NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F042975

Metagenome Family F042975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042975
Family Type Metagenome
Number of Sequences 157
Average Sequence Length 48 residues
Representative Sequence GALDEARALAERYAAAARADLMAFERSPYREALEALPDFILARDH
Number of Associated Samples 139
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.72 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.975 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(9.554 % of family members)
Environment Ontology (ENVO) Unclassified
(31.847 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(31.847 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF01653DNA_ligase_aden 59.24
PF12826HHH_2 5.73
PF03120DNA_ligase_OB 4.46
PF00144Beta-lactamase 3.82
PF14520HHH_5 1.91
PF00072Response_reg 0.64
PF12796Ank_2 0.64
PF00596Aldolase_II 0.64
PF09363XFP_C 0.64
PF01548DEDD_Tnp_IS110 0.64
PF04014MazE_antitoxin 0.64
PF14684Tricorn_C1 0.64
PF04264YceI 0.64
PF14534DUF4440 0.64
PF13365Trypsin_2 0.64
PF13516LRR_6 0.64
PF05433Rick_17kDa_Anti 0.64
PF13361UvrD_C 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG0272NAD-dependent DNA ligaseReplication, recombination and repair [L] 63.69
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 3.82
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 3.82
COG2367Beta-lactamase class ADefense mechanisms [V] 3.82
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.64
COG3547TransposaseMobilome: prophages, transposons [X] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.25 %
UnclassifiedrootN/A26.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_115056451All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300001213|JGIcombinedJ13530_106545522All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300003989|Ga0055473_10287431All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300003994|Ga0055435_10094808All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300004007|Ga0055476_10190585All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300004011|Ga0055460_10141934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes716Open in IMG/M
3300004065|Ga0055481_10462694All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300004114|Ga0062593_100492848All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300004146|Ga0055495_10160688All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005330|Ga0070690_100321619All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300005332|Ga0066388_100064278All Organisms → cellular organisms → Bacteria → Proteobacteria3923Open in IMG/M
3300005334|Ga0068869_100049230All Organisms → cellular organisms → Bacteria3050Open in IMG/M
3300005343|Ga0070687_101155227All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005355|Ga0070671_100949266All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005445|Ga0070708_100897962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium832Open in IMG/M
3300005446|Ga0066686_10661039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria709Open in IMG/M
3300005471|Ga0070698_100865306All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005544|Ga0070686_101042744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300005545|Ga0070695_100782937All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005546|Ga0070696_100980913All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005552|Ga0066701_10681171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300005569|Ga0066705_10932944All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005615|Ga0070702_100198600All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300005764|Ga0066903_107364920All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005830|Ga0074473_11109876All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005833|Ga0074472_11331425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1445Open in IMG/M
3300005836|Ga0074470_10422762Not Available565Open in IMG/M
3300005842|Ga0068858_101146057All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300005842|Ga0068858_101576009All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300006186|Ga0075369_10403279All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300006237|Ga0097621_100693597All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300006796|Ga0066665_10271206All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300006844|Ga0075428_100259426All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300006844|Ga0075428_102644396All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006845|Ga0075421_100854515All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300006845|Ga0075421_100935117All Organisms → cellular organisms → Bacteria → Proteobacteria986Open in IMG/M
3300006846|Ga0075430_101095621All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300006854|Ga0075425_102254469All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006871|Ga0075434_100169022All Organisms → cellular organisms → Bacteria2206Open in IMG/M
3300006880|Ga0075429_100129499All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300007076|Ga0075435_100039829All Organisms → cellular organisms → Bacteria3751Open in IMG/M
3300007255|Ga0099791_10671334All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300009012|Ga0066710_100141212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3329Open in IMG/M
3300009012|Ga0066710_101330232All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300009012|Ga0066710_102329606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300009038|Ga0099829_10961716All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300009090|Ga0099827_10802972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300009090|Ga0099827_11039939All Organisms → cellular organisms → Bacteria → PVC group711Open in IMG/M
3300009091|Ga0102851_12471145All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009094|Ga0111539_13293021All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300009111|Ga0115026_11955692Not Available501Open in IMG/M
3300009131|Ga0115027_11687829All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009146|Ga0105091_10203067All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300009162|Ga0075423_10307781All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300009455|Ga0114939_10130361All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300009506|Ga0118657_10188411All Organisms → cellular organisms → Bacteria2887Open in IMG/M
3300009609|Ga0105347_1098078All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300009792|Ga0126374_10745681Not Available742Open in IMG/M
3300009799|Ga0105075_1028176All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon629Open in IMG/M
3300009822|Ga0105066_1083044All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300010337|Ga0134062_10690126Not Available535Open in IMG/M
3300010360|Ga0126372_11686483All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300010397|Ga0134124_12667890Not Available543Open in IMG/M
3300010399|Ga0134127_12277410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter capsici621Open in IMG/M
3300010399|Ga0134127_13653485All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla505Open in IMG/M
3300010400|Ga0134122_11687256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300010401|Ga0134121_11024197All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300010401|Ga0134121_12442100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300010412|Ga0136852_11082661Not Available762Open in IMG/M
3300011443|Ga0137457_1347634All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012096|Ga0137389_10130948All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300012202|Ga0137363_11271402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300012362|Ga0137361_10902063All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300012532|Ga0137373_10117555All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica2294Open in IMG/M
3300012685|Ga0137397_11115142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300012918|Ga0137396_10411139All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300012922|Ga0137394_10595581All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300012931|Ga0153915_12017784Not Available675Open in IMG/M
3300014311|Ga0075322_1120106Not Available627Open in IMG/M
3300014325|Ga0163163_12690574All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300014881|Ga0180094_1158543Not Available530Open in IMG/M
3300014881|Ga0180094_1166144Not Available517Open in IMG/M
3300015077|Ga0173483_10773412All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300015253|Ga0180081_1060662Not Available664Open in IMG/M
3300015259|Ga0180085_1233346Not Available543Open in IMG/M
3300015371|Ga0132258_11117475Not Available1992Open in IMG/M
3300015371|Ga0132258_11923889All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1489Open in IMG/M
3300015371|Ga0132258_13500293All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300017959|Ga0187779_10356656Not Available946Open in IMG/M
3300017997|Ga0184610_1264077All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon571Open in IMG/M
3300018058|Ga0187766_11484896All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300018063|Ga0184637_10418755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300018064|Ga0187773_10021287All Organisms → cellular organisms → Bacteria2782Open in IMG/M
3300018083|Ga0184628_10405666Not Available712Open in IMG/M
3300018084|Ga0184629_10316340All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300018089|Ga0187774_11091238All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes564Open in IMG/M
3300018468|Ga0066662_12909005All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300019487|Ga0187893_10789508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300021090|Ga0210377_10542795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300022221|Ga0224506_10106903Not Available1344Open in IMG/M
3300025318|Ga0209519_10215914All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300025324|Ga0209640_10273569All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300025327|Ga0209751_10908357All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300025551|Ga0210131_1086270Not Available539Open in IMG/M
3300025923|Ga0207681_10900367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3741Open in IMG/M
3300025935|Ga0207709_10996023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300025938|Ga0207704_10934470Not Available731Open in IMG/M
3300025940|Ga0207691_11274064Not Available608Open in IMG/M
3300025960|Ga0207651_10987653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300025981|Ga0207640_10220982Not Available1450Open in IMG/M
3300026041|Ga0207639_11622108Not Available607Open in IMG/M
3300026075|Ga0207708_11162935All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300026530|Ga0209807_1335267All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300026538|Ga0209056_10055797All Organisms → cellular organisms → Bacteria3497Open in IMG/M
3300026540|Ga0209376_1034472All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300026548|Ga0209161_10353371Not Available658Open in IMG/M
3300027675|Ga0209077_1145855Not Available660Open in IMG/M
3300027843|Ga0209798_10524168All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300027869|Ga0209579_10100063All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300027907|Ga0207428_11145324Not Available542Open in IMG/M
3300027909|Ga0209382_11201574Not Available775Open in IMG/M
3300029987|Ga0311334_11093465All Organisms → cellular organisms → Bacteria → PVC group666Open in IMG/M
3300029989|Ga0311365_11296667Not Available627Open in IMG/M
3300030620|Ga0302046_10792286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales763Open in IMG/M
3300030838|Ga0311335_10406300Not Available937Open in IMG/M
3300030838|Ga0311335_11138277Not Available559Open in IMG/M
3300031847|Ga0310907_10444527Not Available684Open in IMG/M
3300031873|Ga0315297_11730508All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031949|Ga0214473_11311929Not Available742Open in IMG/M
3300031997|Ga0315278_11557942Not Available634Open in IMG/M
3300032005|Ga0307411_12154685All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium522Open in IMG/M
3300032017|Ga0310899_10326876All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300032174|Ga0307470_10370725All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300032258|Ga0316191_11346472All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032276|Ga0316188_10121958All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300032397|Ga0315287_11801219Not Available681Open in IMG/M
3300032770|Ga0335085_10862237Not Available991Open in IMG/M
3300033158|Ga0335077_11086017All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300033408|Ga0316605_10451752All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300033414|Ga0316619_11073613All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300033416|Ga0316622_101174253All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300033416|Ga0316622_101679536Not Available740Open in IMG/M
3300033416|Ga0316622_102134305Not Available650Open in IMG/M
3300033416|Ga0316622_102841985All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales554Open in IMG/M
3300033418|Ga0316625_102444451Not Available527Open in IMG/M
3300033419|Ga0316601_102345094All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300033429|Ga0316193_10430918All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300033429|Ga0316193_11623922Not Available513Open in IMG/M
3300033481|Ga0316600_10999896All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300033483|Ga0316629_10762200Not Available739Open in IMG/M
3300033501|Ga0326732_1086044Not Available515Open in IMG/M
3300033521|Ga0316616_100094322Not Available2608Open in IMG/M
3300033521|Ga0316616_101048431All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300033521|Ga0316616_102841130Not Available652Open in IMG/M
3300033550|Ga0247829_11608167All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300034177|Ga0364932_0415031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300034178|Ga0364934_0341372Not Available567Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.73%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.46%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.55%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.55%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.91%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.27%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.27%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.27%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.27%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.27%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.27%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.27%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.64%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.64%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.64%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.64%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.64%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.64%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.64%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.64%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.64%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.64%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003989Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004065Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004146Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300022221Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033501Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fractionEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11505645113300000956SoilDRVSRDELVHAARENGALEEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH
JGIcombinedJ13530_10654552213300001213WetlandEARRLAEDYAEHARRDLAGFERSAYSEALRALPDFILGRDH*
Ga0055473_1028743123300003989Natural And Restored WetlandsVSRDEIVRLARERGALDEARVLAEQYAAAARGDLMVFEPSSYRDALEALPGFILARDH*
Ga0055435_1009480833300003994Natural And Restored WetlandsDRGFQRVSPDDVARLARECGALDEARSLAEEYAAAARADLLAFDRSPYREALAALPDFILARDH*
Ga0055476_1019058513300004007Natural And Restored WetlandsDRADQLLELARTSGALSEAQRLAEDYAEAARRDLLAFEGSPFRDALEALPGFVLARDH*
Ga0055460_1014193423300004011Natural And Restored WetlandsGFSRVSREELVRMARECGALDEASRMAEEYADLALRELLAFEPSPYREALEALPGFILARDH*
Ga0055481_1046269413300004065Natural And Restored WetlandsGDAEKVRIVLEDRGFGRVSRDEIVRLARERGALDEARVLAEQYAAAARGDLMVFEPSSYRDALEALPGFILARDH*
Ga0062593_10049284823300004114SoilRALAERYAAAARADLAGFERSPYREALEALPDFILARDH*
Ga0055495_1016068823300004146Natural And Restored WetlandsRVTREELVKMARECGALDEARDLAEGYAAAARRDLVAFEPSEYREALEALPGFILARDY*
Ga0070690_10032161913300005330Switchgrass RhizosphereLDEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH*
Ga0066388_10006427813300005332Tropical Forest SoilEARAQAERYAAAAGADLVGFERSPYREALEALPNLLLARDH*
Ga0068869_10004923033300005334Miscanthus RhizosphereEARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH*
Ga0070687_10115522713300005343Switchgrass RhizosphereEDRGFSRVAEDELVSLAVEHGAILEARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH*
Ga0070671_10094926623300005355Switchgrass RhizosphereELLRLAREHGALDEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH*
Ga0070708_10089796213300005445Corn, Switchgrass And Miscanthus RhizosphereATAAAERYAESARQDLGAFGPSSYREALERLPHYILSRHH*
Ga0066686_1066103923300005446SoilALEEARAQAERYAVAARADLAGFERSPYREALEVLPDFILARDH*
Ga0070698_10086530613300005471Corn, Switchgrass And Miscanthus RhizosphereENGALEEARAQAERYATAARADLASFERSPYREALQVLPDFILARDH*
Ga0070686_10104274423300005544Switchgrass RhizosphereLRLAREHGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH*
Ga0070695_10078293723300005545Corn, Switchgrass And Miscanthus RhizosphereLLRLAREHGALDEARALAERYATAARADLTGFERSPYREALEALPDFILARDH*
Ga0070696_10098091323300005546Corn, Switchgrass And Miscanthus RhizosphereDEARALAERYAAAARADLTGFERSPYREALEALPDFIVARDH*
Ga0066701_1068117123300005552SoilFGRVSREEIVRLAREHGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH*
Ga0066705_1093294423300005569SoilRKLAERYAEAARRELAVFERSPYREALAVLPDFILGRDH*
Ga0070702_10019860013300005615Corn, Switchgrass And Miscanthus RhizosphereDEARALAERYAEAARKDLAVFDRSPFREALAVLPDFILSRDH*
Ga0066903_10736492013300005764Tropical Forest SoilVSREDLVRLARDCGALEEARALAERCADEARASLLAFEPSPYREALEALPGFILARDH*
Ga0074473_1110987623300005830Sediment (Intertidal)LARECGALDEARAMAERYADLARRELLAFDPSPYRDALEALPGFILARDH*
Ga0074472_1133142513300005833Sediment (Intertidal)ELVRMARECGALDQALEMAERYADLARRDLLAFDPSPYREALEALPGFILARDH*
Ga0074470_1042276223300005836Sediment (Intertidal)VVKDRGFERVSPDDVARLARECGALDEARSLAEEYAAAARADLLALDRSPYREALAALPDFILARDH*
Ga0068858_10114605723300005842Switchgrass RhizosphereDEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH*
Ga0068858_10157600913300005842Switchgrass RhizosphereAERYAAAARADLAGFERSPYREALEALPEFILARDH*
Ga0075369_1040327923300006186Populus EndosphereEARALAARYAEAARKDLAVFDRSPFREALAVLPDFILSRDH*
Ga0097621_10069359713300006237Miscanthus RhizosphereAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH*
Ga0066665_1027120623300006796SoilGMPRDNGVLEEARAQAERYAVADQSDLAGFERSPYREALEVLPDFILARDH*
Ga0075428_10025942613300006844Populus RhizosphereRLARECGALDEAHGMAERYAEEARASLLAFEASPYREALEALPGFILARDH*
Ga0075428_10264439613300006844Populus RhizosphereARKHGAIDEARSQAERYAAAARRDLAAFDGSAYRDALEMLPDFILARDH*
Ga0075421_10085451523300006845Populus RhizosphereCGALEEARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH*
Ga0075421_10093511733300006845Populus RhizosphereALAARYAEAARKDLSVFERSPFREALAVLPDFILGRDH*
Ga0075430_10109562113300006846Populus RhizosphereGALDEARALAERYAAAARADLMAFERSPYREALEALPDFILARDH*
Ga0075425_10225446913300006854Populus RhizosphereSLAVEHGAILEARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH*
Ga0075434_10016902233300006871Populus RhizosphereRYAEAARKDLAVFDRSPFREALAVLPDFILSRDH*
Ga0075429_10012949913300006880Populus RhizosphereRAFARVSRDELVRLARECGALDEAHGMAERYAEEARASLLAFEASPYREALEALPGFILARDH*
Ga0075435_10003982913300007076Populus RhizosphereFERVSREDLLRLAREHGALEEARALAARYADAARKDLAAFERSPFREALAVLPDFILSRDH*
Ga0099791_1067133423300007255Vadose Zone SoilELVRAARENGALEEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH*
Ga0066710_10014121243300009012Grasslands SoilGRVSREEIVRLAREHGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH
Ga0066710_10133023233300009012Grasslands SoilLADRGFGRVSREELLLLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPDFILARDH
Ga0066710_10232960613300009012Grasslands SoilRVLAERYAASARQDLLAFERSPYRDALRVLPDFILARDH
Ga0099829_1096171623300009038Vadose Zone SoilALDEARALAETYAEAAKRDLSAFERSPYREALEVLPDFILARDH*
Ga0099827_1080297213300009090Vadose Zone SoilLAETYAEAARRDLSAFERSPYREALEVLPDFILARDH*
Ga0099827_1103993913300009090Vadose Zone SoilEATAAAERYAESARQDLGAFEPSSYREALERLPHCILSRHY*
Ga0102851_1247114523300009091Freshwater WetlandsRDCGALDEAREMAERYADLARRDLLAFEPSPYREALDALPGFILSRDH*
Ga0111539_1329302123300009094Populus RhizosphereERYAAAARADLAGFERSPYREALEALPDFILARDH*
Ga0115026_1195569223300009111WetlandALAEARALAETYANAARQDLVGFPPSVYRDALIVLPDFILARDH*
Ga0115027_1168782923300009131WetlandEMAERYAALARRDLLAFDPSPYRDALLALPGFILARDH*
Ga0105091_1020306713300009146Freshwater SedimentELVKMARECGALDQARDLAEGYAAAARRDLLVFEPSEYREALEALPGFILARDH*
Ga0075423_1030778123300009162Populus RhizosphereAERYAAAARADLAGFERSPYREALQVLPDFILARDH*
Ga0114939_1013036113300009455GroundwaterARECGALDEARAMAERYADAARDELRSFEPSEYKDALEALPGFILARDH*
Ga0118657_1018841133300009506Mangrove SedimentGALEEAGSLAERYAEAARRDLRIFEPSPYREALEALPGFILARDH*
Ga0105347_109807813300009609SoilMAERYADEARASLLAFEPSPYREALDALPGFILARDH*
Ga0126374_1074568113300009792Tropical Forest SoilRMARENGAIEEARAQAERYAAAAGADLVGFERSPYREALEALPNLLLARDH*
Ga0105075_102817623300009799Groundwater SandERASRDELVRAARDNGALEEARVQAERYAAAARADLAGFERSPYREALEALPDFILARDH
Ga0105066_108304413300009822Groundwater SandQYAEMARRDLLVFDRSPYREALEILPNFILARDH*
Ga0134062_1069012613300010337Grasslands SoilQAERYAAAARADLAGFDRSPYREALQALPDFILARDH*
Ga0126372_1168648323300010360Tropical Forest SoilVTREELLRLAREHGALEEARALAERYAEMARKDLAIFERSPFREALVVLPDFILSRDH*
Ga0134124_1266789013300010397Terrestrial SoilEARALAERYADSARQQLRVFEPSAYRDALEALPDFILARDH*
Ga0134127_1227741013300010399Terrestrial SoilPPAAEMVGAVLEDRGFDRVSRDELLRLAREHGALEEARLLAERYAAAARHDLAGFERTPYREALEALPEFILARNY*
Ga0134127_1365348523300010399Terrestrial SoilARALAERYAEQARRDLQPFERSSYREALEALPDFILARDH*
Ga0134122_1168725623300010400Terrestrial SoilREHGALDEARALAETYAEAARRDLSGFERSPYREALEALPDFILARDH*
Ga0134121_1102419713300010401Terrestrial SoilELLKLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPDFILARDH*
Ga0134121_1244210013300010401Terrestrial SoilLEDARALAARYAEAARKDLAVFERSPFREALAVLPDFILSRDH*
Ga0136852_1108266113300010412Mangrove SedimentRGFTRVPAAEIARLARETGALAEARSLAEDYAQAARQDLVGFEPSIYRDALAVLPDFILARDH*
Ga0137457_134763423300011443SoilAVEYAARARRDLQVFERSKYREALEALPDFILSRDH*
Ga0137389_1013094813300012096Vadose Zone SoilRVSRDELVRAARENGALEEARAQAERYAAAARDDLAGFDRSPYREALQALPDFILARDH*
Ga0137363_1127140213300012202Vadose Zone SoilHGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH*
Ga0137361_1090206313300012362Vadose Zone SoilARALAERYAEAARRDLAAFERSPYRDALEVLPGFILSRDH*
Ga0137373_1011755513300012532Vadose Zone SoilREHGALDEARALAQRYAEAARRDLAVFDRSPYREALEVLPDFILSRDH*
Ga0137397_1111514223300012685Vadose Zone SoilGALDEAQALAETYAEKARRDLAVFERSPYREALEVLPDFILARDH*
Ga0137396_1041113923300012918Vadose Zone SoilEEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH*
Ga0137394_1059558123300012922Vadose Zone SoilFERVSRDELVRAARENGALEEARAQAERYAAAARADLAGFDRSPFREALQALPDFILARDH*
Ga0153915_1201778423300012931Freshwater WetlandsEMAERYADLARRDLLAFDPSPYREALDALPGFILSRDH*
Ga0075322_112010623300014311Natural And Restored WetlandsELAERYAEEARRDLLAFEPSEYRDALEALPGFILARDH*
Ga0163163_1269057423300014325Switchgrass RhizosphereGFDRVSPDAIVRLARDCGALEEARALAERYAEAARQDLLAFDRSPCREALEALPGFILARDH*
Ga0180094_115854323300014881SoilDMAERYAELARRDLLAFEPSPYRDALEALPGFILARDH*
Ga0180094_116614413300014881SoilCGALDQAHDMAERYADEARASLLAFEPSPYREALEALPSFILARDH*
Ga0173483_1077341223300015077SoilVRLARDCGALEEARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH*
Ga0180081_106066223300015253SoilVRLARECGALDEAHGMAERHADEARASLLAFEPSPYREALDALPGFILARDY*
Ga0180085_123334613300015259SoilELVRMARDCGALEEAREMAERYADLARRDLLAFDPSPYRDALDALPGFILGRDH*
Ga0132258_1111747513300015371Arabidopsis RhizosphereLRRGGPAAAELVASVLAERGFGRVTREELVRMARDNGALDEARAQAERYAAAARADLAGFDRSPYREALDVLPTLLLARDH*
Ga0132258_1192388933300015371Arabidopsis RhizosphereGALDEPRALAEEYADNARRELLVFDRSPYREALEILPDFILARDH*
Ga0132258_1350029313300015371Arabidopsis RhizosphereALEEARAMAERYADEARESLLAFEPSPYREALDALPGFILARDH*
Ga0187779_1035665613300017959Tropical PeatlandLAEVYADRARRDLALFDRSAYREALEILPDFILARDH
Ga0184610_126407713300017997Groundwater SedimentQAERYAAAARADLAGFERSPYREALQALPDFILARDH
Ga0187766_1148489613300018058Tropical PeatlandRVTREELVRMARDCGALEEARALAERYADEACRELLAFDPSEYREALSALPGFILARDH
Ga0184637_1041875513300018063Groundwater SedimentDRVSQVLADRGFGRVTREEIVKLAREHGALDEARALAETYAEAARRDLAVFDRSAYREALEALPDFILARDH
Ga0187773_1002128713300018064Tropical PeatlandTMAERFAQAARRELLAFEPSSYRDALEALPGFILARDH
Ga0184628_1040566623300018083Groundwater SedimentRDELVRLARECGALDEANEMAERYAALARRDLLAFEPSPYRDALEALPGFILARDH
Ga0184629_1031634023300018084Groundwater SedimentEHGALDEARALAERYAEAARKDLAVFDRSPYREALEVLPDFILARDH
Ga0187774_1109123823300018089Tropical PeatlandARDCGALDDARAMAERFAQAARRELLAFEPSSYRDALEALPGFILARDH
Ga0066662_1290900523300018468Grasslands SoilDNGALEEARAQAERYAAAARADLAGFDRSPYREALEALPDFILARDH
Ga0187893_1078950823300019487Microbial Mat On RocksEEYADAARRDLLVFERSPYREALAALPDFILARDH
Ga0210377_1054279523300021090Groundwater SedimentEDYAEKARRDLMAFDRSPYREALSVLPDFILSRDH
Ga0224506_1010690323300022221SedimentEAYAERALEALRPFEHSPYREALSSLPGFILARDY
Ga0209519_1021591413300025318SoilDCGALDEARGMAERYADEARANLIVFEPSPYREALDALPGFILARDH
Ga0209640_1027356913300025324SoilAEHYASAARRDLLAFEPSVYREALEALPDFILSRDH
Ga0209751_1090835713300025327SoilRLAREQGAIEEARALAERYAEAARADLQSFERTPYREALAALPDFILARDH
Ga0210131_108627013300025551Natural And Restored WetlandsRSLAEEYAAAARADLLAFDRSPYREALAALPDFILARDH
Ga0207681_1090036713300025923Switchgrass RhizosphereAREHGALEEARALAARYAESARKDLAVFDRSPFREALAVLPDFILSRDH
Ga0207709_1099602323300025935Miscanthus RhizosphereLRLAREHGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH
Ga0207704_1093447013300025938Miscanthus RhizosphereAERYAAAARADLAGFERSPYREALEALPDFILARDH
Ga0207691_1127406423300025940Miscanthus RhizosphereAVLADRGFGRVSREELLKLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPEFILARDH
Ga0207651_1098765313300025960Switchgrass RhizosphereHGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH
Ga0207640_1022098223300025981Corn RhizosphereLDEARALAERYAEAARKDLAVFDRSPFREALAVLPDFILSRDH
Ga0207639_1162210823300026041Corn RhizosphereEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH
Ga0207708_1116293523300026075Corn, Switchgrass And Miscanthus RhizosphereCGALDEARALAERYAEQARRDLQPFERSAYREALEALPDFILARDH
Ga0209807_133526723300026530SoilRKLAERYAEAARRELAVFERSPYREALAVLPDFILGRDH
Ga0209056_1005579733300026538SoilSRRRAQAERYAVAARADLAGFERSPYREALEVLPDFILARDH
Ga0209376_103447233300026540SoilERYAAAARADLAGFERSPYREALQALPDFILARDH
Ga0209161_1035337113300026548SoilARGQAERYAAAARADLAGFDRSPYREALQALPDFILARDH
Ga0209077_114585523300027675Freshwater SedimentRDELVKMARECGALDQARDLAEGYAAAARRDLLVFEPSEYREALEALPGFILARDH
Ga0209798_1052416813300027843Wetland SedimentREHGALDEARTMAERYAESARQQLRAFEPSPYRDALEALPDFILARDH
Ga0209579_1010006313300027869Surface SoilRSLAEEYADRARRDLASFERSAYREALEALPDFILARDH
Ga0207428_1114532423300027907Populus RhizosphereERYAAAARADLAGFERSPYREALEALPDFILARDH
Ga0209382_1120157413300027909Populus RhizosphereAERFAALARRDVLAFERSPYREALELLPDFILARDH
Ga0311334_1109346523300029987FenRECGALEEAGELAERYADEARRDLLAFPPSEYRDALEALPGFILARDH
Ga0311365_1129666723300029989FenGALEDARKLAEHYADEARRELLAFEPSEYRDALETLPGFILARDH
Ga0302046_1079228613300030620SoilDLLRQAREHGALEEARALAERYAEAARRDLAVFERSPYREALAALPDFILARDH
Ga0311335_1040630013300030838FenEELVRMARDCGALEEAQTMAERYAEAARGELLAFEPSEYRDALFALPGFVLARDH
Ga0311335_1113827713300030838FenARKLAEHYADEARRELLAFEPSEYRDALETLPGFILARDH
Ga0310907_1044452723300031847SoilGQAERYADSARRALRGFDPSPYRDALEALPDFILARDH
Ga0315297_1173050823300031873SedimentMAERYAELARRDLLAFDPSPYRDALEALPSFILARDH
Ga0214473_1131192913300031949SoilLVRLARECGALDEARGMAERYADEARASLLAFEPSPYREALDALPGFILARDH
Ga0315278_1155794213300031997SedimentVRLARECGALDEAHGMAERYADEARASLLAFEPSPYREALEALPGFILARDH
Ga0307411_1215468523300032005RhizosphereREQLLRLARETGALDEARKEADRYAAAARQDLLVFDRSPYREALTALPDFILARDR
Ga0310899_1032687613300032017SoilARALAERYADLAREDLSALEPSPNREALSVLPDFILARDH
Ga0307470_1037072523300032174Hardwood Forest SoilEARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH
Ga0316191_1134647223300032258Worm BurrowAGSLAERYAEAARRDLRVFEPSPYREALEALPGFILARDH
Ga0316188_1012195813300032276Worm BurrowRDHGALEEAGSLAERYAEAARRDLQVFEPSPYREALEALPGFILARDH
Ga0315287_1180121923300032397SedimentERYAALARRDLLAFDPSPYRDALLALPGFILARDH
Ga0335085_1086223733300032770SoilEEYADAARRDLLGFERSAYCEALAALPDFILARDH
Ga0335077_1108601733300033158SoilVSAEELVRLARECSALDEARALAEDYADRARRDLLAFERSPYREALAVLPDFILARDH
Ga0316605_1045175223300033408SoilMAERYAEEARRELLAFEPSDYREALEALPGFILARDH
Ga0316619_1107361313300033414SoilAFSRVTRDELVRMARDCGALDEAREMAERYADLARRDLLAFEPSPCREALDALPGFILARDH
Ga0316622_10117425313300033416SoilAVLDDRAFSRVTREELVRMARECGALEEARAMAERYADSARHDLLAFDPSPYREALEALPGFILGRDH
Ga0316622_10167953613300033416SoilAEHYAELARRDLAVFEPSPYRDALEALPGFILARDH
Ga0316622_10213430513300033416SoilELAERYAELARRDLLAFEPSEYRDALEALPGFILARDH
Ga0316622_10284198523300033416SoilALDEARELAAVYAEQARRQLDVFEPSEYRDTLLALPGFILARDH
Ga0316625_10244445113300033418SoilALDEASGLAERYAERARRDLLAFEPSQYRDALEALPGFILARDH
Ga0316601_10234509413300033419SoilVRMARECGALDEAREMAERYADLARRDLLAFEPSPYRDALEALPGFILARDH
Ga0316193_1043091823300033429SedimentGSLAERYAEAARRDLRVFEPSPYREALEALPGFILARDH
Ga0316193_1162392213300033429SedimentAGSLAERYAEAARQALRAFEPSPYRDALEALPGFILARDH
Ga0316600_1099989613300033481SoilARDCGALDEAREMAERYADLARRDLLAFEPSPYREALDALPGFILSRDH
Ga0316629_1076220023300033483SoilRVTRDELVRMAGECGALEEAQEMAERYADFARRDLLAFDPSPYREALEALPGFILGRDH
Ga0326732_108604423300033501Peat SoilLVRMARDCGALEEARRMAERYAEEARRELLAFEPSEYREALLALPGFILARDH
Ga0316616_10009432233300033521SoilMARDCGALEEARELAERYADLARRDLLAFDPSPYREALEALPSFILARDH
Ga0316616_10104843113300033521SoilELVRMARECGALDEAREMAERYAGRARRDLLAFEPSPYREALDALPGFILSRDH
Ga0316616_10284113023300033521SoilEDARRMAERYAEEARRELLAFEPSEYREALEALPGFILARDH
Ga0247829_1160816713300033550SoilEARGLAEQYAERARRDLAAFERSPYREALAVLPDFILARDH
Ga0364932_0415031_378_5063300034177SedimentDEARALAEQYAEKARRDLLVFDRSPYREALEILPDFILARDH
Ga0364934_0341372_422_5653300034178SedimentECGALEEARRLAERYAEAARRELMGFERSPHREALLALPDFILARDH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.