Metagenome / Metatranscriptome Family F042868

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F042868
Family Type	Metagenome / Metatranscriptome
Number of Sequences	157
Average Sequence Length	40 residues
Representative Sequence	EIYWLAWECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK
Number of Associated Samples	104
Number of Associated Scaffolds	157

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	1.28 %
% of genes near scaffold ends (potentially truncated)	98.73 %
% of genes from short scaffolds (< 2000 bps)	79.62 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (63.694 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (34.395 % of family members)
Environment Ontology (ENVO)	Unclassified (73.248 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (75.159 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 157 Family Scaffolds
PF03354	TerL_ATPase	0.64
PF09636	XkdW	0.64
PF01844	HNH	0.64

COG ID	Name	Functional Category	% Frequency in 157 Family Scaffolds
COG4626	Phage terminase-like protein, large subunit, contains N-terminal HTH domain	Mobilome: prophages, transposons [X]	0.64

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.52 %
Unclassified	root	N/A	32.48 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	65.61 %
Unclassified	root	N/A	32.48 %
cellular organisms	root	All Organisms → cellular organisms	1.91 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	63.69 %
Unclassified	root	N/A	32.48 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	63.69 %
Unclassified	root	N/A	32.48 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	63.69 %
Unclassified	root	N/A	32.48 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	63.69 %
Unclassified	root	N/A	32.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.64 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	63.69 %
Unclassified	root	N/A	32.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.64 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	63.69 %
Unclassified	root	N/A	32.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000736\|JGI12547J11936_1025484	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1367	Open in IMG/M
3300002272\|B570J29579_108358	Not Available	509	Open in IMG/M
3300002408\|B570J29032_109762128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1239	Open in IMG/M
3300002408\|B570J29032_109895397	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2119	Open in IMG/M
3300002408\|B570J29032_109903017	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2245	Open in IMG/M
3300003277\|JGI25908J49247_10062950	Not Available	942	Open in IMG/M
3300003277\|JGI25908J49247_10076452	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	831	Open in IMG/M
3300003394\|JGI25907J50239_1038725	Not Available	998	Open in IMG/M
3300003429\|JGI25914J50564_10143636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300005527\|Ga0068876_10184217	Not Available	1216	Open in IMG/M
3300005527\|Ga0068876_10255753	Not Available	1003	Open in IMG/M
3300005580\|Ga0049083_10210294	Not Available	659	Open in IMG/M
3300005581\|Ga0049081_10206563	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	702	Open in IMG/M
3300005583\|Ga0049085_10122045	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	889	Open in IMG/M
3300005584\|Ga0049082_10123716	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	903	Open in IMG/M
3300005585\|Ga0049084_10233276	Not Available	622	Open in IMG/M
3300005805\|Ga0079957_1087563	All Organisms → Viruses → Predicted Viral	1738	Open in IMG/M
3300006639\|Ga0079301_1032790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1743	Open in IMG/M
3300006805\|Ga0075464_10012681	All Organisms → cellular organisms → Bacteria	4193	Open in IMG/M
3300006805\|Ga0075464_10222452	Not Available	1125	Open in IMG/M
3300006920\|Ga0070748_1220343	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	689	Open in IMG/M
3300007559\|Ga0102828_1010467	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1888	Open in IMG/M
3300007974\|Ga0105747_1305806	Not Available	539	Open in IMG/M
3300008107\|Ga0114340_1031662	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2420	Open in IMG/M
3300008113\|Ga0114346_1006880	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6815	Open in IMG/M
3300008261\|Ga0114336_1137039	Not Available	1101	Open in IMG/M
3300008266\|Ga0114363_1168616	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	708	Open in IMG/M
3300008448\|Ga0114876_1075398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1419	Open in IMG/M
3300008448\|Ga0114876_1114802	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1044	Open in IMG/M
3300009068\|Ga0114973_10129050	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1418	Open in IMG/M
3300009155\|Ga0114968_10030791	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3594	Open in IMG/M
3300009158\|Ga0114977_10135344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1476	Open in IMG/M
3300009158\|Ga0114977_10732443	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524	Open in IMG/M
3300009159\|Ga0114978_10021178	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4786	Open in IMG/M
3300009160\|Ga0114981_10653534	Not Available	557	Open in IMG/M
3300009163\|Ga0114970_10056266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2523	Open in IMG/M
3300009164\|Ga0114975_10056166	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2313	Open in IMG/M
3300009170\|Ga0105096_10696177	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300009180\|Ga0114979_10470702	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	729	Open in IMG/M
3300009183\|Ga0114974_10016854	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5212	Open in IMG/M
3300009183\|Ga0114974_10045071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2977	Open in IMG/M
3300009183\|Ga0114974_10122594	All Organisms → Viruses → Predicted Viral	1651	Open in IMG/M
3300009183\|Ga0114974_10175446	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1324	Open in IMG/M
3300009183\|Ga0114974_10345867	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	863	Open in IMG/M
3300009184\|Ga0114976_10121072	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1481	Open in IMG/M
3300009187\|Ga0114972_10354234	Not Available	856	Open in IMG/M
3300010354\|Ga0129333_11335390	Not Available	591	Open in IMG/M
3300010885\|Ga0133913_11477247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1723	Open in IMG/M
3300010885\|Ga0133913_11837011	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1515	Open in IMG/M
3300010885\|Ga0133913_11844626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1511	Open in IMG/M
3300010885\|Ga0133913_13052758	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1114	Open in IMG/M
3300010885\|Ga0133913_13410406	Not Available	1041	Open in IMG/M
3300012666\|Ga0157498_1044024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	685	Open in IMG/M
3300012729\|Ga0157625_1160451	Not Available	771	Open in IMG/M
3300013006\|Ga0164294_10183147	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1494	Open in IMG/M
3300013006\|Ga0164294_10317002	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1079	Open in IMG/M
3300013372\|Ga0177922_10445672	Not Available	1005	Open in IMG/M
3300013372\|Ga0177922_10446251	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	779	Open in IMG/M
3300013372\|Ga0177922_10516743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3892	Open in IMG/M
3300013372\|Ga0177922_10809645	Not Available	890	Open in IMG/M
3300013372\|Ga0177922_11275909	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3128	Open in IMG/M
3300015050\|Ga0181338_1024348	Not Available	936	Open in IMG/M
3300015050\|Ga0181338_1066550	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300017701\|Ga0181364_1023452	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1012	Open in IMG/M
3300017701\|Ga0181364_1050445	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	653	Open in IMG/M
3300017701\|Ga0181364_1072569	Not Available	526	Open in IMG/M
3300017701\|Ga0181364_1075160	Not Available	516	Open in IMG/M
3300017722\|Ga0181347_1034212	Not Available	1576	Open in IMG/M
3300017722\|Ga0181347_1085379	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	915	Open in IMG/M
3300017723\|Ga0181362_1014809	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1677	Open in IMG/M
3300017723\|Ga0181362_1054155	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	831	Open in IMG/M
3300017736\|Ga0181365_1030724	Not Available	1355	Open in IMG/M
3300017736\|Ga0181365_1046283	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1090	Open in IMG/M
3300017736\|Ga0181365_1052004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1022	Open in IMG/M
3300017736\|Ga0181365_1067642	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	883	Open in IMG/M
3300017736\|Ga0181365_1086171	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	767	Open in IMG/M
3300017754\|Ga0181344_1026859	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1767	Open in IMG/M
3300017754\|Ga0181344_1196939	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	566	Open in IMG/M
3300017761\|Ga0181356_1024737	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2182	Open in IMG/M
3300017766\|Ga0181343_1217062	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521	Open in IMG/M
3300017774\|Ga0181358_1081664	Not Available	1180	Open in IMG/M
3300017774\|Ga0181358_1090899	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1105	Open in IMG/M
3300017774\|Ga0181358_1113383	Not Available	960	Open in IMG/M
3300017777\|Ga0181357_1186584	Not Available	747	Open in IMG/M
3300017777\|Ga0181357_1188075	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	743	Open in IMG/M
3300017778\|Ga0181349_1108599	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1032	Open in IMG/M
3300017780\|Ga0181346_1067296	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1428	Open in IMG/M
3300017780\|Ga0181346_1137501	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	924	Open in IMG/M
3300017784\|Ga0181348_1017090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3112	Open in IMG/M
3300019784\|Ga0181359_1089680	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1141	Open in IMG/M
3300019784\|Ga0181359_1201975	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	639	Open in IMG/M
3300020183\|Ga0194115_10184723	Not Available	1046	Open in IMG/M
3300020220\|Ga0194119_10049543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3848	Open in IMG/M
3300020530\|Ga0208235_1007339	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1458	Open in IMG/M
3300020536\|Ga0207939_1005585	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2242	Open in IMG/M
3300021956\|Ga0213922_1009251	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2785	Open in IMG/M
3300021962\|Ga0222713_10823522	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	516	Open in IMG/M
3300021963\|Ga0222712_10561378	Not Available	665	Open in IMG/M
3300022190\|Ga0181354_1134858	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	784	Open in IMG/M
3300022407\|Ga0181351_1164498	Not Available	782	Open in IMG/M
3300022407\|Ga0181351_1186453	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	708	Open in IMG/M
3300022407\|Ga0181351_1222380	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611	Open in IMG/M
3300023174\|Ga0214921_10277219	Not Available	956	Open in IMG/M
3300024346\|Ga0244775_10419582	Not Available	1099	Open in IMG/M
3300024346\|Ga0244775_11515211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300024346\|Ga0244775_11571411	Not Available	501	Open in IMG/M
3300024348\|Ga0244776_10619640	Not Available	680	Open in IMG/M
3300027563\|Ga0209552_1150934	Not Available	598	Open in IMG/M
3300027656\|Ga0209357_1163150	Not Available	588	Open in IMG/M
3300027659\|Ga0208975_1058694	Not Available	1168	Open in IMG/M
3300027688\|Ga0209553_1089163	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1130	Open in IMG/M
3300027693\|Ga0209704_1027054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1499	Open in IMG/M
3300027707\|Ga0209443_1127658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943	Open in IMG/M
3300027732\|Ga0209442_1013871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3865	Open in IMG/M
3300027732\|Ga0209442_1281026	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	582	Open in IMG/M
3300027733\|Ga0209297_1364013	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300027736\|Ga0209190_1019438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3836	Open in IMG/M
3300027747\|Ga0209189_1351200	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	559	Open in IMG/M
3300027754\|Ga0209596_1009125	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6765	Open in IMG/M
3300027759\|Ga0209296_1020167	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3811	Open in IMG/M
3300027759\|Ga0209296_1384609	Not Available	530	Open in IMG/M
3300027785\|Ga0209246_10066536	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1398	Open in IMG/M
3300027785\|Ga0209246_10185026	Not Available	816	Open in IMG/M
3300027785\|Ga0209246_10189850	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804	Open in IMG/M
3300027785\|Ga0209246_10410751	Not Available	507	Open in IMG/M
3300027793\|Ga0209972_10097451	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1482	Open in IMG/M
3300027798\|Ga0209353_10008577	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5023	Open in IMG/M
3300027798\|Ga0209353_10236773	Not Available	789	Open in IMG/M
3300027808\|Ga0209354_10006184	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4852	Open in IMG/M
3300027963\|Ga0209400_1055327	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2031	Open in IMG/M
3300027969\|Ga0209191_1114077	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1137	Open in IMG/M
3300027971\|Ga0209401_1021081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3313	Open in IMG/M
3300031758\|Ga0315907_10959899	Not Available	621	Open in IMG/M
3300031772\|Ga0315288_11057500	Not Available	716	Open in IMG/M
3300031772\|Ga0315288_11633598	Not Available	524	Open in IMG/M
3300031784\|Ga0315899_11503105	Not Available	564	Open in IMG/M
3300031951\|Ga0315904_10015868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9274	Open in IMG/M
3300032116\|Ga0315903_10384937	Not Available	1148	Open in IMG/M
3300032173\|Ga0315268_11029966	Not Available	830	Open in IMG/M
3300032173\|Ga0315268_11901483	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300032516\|Ga0315273_11032259	Not Available	1050	Open in IMG/M
3300033978\|Ga0334977_0210270	Not Available	974	Open in IMG/M
3300033981\|Ga0334982_0123393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1343	Open in IMG/M
3300033981\|Ga0334982_0133628	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1278	Open in IMG/M
3300033992\|Ga0334992_0473281	Not Available	547	Open in IMG/M
3300034012\|Ga0334986_0072984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2112	Open in IMG/M
3300034012\|Ga0334986_0184540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1178	Open in IMG/M
3300034012\|Ga0334986_0584256	Not Available	535	Open in IMG/M
3300034071\|Ga0335028_0066006	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2421	Open in IMG/M
3300034073\|Ga0310130_0008881	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3628	Open in IMG/M
3300034092\|Ga0335010_0182203	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1299	Open in IMG/M
3300034101\|Ga0335027_0220419	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1332	Open in IMG/M
3300034122\|Ga0335060_0325499	Not Available	833	Open in IMG/M
3300034200\|Ga0335065_0818336	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300034284\|Ga0335013_0098445	All Organisms → Viruses → Predicted Viral	2050	Open in IMG/M
3300034284\|Ga0335013_0120864	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1812	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.73%
Terrestrial	Environmental → Terrestrial	1.27%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	91.08%
Marine	Environmental → Aquatic → Marine	7.64%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.27%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	43.95%
Lentic	Environmental → Aquatic → Freshwater → Lentic	42.68%
Coastal	Environmental → Aquatic → Marine → Coastal	3.18%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.18%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.55%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.27%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.27%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.27%
Creek	Environmental → Aquatic → Freshwater → Creek	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	40.76%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	40.76%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.18%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	3.18%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.18%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.55%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.91%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.27%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.27%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.27%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	34.39%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	19.75%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.46%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.82%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.18%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.18%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.55%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.55%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.55%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.55%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.91%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.91%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.27%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.27%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.27%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.27%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	0.64%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.64%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.64%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.64%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.64%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.64%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.64%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.64%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental	Open in IMG/M
3300002272	Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300003429	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300012729	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental	Open in IMG/M
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020536	Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027688	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12547J11936_10254843	3300000736	Freshwater And Sediment	EMQSHIYWLAWECLRRANVTVPVFGIDFIDSLETVEVLDEEKK*
B570J29579_1083581	3300002272	Freshwater	QQTHIYWLAWECLRRSGAQVPLFNAEFIDSLETVEVLDEEKK*
B570J29032_1097621283	3300002408	Freshwater	RESEMQSHIYWLAWECLRRSGAQVPLWGAEFIDSLETVEVLDEEKK*
B570J29032_1098953973	3300002408	Freshwater	LAYECLRRAGAQIPLWGTEFIDTLDTVEVLDEEKK*
B570J29032_1099030173	3300002408	Freshwater	EHERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLETVEVLDEEKK*
JGI25908J49247_100629501	3300003277	Freshwater Lake	HIYWLAWECLRRSGAQVPLWGAEFIDSLETVEVLDEEKK*
JGI25908J49247_100764521	3300003277	Freshwater Lake	SDIYWLAWECLRRANITVPLYGVEFIDSLETVEVLDEEKK*
JGI25907J50239_10387251	3300003394	Freshwater Lake	HERQTEIYFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
JGI25914J50564_101436362	3300003429	Freshwater Lake	VLRDFERQTEIYWLAWECLRRANVTVPLFGVEFIDSLDTVEVLD
Ga0068876_101842171	3300005527	Freshwater Lake	THIFWLAWECLRKSGAQVPIFGVEFIDSLETVEVLDEEKK*
Ga0068876_102557531	3300005527	Freshwater Lake	WLAWECLRRAGAQVSLSFDEFIDSLDTVEVLDEEKK*
Ga0049083_102102941	3300005580	Freshwater Lentic	AWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK*
Ga0049081_102065631	3300005581	Freshwater Lentic	ERQTEIYFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
Ga0049085_101220453	3300005583	Freshwater Lentic	DIYWLAWECLRRANITVPLYGVEFIDSLETVEVLDEEKK*
Ga0049082_101237161	3300005584	Freshwater Lentic	ERQTEIYWLAWECLRRANVTVPLFGIDFIDTLDVVEVLDEEKK*
Ga0049084_102332761	3300005585	Freshwater Lentic	YFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
Ga0079957_10875633	3300005805	Lake	AYECLRRSGAQIPLWGTEFIDTLETVEVIDEEKK*
Ga0079301_10327903	3300006639	Deep Subsurface	IYWLAWECLRRANVTVPIFGIEFIDTLDTVEVLDEEKK*
Ga0075464_100126815	3300006805	Aqueous	TEIFYLAYECLRRAGAQIPLWGSEFIDTLETVEVLDEEKK*
Ga0075464_102224524	3300006805	Aqueous	AHECLRRANVVVPVFGLEFIDSLDTVEVLDEEKK*
Ga0070748_12203431	3300006920	Aqueous	IFWLAWECLRRANVTVPTFGLEFIETLDTVEVLDDAKN*
Ga0102828_10104671	3300007559	Estuarine	IYFLAHECLRRANVTVPVFGIEFIDSLETVEVLDEEKK*
Ga0105747_13058061	3300007974	Estuary Water	TEIYFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
Ga0114340_10316623	3300008107	Freshwater, Plankton	AYECLRRAGAQIPLWGIEFIDSLETVEVLDDEKK*
Ga0114346_100688012	3300008113	Freshwater, Plankton	VLREHERQTEIFWLAYECLRRAGAQIPVWGIDFIDSLETVEVLDDEKK*
Ga0114336_11370391	3300008261	Freshwater, Plankton	AWECLRRAGAQVSLSFDEFIDSLDTVEVLDEEKK*
Ga0114363_11686161	3300008266	Freshwater, Plankton	REHERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0114876_10753981	3300008448	Freshwater Lake	AYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0114876_11148021	3300008448	Freshwater Lake	HERQTEIFWLAYECLRRAGAQIPLWGIEFIDSLETVEVLDEEKK*
Ga0114973_101290501	3300009068	Freshwater Lake	LAHECLRRANVTVPVFGVEFIDSLETVEVLDEPKK*
Ga0114968_100307914	3300009155	Freshwater Lake	DHERQTEIYYLAHECLRRANVTVPVFGLEFIETLDTVEVLDEEKK*
Ga0114977_101353443	3300009158	Freshwater Lake	LRDHERQTEIYFLAYECLRRANVVVPVFGLEFIETLDTVEVLDEEKK*
Ga0114977_107324432	3300009158	Freshwater Lake	DIFWLAWECLRRANVTVPIYGLEFIDSLETVEVLDEEKK*
Ga0114978_100211786	3300009159	Freshwater Lake	YFLAYECLRRANVVVPVFGLEFIETLDTVEVLDEEKK*
Ga0114981_106535342	3300009160	Freshwater Lake	SDIFWLAWECLRRANVTVPIYGLEFIDSLETVEVLDEEKK*
Ga0114970_100562661	3300009163	Freshwater Lake	QTEIYFLAHECLRRANVVVPVFGIDFIDSLETVEVMDDEKK*
Ga0114975_100561661	3300009164	Freshwater Lake	FLAHECLRRANITVPLFGAEFIDSLETVEVLDEEKK*
Ga0105096_106961772	3300009170	Freshwater Sediment	REHEQQTHIYWLAWECLRRSGAQVSLFGAEFIDSLETVEVLDEEKK*
Ga0114979_104707022	3300009180	Freshwater Lake	DHERQTEIYFLAHECLRRANVVVPVFGIDFIETLDTVEVLDEEKK*
Ga0114974_100168541	3300009183	Freshwater Lake	FWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0114974_100450711	3300009183	Freshwater Lake	KVLRDHERQTEIYYLAHECLRRANVTVPVFGVEFIDSLETVEVLDEPKK*
Ga0114974_101225941	3300009183	Freshwater Lake	RQTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0114974_101754461	3300009183	Freshwater Lake	EHERQTEIFWLAYECLRRAGAQIPLWGTEFIDTLDTVEVLDEEKK*
Ga0114974_103458671	3300009183	Freshwater Lake	DHERQTEIYYLAHECLRRANVTVPVFGIDFIDSLETVEVLDEEKK*
Ga0114976_100022621	3300009184	Freshwater Lake	WECLRRSDVTVPIFGLAFVETLSKVEVLDDEANF*
Ga0114976_101210723	3300009184	Freshwater Lake	ERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0114972_103542342	3300009187	Freshwater Lake	ERQTEIYFLAHECLRRANVVVPVFGIDFIETLDTVEVLDEEKK*
Ga0129333_113353902	3300010354	Freshwater To Marine Saline Gradient	AHECLRRANVTVPIFGLEFIDSLETVEVLDEEKK*
Ga0133913_114772471	3300010885	Freshwater Lake	IYFLAHECLRRANVVVPVFGIDFIDSLETVEVMDDEKK*
Ga0133913_118370111	3300010885	Freshwater Lake	LAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
Ga0133913_118446263	3300010885	Freshwater Lake	FWLAYECLRRAGAQIPIWGTEFIDTLETVEVLDEEKK*
Ga0133913_130527581	3300010885	Freshwater Lake	QSDIFWLAWECLRRANVTVPIFGVEFIDTLETVEVLDEAKN*
Ga0133913_134104061	3300010885	Freshwater Lake	LAHECLRRANVTVPVFGLEFIDSLETVEVLDEEKK*
Ga0157498_10440242	3300012666	Freshwater, Surface Ice	LAWECLRRANVVVPLFGIEFIDSLDTVEVLDEEKK*
Ga0157625_11604511	3300012729	Freshwater	HERQTEIYWLAHECLRRANVTVPVFGIEFIDSLDTVEVLDEKKK*
Ga0164294_101831471	3300013006	Freshwater	QTEIYFLAHECLRRANVTVPVFGIEFIDSLETVEVLDEEKK*
Ga0164294_103170021	3300013006	Freshwater	TEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK*
Ga0177922_104456723	3300013372	Freshwater	FWLAHECLRRANVVVPVFGPEFVDTLDTVEVLDDEKN*
Ga0177922_104462512	3300013372	Freshwater	IYFLAHECLRRANVTVPVFGIDFIDSLETVEVLDEEKK*
Ga0177922_105167431	3300013372	Freshwater	QSHIYWLAWECLRRSGAQVPLWGAEFIDSLETVEVLDEEKK*
Ga0177922_108096451	3300013372	Freshwater	QTEIYFLAHECLRRANITVPLFGAEFIDSLETVEVLDEPKK*
Ga0177922_112759091	3300013372	Freshwater	FLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK*
Ga0181338_10243481	3300015050	Freshwater Lake	EIYYLAHECLRRANVTVPVFGVEFIDSLETVEVLDEEKK*
Ga0181338_10665501	3300015050	Freshwater Lake	RQTEIYWLAWECLRRANVTVPLFGIEFIDLLDVVEVLDEEKK*
Ga0181364_10234522	3300017701	Freshwater Lake	YWLAWECLRRANVTVPVFGIEFIDSLDTVEVLDEEKK
Ga0181364_10504452	3300017701	Freshwater Lake	YWLAWECLRRANVTVPFFGVEFIDSLDTVEVLDEEKK
Ga0181364_10725692	3300017701	Freshwater Lake	WLAWECLRRANITVPLYGVEFIDSLETVEVLDEEKK
Ga0181364_10751601	3300017701	Freshwater Lake	LAWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK
Ga0181347_10342123	3300017722	Freshwater Lake	IYYLAHECLRRANVTVPIFGLEFIDSLDVVEVLDEEKK
Ga0181347_10853791	3300017722	Freshwater Lake	FLAHECLRRANVTVPIFGAEFIDSLETVEVLDEEKK
Ga0181362_10148093	3300017723	Freshwater Lake	QTEIYWLAWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK
Ga0181362_10541551	3300017723	Freshwater Lake	LREHERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0181365_10307241	3300017736	Freshwater Lake	REGDYFLAHECLRRANVTVPIFGAEFIDSLETVEVLDEEKK
Ga0181365_10462831	3300017736	Freshwater Lake	WLAWECLRRANVTVPLFGIEFIDLLDTVEVLDEEKK
Ga0181365_10520041	3300017736	Freshwater Lake	RQTEIYWLAWECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK
Ga0181365_10676421	3300017736	Freshwater Lake	IYFLAHECLRRANVTVPIFGLEFIDSLETVEVLDEEKK
Ga0181365_10861711	3300017736	Freshwater Lake	IFWLAYECLRRAGAQMPIWGTEFIDTLETVEVLDEEKK
Ga0181344_10268593	3300017754	Freshwater Lake	HERQTEIFWLAYECLRRAGAQIPLWGTEFIDTLETVEVLDEEKK
Ga0181344_11969391	3300017754	Freshwater Lake	ERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0181356_10247371	3300017761	Freshwater Lake	YYLAHECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK
Ga0181343_12170621	3300017766	Freshwater Lake	EHERQTEIFWIAYECLRRAGAQIPLWGTEFIDTLETVEVLDEEKK
Ga0181358_10816643	3300017774	Freshwater Lake	DHERQTEIYFLAHECLRRANITVPLFGAEFIDSLETVEVLDEEKK
Ga0181358_10908991	3300017774	Freshwater Lake	EIYWLAWECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK
Ga0181358_11133831	3300017774	Freshwater Lake	KVMEHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0181357_11865842	3300017777	Freshwater Lake	LAHECLRRANVTVPIFGAEFIDSLETVEVLDEEKK
Ga0181357_11880751	3300017777	Freshwater Lake	TEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0181349_11085993	3300017778	Freshwater Lake	EIYWLAWECLRRANVTVPLFGIEFIDLLDVVEVLDEEKK
Ga0181346_10672963	3300017780	Freshwater Lake	YFLAHECLRRANVTVPIFGAEFIDSLETVEVLDDEKK
Ga0181346_11375011	3300017780	Freshwater Lake	DSEMQSTIYWLAWECLRRANVTVPLFGIEFIDTLDTVEVLDEEKK
Ga0181348_10170901	3300017784	Freshwater Lake	RDFERQTEIYWLAWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK
Ga0181359_10896801	3300019784	Freshwater Lake	KLAWECLRRASITVPLFGTEFIDSLETVEVLDEEKK
Ga0181359_12019751	3300019784	Freshwater Lake	IYWLAWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK
Ga0194115_101847233	3300020183	Freshwater Lake	EIFYLAYECLRRAGAQIPLWGVEFIDTLDTVEVLDDEKK
Ga0194119_100495436	3300020220	Freshwater Lake	WLAWECLRRANVTVPVFGLDFIDTLDTVEVLDDEKK
Ga0208235_10073393	3300020530	Freshwater	LAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0207939_10055853	3300020536	Freshwater	EHERQTEIFWLAYECLRRAGAQIPLWGSEFIDTLETVEVLDEEKK
Ga0213922_10092511	3300021956	Freshwater	WLAWECLRRANVTVPMFGAEFIDSLDTVEVLDDSKN
Ga0222713_108235222	3300021962	Estuarine Water	EHERQTEIFWLAYECLRRAGAQIPLWGVEFIDSLDTVEVLDEEKK
Ga0222712_105613782	3300021963	Estuarine Water	QTEIFWLAYECLRRAGAQVPLWGTEFIDTLETVEVLDEEKK
Ga0181354_11348582	3300022190	Freshwater Lake	MQSTIYWLAWECLRRANVTVPVFGLEFIDSLETVEVLDEEKK
Ga0181351_11644981	3300022407	Freshwater Lake	GIAHECLRRANVTVPMFGIEFIDSLETVEVLDEEKK
Ga0181351_11864531	3300022407	Freshwater Lake	KRRLAWECLRRSGAQVPLWGAEFIDSLETVEVLDEEKK
Ga0181351_12223802	3300022407	Freshwater Lake	DHERQTEIYWLAWECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK
Ga0214921_102772192	3300023174	Freshwater	VLREHERQTEIFWLAYECLRRAGAQIPIWGTEFIDTLETVEVLDEEKK
Ga0244775_104195821	3300024346	Estuarine	LAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0244775_115152112	3300024346	Estuarine	EIYWLAWECLRRANVTVPLFGVEFIDSLDTVEVLDEEKK
Ga0244775_115714111	3300024346	Estuarine	SDIFWLAWECLRRAGGQVSLSFDEFIDSLDTVEVLDEEKK
Ga0244776_106196401	3300024348	Estuarine	TEIYFLAHECLRRANVVVPVFGSEFIESLDTVEVLDEEKN
Ga0209552_11509341	3300027563	Freshwater Lake	TEIYFLAHECLRRANVTVPIFGIEFIDSLEVVEVLDEEKK
Ga0209357_11631502	3300027656	Freshwater Lake	DHERQTEIYFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0208975_10586943	3300027659	Freshwater Lentic	FLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0209553_10891633	3300027688	Freshwater Lake	IFWLAYECLRRAGAQIPLWGTEFIDTLDTVEVLDEEKK
Ga0209704_10270543	3300027693	Freshwater Sediment	LAWECLRKSGAQVPVFGVEFIDSLETVEVLDEEKK
Ga0209443_11276583	3300027707	Freshwater Lake	YIYWLAWECLRRANITVPLYGVEFIDSLETVEVLDEEKK
Ga0209442_10138711	3300027732	Freshwater Lake	DSEMQSTIYWLAWECLRRANVTVPIFGAEFIDSLETVEVLDEEKK
Ga0209442_12810261	3300027732	Freshwater Lake	KQSDIYWLAWECLRRANITVPLYGVEFIDSLETVEVLDEEKK
Ga0209297_13640131	3300027733	Freshwater Lake	DEKQSDIFWLAWECLRRANVTVPIYGLEFIDSLETVEVLDEEKK
Ga0209190_10194384	3300027736	Freshwater Lake	FLAHECLRRANITVPVFGAEFIDSLETVEVLDEEKK
Ga0209189_13512002	3300027747	Freshwater Lake	IYWLAWECLRKSGVTVPIFGVEFLDSLELVEVLDDEKK
Ga0209596_10091251	3300027754	Freshwater Lake	FWLAWECLRRANITVPIFGTEFIDTLDTVEVLEDEKK
Ga0209296_10201671	3300027759	Freshwater Lake	TEIYFLAHECLRRANITVPLFGAEFIDSLETVEVLDEEKK
Ga0209296_13846092	3300027759	Freshwater Lake	VLRDHERQTEIYYLAHECLRRANVTVPVFGVEFIDSLETVEVLDEPKK
Ga0209246_100665363	3300027785	Freshwater Lake	QQTHIYWLAWECLRRASITVPLFGTEFIDSLETVEVLDEEKK
Ga0209246_101850262	3300027785	Freshwater Lake	FWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0209246_101898501	3300027785	Freshwater Lake	EIYYLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0209246_104107511	3300027785	Freshwater Lake	WLAWECLRRANVVVPLFGLEFIDSLDTVEVLDEEKK
Ga0209972_100974513	3300027793	Freshwater Lake	TEIFWLAYECLRRAGAQIPLWGIEFIDSLETVEVLDDEKK
Ga0209353_100085777	3300027798	Freshwater Lake	LAWECLRRANVTVPLFGIEFIDLLDTVEVLDEEKK
Ga0209353_102367733	3300027798	Freshwater Lake	QTEIYYLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0209354_100061847	3300027808	Freshwater Lake	EIYYLAHECLRRANVVVPVFGSEFIESLDTVEVLDEEKN
Ga0209400_10553271	3300027963	Freshwater Lake	LAWECLRRANVTIPLFGTEFIDSLELVEVLEEEKK
Ga0209191_11140771	3300027969	Freshwater Lake	IFWIAYECLRRAGAQIPLWGTEFIDTLETVEVLDEEKK
Ga0209401_10210811	3300027971	Freshwater Lake	EIFWLAYECLRRAGAQIPIWGSEFIDTLETVEVLDEEKK
Ga0315907_109598992	3300031758	Freshwater	QSDIFWLAWECLRRAGGQVSLSFDEFIDSLETVEVLDEEKK
Ga0315288_110575001	3300031772	Sediment	QTEIYYLAHECLRRAGVTVPLFGLEFIDTLDTVEVLDEEKK
Ga0315288_116335981	3300031772	Sediment	TEIYFLAHECLRRANVVVPVFGSEFIETLDTVEVLDEEKN
Ga0315899_115031052	3300031784	Freshwater	TEIFWLAYECLRRAGAQIPLWGVEFIDSLDTVEVLDEEKK
Ga0315904_1001586819	3300031951	Freshwater	FWLAYECLRRAGAQIPLWGIEFIDSLETVEVLDDEKK
Ga0315903_103849373	3300032116	Freshwater	FWLAYECLRRAGAQIPLWGVEFIDTLDTVEVLDDEKK
Ga0315268_110299661	3300032173	Sediment	TEIYFLAHECLRRANVTVPVFGIEFIDSLETVEVLDEEKK
Ga0315268_119014832	3300032173	Sediment	HERQTEIYWLAWECLRRANVTVPLFGIEFIDLLDVVEVLDEEKK
Ga0315273_110322591	3300032516	Sediment	LAHECLRRANVVVPVFGSEFIETLDTVEVLDEEKN
Ga0334977_0210270_2_142	3300033978	Freshwater	RDHERQTEIYFLAHECLRRANVTVPIFGIEFIDSLETVEVLDEEKK
Ga0334982_0123393_1_135	3300033981	Freshwater	DEKQSDIFWLAWECLRRAGGQVSLSFDEFIDSLETVEVLDEEKK
Ga0334982_0133628_1144_1278	3300033981	Freshwater	HEQQTHIFWLAWECLRKSGAQVPVFGVEFIDSLETVEVLDEEKK
Ga0334992_0473281_428_547	3300033992	Freshwater	HIYWLAWECLRRASITVPLFGTEFIDSLETVEVLDEEKK
Ga0334986_0072984_1987_2112	3300034012	Freshwater	QTEIFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0334986_0184540_1044_1178	3300034012	Freshwater	DEKQSDIYWLAWECLRRAGITVPTFGIDFIDSLETVEVMDEEKK
Ga0334986_0584256_415_534	3300034012	Freshwater	EIFWLAYECLRRANAQIPLWGTEFIDTLETVEVLDEEKK
Ga0335028_0066006_2_157	3300034071	Freshwater	ISKVLREHERQTEIFWLAYECLRRAGVQIPVWGVDFIDSLETVEVLDEEKK
Ga0310130_0008881_1_111	3300034073	Fracking Water	WLAYECLRRSGAQIPLWGTEFIDTLETVEVLDEEKK
Ga0335010_0182203_1182_1298	3300034092	Freshwater	IFWLAYECLRRAGAQIPLWGSEFIDTLDTVEVLDEEKK
Ga0335027_0220419_3_146	3300034101	Freshwater	LREEEKQSDIYWLAWECLRRAGAQVSLFGNEFIDSLETVEVLDEEKK
Ga0335060_0325499_726_833	3300034122	Freshwater	LAYECLRRAGAQIPLWGIEFIDSLDTVEVLDDEKK
Ga0335065_0818336_396_518	3300034200	Freshwater	TEIYYLAHECLRRANVTVPVFGVEFIDSLETVEVLDEEKK
Ga0335013_0098445_1_114	3300034284	Freshwater	YWLAHECLRRANVTVPVFGIEFIDSLDTVEVLDEEKK
Ga0335013_0120864_1683_1811	3300034284	Freshwater	RQTEIYWLAHECLRRANVTVPVFGIEFIDSLDTVEVLDEEKK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F042868

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences