0126375_10372312	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300012948\|Ga0126375_10373701	All Organisms → cellular organisms → Bacteria	1020	Open in IMG/M
3300012948\|Ga0126375_10443163	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300012971\|Ga0126369_10065020	All Organisms → cellular organisms → Bacteria	3175	Open in IMG/M
3300012972\|Ga0134077_10036786	All Organisms → cellular organisms → Bacteria	1763	Open in IMG/M
3300012976\|Ga0134076_10529169	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300014154\|Ga0134075_10487886	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300014884\|Ga0180104_1227234	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300014885\|Ga0180063_1225879	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300015245\|Ga0137409_10082176	All Organisms → cellular organisms → Bacteria → Proteobacteria	3006	Open in IMG/M
3300015245\|Ga0137409_10515856	All Organisms → cellular organisms → Bacteria	1019	Open in IMG/M
3300015264\|Ga0137403_10282676	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1559	Open in IMG/M
3300015371\|Ga0132258_11789070	All Organisms → cellular organisms → Bacteria	1548	Open in IMG/M
3300016341\|Ga0182035_11775146	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300017657\|Ga0134074_1165933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	776	Open in IMG/M
3300018053\|Ga0184626_10341938	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300018054\|Ga0184621_10280220	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	590	Open in IMG/M
3300018060\|Ga0187765_11046701	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300018063\|Ga0184637_10268809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	1037	Open in IMG/M
3300018078\|Ga0184612_10622825	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	509	Open in IMG/M
3300021307\|Ga0179585_1155812	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300022694\|Ga0222623_10277682	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300024330\|Ga0137417_1063472	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300025551\|Ga0210131_1031122	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300025899\|Ga0207642_10922522	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300025899\|Ga0207642_11067357	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300025922\|Ga0207646_10759403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	865	Open in IMG/M
3300025923\|Ga0207681_10826716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	774	Open in IMG/M
3300026118\|Ga0207675_102100292	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300026310\|Ga0209239_1083760	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrificans	1374	Open in IMG/M
3300026325\|Ga0209152_10290479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	611	Open in IMG/M
3300026327\|Ga0209266_1267355	Not Available	543	Open in IMG/M
3300026359\|Ga0257163_1017935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	1091	Open in IMG/M
3300026361\|Ga0257176_1067151	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300026537\|Ga0209157_1211504	All Organisms → cellular organisms → Bacteria	807	Open in IMG/M
3300026873\|Ga0207620_1013357	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300027646\|Ga0209466_1080561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	657	Open in IMG/M
3300027909\|Ga0209382_10292663	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1838	Open in IMG/M
3300028381\|Ga0268264_10630252	All Organisms → cellular organisms → Bacteria	1059	Open in IMG/M
3300028381\|Ga0268264_11572710	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	668	Open in IMG/M
3300028828\|Ga0307312_10770619	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300031561\|Ga0318528_10506093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	649	Open in IMG/M
3300031640\|Ga0318555_10564628	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus → Chondromyces apiculatus DSM 436	617	Open in IMG/M
3300031740\|Ga0307468_100897218	All Organisms → cellular organisms → Bacteria	768	Open in IMG/M
3300031744\|Ga0306918_11126153	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300031751\|Ga0318494_10284693	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300031846\|Ga0318512_10278895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	828	Open in IMG/M
3300032003\|Ga0310897_10717224	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300032180\|Ga0307471_103681602	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300032261\|Ga0306920_101800603	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300033433\|Ga0326726_11467424	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300034643\|Ga0370545_111535	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.18%
Host-Associated	Host-Associated	15.82%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	73.42%
Plants	Host-Associated → Plants	15.82%
Aquatic	Environmental → Aquatic	10.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	72.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.49%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.33%
Sediment	Environmental → Aquatic → Sediment	6.96%
Freshwater	Environmental → Aquatic → Freshwater	1.90%
Marine	Environmental → Aquatic → Marine	1.90%
Peat	Environmental → Terrestrial → Peat	0.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.29%
Loam	Environmental → Terrestrial → Soil → Loam	8.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.96%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.06%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.90%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.27%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.63%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.63%
Sand	Environmental → Terrestrial → Soil → Sand	0.63%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	42.41%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.96%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.06%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.90%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.27%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.63%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.63%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.63%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.63%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.63%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.63%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.56%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	10.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.13%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.59%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.16%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.53%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.90%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.90%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.90%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.90%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.27%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.27%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.27%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.63%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.63%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.63%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.63%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.63%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.63%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.63%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.63%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.63%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.63%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.63%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2065487018	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000881	Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300003152	Freshwater sediment microbial communities from Loktak Lake, India	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300004025	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1	Environmental	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010078	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010087	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010095	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010114	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010119	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010126	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010896	Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012380	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012393	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012399	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300021307	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021858	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025551	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026359	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A	Environmental	Open in IMG/M
3300026361	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026873	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-12 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.21
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.21
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F042542

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPINP_02545580	2065487018	Soil	MEVTAMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF
GPIPI_02307790	2088090014	Soil	MEVSAMAWETPEFVEVKMDAEINSYQDDFEREQDERF
INPhiseqgaiiFebDRAFT_1005814142	3300000364	Soil	MSQGCLRREVNAMVWEAPEFTEVRMDAEINSYQDDFEREQDDRF*
JGI11643J11755_116053622	3300000787	Soil	MAWEAPEFVEVRMDAEIXSYQDEFGPGREXDDRF*
JGI10215J12807_15373152	3300000881	Soil	MAWEAPEFVEVRMDAEINSYQDEFGPGREEDDRF*
JGI25382J43887_101333733	3300002908	Grasslands Soil	SRWISRGGDSMTWEAPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0052254_10048302	3300003152	Sediment	MALGAQSPEVSDMTWETPDFLEVKMDAEINSYQDDFEREGDDRF*
Ga0055439_101169582	3300004019	Natural And Restored Wetlands	LTHFTEVIAMTWEAPDFVEVKMDAEINSYQDDFEREQDDRF*
Ga0055433_100036753	3300004025	Natural And Restored Wetlands	LGHEPTAPGAQSPEVSAMTWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0066396_100061542	3300004267	Tropical Forest Soil	LALGPFTEVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0062595_1010985591	3300004479	Soil	PSLEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0066672_100307553	3300005167	Soil	VALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0066685_104541292	3300005180	Soil	MSHGRCVMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0066388_1039929041	3300005332	Tropical Forest Soil	LALGPFTEVNDMTWEAPDFVEVKMDAEINSYQDDFDREQDD
Ga0066388_1049601211	3300005332	Tropical Forest Soil	LALGPFTEVNDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0066388_1053249291	3300005332	Tropical Forest Soil	EPLGGADMVWEAPEVTEVRMDAEINSYQDDFGSEPDDRF*
Ga0066388_1075225621	3300005332	Tropical Forest Soil	VTRPTEGRAMTWEAPEFVEIKMDAEINSYQDDFEREQDDRF*
Ga0070680_1008394322	3300005336	Corn Rhizosphere	DCPHVEETPMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0070669_1015561992	3300005353	Switchgrass Rhizosphere	GDPSLEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0070708_1000518045	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VPASRVALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0066681_102166101	3300005451	Soil	AASRVALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0066698_102557333	3300005558	Soil	RAKGLDSRGGDSMTWETPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0066670_102955281	3300005560	Soil	GDSMTWEVPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0066699_110663832	3300005561	Soil	KKGGNTMDWEAPSFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0066905_1003777451	3300005713	Tropical Forest Soil	MAWEAPDFVEVKMDAEINSYQDEFGPGREQDDRF*
Ga0066905_1007032272	3300005713	Tropical Forest Soil	VEPGASKTQPTEVRAMAWEAPEFVEVKMDAEINSYQDEFGPGREQDDRF*
Ga0068861_1025520341	3300005719	Switchgrass Rhizosphere	PTSEESAMIWEAPDFTEVKMDAEINSYQDDFEREPDDRF*
Ga0066903_1000237059	3300005764	Tropical Forest Soil	MAWEAPEFVEVKMDAEINSYQDEFGPGREQDDRF*
Ga0068862_1027793801	3300005844	Switchgrass Rhizosphere	IWSYTAEVTDMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0081540_10272912	3300005983	Tabebuia Heterophylla Rhizosphere	MAWEAPDFVEVKMDAEINSYQDDFGPGREQDDRF*
Ga0066696_106015211	3300006032	Soil	MSHGRCVMAWEAPDFVEVKMDAEINSYQDDFSGI*
Ga0075023_1000002165	3300006041	Watersheds	MTWETPTFVEVKMDAEINSYQDDFGGERDTAPLF*
Ga0075028_1000330292	3300006050	Watersheds	MTWETPAFVEVKMDAEINSYQDDFSGERDTSPVF*
Ga0075018_101219583	3300006172	Watersheds	VDFVQEDVMTWETPAFVEVKMDAEINSYQDDFSGERDTSPVF*
Ga0075430_1003606562	3300006846	Populus Rhizosphere	LGGADMVWEAPEVTEVRMDAEINSYQDDFGSEPDDRF*
Ga0075433_100778602	3300006852	Populus Rhizosphere	MAWEAPEFVEVKMDAEINSYQDDFGPGREQDDRF*
Ga0075433_100855141	3300006852	Populus Rhizosphere	GRCVMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0075433_107435712	3300006852	Populus Rhizosphere	MALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0075425_1003300023	3300006854	Populus Rhizosphere	MVWEAPEFVEVKMDAEINSYQDDFGPGREQDDRF*
Ga0075434_1014894762	3300006871	Populus Rhizosphere	LRSRLRVGDPAFFRLEVGLMTWEAPDFIEVKMDAEINSYQDDFEREQDDRF*
Ga0099829_108767802	3300009038	Vadose Zone Soil	LALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0099827_102097283	3300009090	Vadose Zone Soil	ALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0099827_116077961	3300009090	Vadose Zone Soil	LALGDFSREVSNMSWEAPDFIEVKMDAEINSYQDDFDREQDNRF*
Ga0111539_104876731	3300009094	Populus Rhizosphere	MEVSAMAWETPEFVEVKMDAEINSYQDDFEREQDERF*
Ga0066709_1005784412	3300009137	Grasslands Soil	LEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0114129_112146222	3300009147	Populus Rhizosphere	MRFMSHGRCVMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0111538_140923091	3300009156	Populus Rhizosphere	MEVTAMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0105092_100149652	3300009157	Freshwater Sediment	MEVRAMAWEAPEFVEVKMDAEINSYQDDFGPGREQDDRF*
Ga0075423_100168735	3300009162	Populus Rhizosphere	MAWKAPDFVEVKMDAEINSYQDDFGPGREQDDRF*
Ga0075423_106896312	3300009162	Populus Rhizosphere	MGMTWEAPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0105249_108201252	3300009553	Switchgrass Rhizosphere	MEVRAMAWEAPEFVEVKMDAEINSYQDDFERQEDDRF*
Ga0105340_13721101	3300009610	Soil	DEPMTWETPAFVEVKMDAEINSYQDDFAPDRDESV*
Ga0126374_106796542	3300009792	Tropical Forest Soil	VDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0105057_11081641	3300009813	Groundwater Sand	MTWEAPDFIEVKMDAEINSYQDDFDREQDDRSRAR
Ga0126380_101373171	3300010043	Tropical Forest Soil	VNDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126380_103529232	3300010043	Tropical Forest Soil	MALGPHSPEESDMTWETPDFIEVKMDAEINSYQDDFERDGDDRF*
Ga0126380_108367341	3300010043	Tropical Forest Soil	EVSDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126384_106212701	3300010046	Tropical Forest Soil	RDQGGGGDFSREVSAMSWEAPEFIEIKMDAEINSYQDDFDREQDDRF*
Ga0126384_112757972	3300010046	Tropical Forest Soil	MAMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0126384_120663762	3300010046	Tropical Forest Soil	PTEVRAMAWEAPEFVEVKMDAEINSYQDDLDREQDDRF*
Ga0126382_101417451	3300010047	Tropical Forest Soil	VDDMTWEAPDFVEVKMDAEINSYQDDCDREQDDRF*
Ga0126382_104039952	3300010047	Tropical Forest Soil	LEVETMVWEAPDFIEVKMDAEINSYQDDFEREQDDRF*
Ga0126382_107357401	3300010047	Tropical Forest Soil	MEVRAMTWEAPEFTEVKMDAEINSYQDDFDREQDDRF*
Ga0127487_1097061	3300010078	Grasslands Soil	VTSRNREGRAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0127492_10328901	3300010087	Grasslands Soil	RAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0127475_10054171	3300010095	Grasslands Soil	EVRAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0127460_10570591	3300010114	Grasslands Soil	QANSANGRVRAMTWETPAFIEVKMDAEINSYQPDDFDRDPDDRF*
Ga0127452_10614211	3300010119	Grasslands Soil	VTSRNREVQAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0127482_11653591	3300010126	Grasslands Soil	SAVTSMNREVRAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0134084_101346631	3300010322	Grasslands Soil	SRGGDSMTWEVPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0134071_100771352	3300010336	Grasslands Soil	GITMTWETPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126370_117599851	3300010358	Tropical Forest Soil	VVVLQSLEVRAMAWETPEFVEVKMDAEINSYQDDFEREQDDRF*
Ga0126376_100746993	3300010359	Tropical Forest Soil	LALGPFTEVDDMTWEVPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126376_125116692	3300010359	Tropical Forest Soil	MPMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0126372_100633394	3300010360	Tropical Forest Soil	VRGMTWETPSFTEIKMDAEINSYQDDFDREQDDRF*
Ga0126377_100425412	3300010362	Tropical Forest Soil	VDDMTWEAPDFVEVKMDAEISSYQDDFDREQDDRF*
Ga0126377_125461901	3300010362	Tropical Forest Soil	KTQPTEVRAMAWEAPEFVEVKMDAEINSYQDEFGPGREQDDRF*
Ga0126377_132429151	3300010362	Tropical Forest Soil	LEVETMVWEAPDFIEVKMDAEINSYHDDFEREQDDRF*
Ga0126383_115874982	3300010398	Tropical Forest Soil	GGDSMTWETPAFIEVKMDAEINSYQDDFDREQDDRF*
Ga0134122_102807933	3300010400	Terrestrial Soil	LEETPMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0134121_104923541	3300010401	Terrestrial Soil	MSQGCLRTEVRAMVWDAPEFTEVRMDAEINSYQDDFEREQDDRF*
Ga0138111_11053501	3300010896	Grasslands Soil	REVRAMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0137392_100554911	3300011269	Vadose Zone Soil	RTMTWEAPAFVEVKMDAEINSYQPDNFDREPDDRF*
Ga0137391_107642881	3300011270	Vadose Zone Soil	LALGDFSREVRVMSWEAPDFIEVKMDAEINSYQDDFDRE
Ga0137389_103932741	3300012096	Vadose Zone Soil	LALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQ
Ga0137389_116855572	3300012096	Vadose Zone Soil	AASRLALGDFSREVRVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0137362_113434621	3300012205	Vadose Zone Soil	ISTGAWEAPTFVELRMDAEIGSYQGAFDREPDERF*
Ga0137380_109696553	3300012206	Vadose Zone Soil	VALGDFSREVSVMSWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0137377_104686641	3300012211	Vadose Zone Soil	ISRGGDSMTWEAPAFVEVKMDAEINSYQDDFDREQDDRF*
Ga0150985_1010196722	3300012212	Avena Fatua Rhizosphere	GGDAMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0137372_103588421	3300012350	Vadose Zone Soil	RRGEPMTWEAPTFVEVKMDAEINSYQDDFDREQDDRF*
Ga0137366_106413681	3300012354	Vadose Zone Soil	VRRVTPMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0137361_101494244	3300012362	Vadose Zone Soil	TVGGAVMTWEAPQFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0134047_12482361	3300012380	Grasslands Soil	GQANSANGRVRAMTWETPAFIEVKMDAEINSYQPDDFDRDPDDRF*
Ga0134052_11633862	3300012393	Grasslands Soil	QANSANGRVRAMTWETPAFIEVKMDAEINSYQPDDFDRDQDDRF*
Ga0134061_12469961	3300012399	Grasslands Soil	NSANGRVRAMTWETPAFIEVKMDAEINSYQPDDFDRDPDDRF*
Ga0157292_102002642	3300012900	Soil	RSVLDRSIEVSAMSWEAPDFSEVRMDAEINSYQDDFDREPDDRF*
Ga0157298_103961632	3300012913	Soil	VLDRSVEVSAMSWEAPDFSEVRMDAEINSYQDDFGGEQDDRF*
Ga0137396_106519391	3300012918	Vadose Zone Soil	GAVMTWEAPQFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0137359_104502402	3300012923	Vadose Zone Soil	LEDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0137404_101569873	3300012929	Vadose Zone Soil	MEVRAMAWEAPEFVEVKMDAEINSYQDDFERQGDDRF*
Ga0137407_117674002	3300012930	Vadose Zone Soil	VALGDLSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0126375_103193532	3300012948	Tropical Forest Soil	MVAANRWPWAPFTEVNDMTWETPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126375_103723121	3300012948	Tropical Forest Soil	LALGPFTEVDDMTWETPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126375_103737011	3300012948	Tropical Forest Soil	GPFTEVNDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF*
Ga0126375_104431632	3300012948	Tropical Forest Soil	MALGPHSPEESDMTWETPDFIEVKMDAEINSYQDDFDRQDDDRF*
Ga0126369_100650204	3300012971	Tropical Forest Soil	VVVLQSLEVRAMAWETPEFVEVKMDAEINSYQDDFEREQD
Ga0134077_100367861	3300012972	Grasslands Soil	AMSWETPAFIEVKMDAEINSYQPDDFDRDQDDRF*
Ga0134076_105291692	3300012976	Grasslands Soil	VALRDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF*
Ga0134075_104878861	3300014154	Grasslands Soil	RTGVSEMTWETPTFEEVKMDAEINSYQEDSDDRF*
Ga0180104_12272342	3300014884	Soil	SGVRQPPEVTAMTWEAPEFVEIKMDAEINSYQDDFEREQDDRF*
Ga0180063_12258791	3300014885	Soil	ATSGDPLLALWEVSAMTWEAPEFVEIKMDAEINSYQDDFEREQDDRF*
Ga0137409_100821763	3300015245	Vadose Zone Soil	MALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFD
Ga0137409_105158561	3300015245	Vadose Zone Soil	LALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFD
Ga0137403_102826762	3300015264	Vadose Zone Soil	VEVTPMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0132258_117890701	3300015371	Arabidopsis Rhizosphere	MAMTWEAPDFVEVKMDAEINSYQDDFGGEQDDRF*
Ga0182035_117751462	3300016341	Soil	SLALGPFTEVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0134074_11659332	3300017657	Grasslands Soil	VALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0184626_103419382	3300018053	Groundwater Sediment	LLAMWEVSAMIWEAPEFVEIKMDAEINSYQDDFEREQDDRF
Ga0184621_102802202	3300018054	Groundwater Sediment	VPTPETHPMEVRAMAWEAPEFVEVKMDAEINSYQDDFEREQDERF
Ga0187765_110467012	3300018060	Tropical Peatland	LALVFHLTGGEAMTWEAPDFVEVKMDAEINSYQDDFEREQDDRF
Ga0184637_102688092	3300018063	Groundwater Sediment	LLVMWEVSAMIWEAPEFVEIKMDAEINSYQDDFEREQDDRF
Ga0184612_106228251	3300018078	Groundwater Sediment	LLALWEVSAMTWEAPEFVEIKMDAEINSYQDDFEREQDDRF
Ga0179585_11558122	3300021307	Vadose Zone Soil	GQANCANGRMRAMTWETPAFIEVKMDAEINSYQPDDFDRDPDDRF
Ga0213852_13057212	3300021858	Watersheds	VDFVQEDVMTWETPAFVEVKMDAEINSYQDDFSGERDTSPVF
Ga0222623_102776821	3300022694	Groundwater Sediment	GPKPPIPEESAMIWEAPDFIEVKMDAEINSYQDDFERESDDRF
Ga0137417_10634722	3300024330	Vadose Zone Soil	MALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0209431_100896021	3300025313	Soil	DEPMTWETPAFVELKMDAEINSYQDDFAPDRDDSV
Ga0210131_10311221	3300025551	Natural And Restored Wetlands	TSEVSAMTWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0207642_109225221	3300025899	Miscanthus Rhizosphere	IPIWSYTAEVTDMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF
Ga0207642_110673571	3300025899	Miscanthus Rhizosphere	LEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0207646_107594032	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	IVPASRVALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0207681_108267162	3300025923	Switchgrass Rhizosphere	PYQNPLPEVSAMTWEAPDFIEVKMDAEINSYQDDFDRQDDDRF
Ga0207675_1021002922	3300026118	Switchgrass Rhizosphere	PTSEESAMIWEAPDFTEVKMDAEINSYQDDFEREPDDRF
Ga0209239_10837603	3300026310	Grasslands Soil	FSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0209152_102904791	3300026325	Soil	VGGAVMTWEAPKFVEVKMDAEINSYQDDFGGEQDDRF
Ga0209266_12673551	3300026327	Soil	LEVSAMTWEAPDFVDVKMDAEINSYQDDFDREQDDRF
Ga0257163_10179352	3300026359	Soil	LALGDFSREVSVMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0257176_10671512	3300026361	Soil	LALGDFSREVSLMSWEAPDFIEVKMDAEINSYQDDFDREQDDRF
Ga0209058_11459831	3300026536	Soil	RAKGLDSRGGDSMTWETPAFVEVKMDAEINSYQDDFDREQDDRF
Ga0209157_12115041	3300026537	Soil	RRGLGEPSLEVSAMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0207620_10133572	3300026873	Soil	RSVLDRSVEVSAMSWEAPDFSEVRMDAEINSYQDDFDREPDDRF
Ga0209466_10805612	3300027646	Tropical Forest Soil	AQAVGPGALSPEVSDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0209382_102926633	3300027909	Populus Rhizosphere	VEPSAAPARHLMEVRAMAWETPEFVEVKMDAEINSYQDDFDRQQDDRF
Ga0268264_106302522	3300028381	Switchgrass Rhizosphere	EVTTMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF
Ga0268264_115727101	3300028381	Switchgrass Rhizosphere	MGHGHRRREVSAMVWEAPEFAEVRMDAEINSYQDDFEREQDDRF
Ga0307312_107706192	3300028828	Soil	VNRTLDPKPEVSAMTWEAPDFIEVKMDAEINSYQDDFERESDDRF
Ga0318528_105060931	3300031561	Soil	EVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0318555_105646281	3300031640	Soil	LIPHFYRLEVGAMTWEAPDFIEVKMDAEINSYQDDFEREQDDRF
Ga0307468_1008972181	3300031740	Hardwood Forest Soil	ESAMIWEAPDFTEVKMDAEINSYQDDFEREPDDRF
Ga0306918_111261532	3300031744	Soil	LALGPFTEVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0318494_102846931	3300031751	Soil	TEVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0318512_102788952	3300031846	Soil	FTEVDDMTWEAPDFVEVKMDAEINSYQDDFDREQDDRF
Ga0310897_107172242	3300032003	Soil	TAEVTTMAWEAPDFVEVKMDAEINSYQDDFGGEQDDRF
Ga0307471_1036816022	3300032180	Hardwood Forest Soil	GWPTLDRTREVSEMTWETPTFVEVKMDAEINSYQEESDDRF
Ga0306920_1018006031	3300032261	Soil	LSAVHLAHTGGERAMIWEAPDFIEVKMDAEINSYQDDFEREQDDRF
Ga0326726_114674242	3300033433	Peat Soil	TRQMSQGHLRREVSAMVWQAPEFTEVRMDAEINSYQDDFEREQDDRF
Ga0370545_111535_487_603	3300034643	Soil	RLEVSAMTWEAPEFVEVKMDAEINSYQDDFEREQDDRF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign