NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043020

Metagenome / Metatranscriptome Family F043020

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043020
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 50 residues
Representative Sequence QRKALAAGAREHSPVREHEHETTGPRPIRRMLQGAVVDPFGHLWLIGKILE
Number of Associated Samples 150
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.27 %
% of genes near scaffold ends (potentially truncated) 96.82 %
% of genes from short scaffolds (< 2000 bps) 92.36 %
Associated GOLD sequencing projects 146
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.994 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.465 % of family members)
Environment Ontology (ENVO) Unclassified
(25.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.949 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.33%    β-sheet: 31.65%    Coil/Unstructured: 62.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.70
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF02687FtsX 14.01
PF00753Lactamase_B 7.01
PF00590TP_methylase 3.18
PF00383dCMP_cyt_deam_1 2.55
PF12704MacB_PCD 2.55
PF00484Pro_CA 1.91
PF00072Response_reg 1.27
PF00155Aminotran_1_2 1.27
PF00903Glyoxalase 1.27
PF14870PSII_BNR 1.27
PF01370Epimerase 1.27
PF00873ACR_tran 0.64
PF06224HTH_42 0.64
PF13432TPR_16 0.64
PF08220HTH_DeoR 0.64
PF07228SpoIIE 0.64
PF03824NicO 0.64
PF09369MZB 0.64
PF13701DDE_Tnp_1_4 0.64
PF01494FAD_binding_3 0.64
PF07238PilZ 0.64
PF01048PNP_UDP_1 0.64
PF01906YbjQ_1 0.64
PF00404Dockerin_1 0.64
PF00248Aldo_ket_red 0.64
PF08448PAS_4 0.64
PF13883Pyrid_oxidase_2 0.64
PF06580His_kinase 0.64
PF13823ADH_N_assoc 0.64
PF02645DegV 0.64
PF13450NAD_binding_8 0.64
PF07606DUF1569 0.64
PF02746MR_MLE_N 0.64
PF13451zf-trcl 0.64
PF08240ADH_N 0.64
PF07690MFS_1 0.64
PF00575S1 0.64
PF13378MR_MLE_C 0.64
PF13854Kelch_5 0.64
PF10518TAT_signal 0.64
PF10604Polyketide_cyc2 0.64
PF12698ABC2_membrane_3 0.64
PF12833HTH_18 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 1.91
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.27
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.27
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.64
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.64
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.64
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.64
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.64
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.64
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.64
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.64
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.64
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.90 %
UnclassifiedrootN/A5.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12583956All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300002245|JGIcombinedJ26739_100190392All Organisms → cellular organisms → Bacteria → Acidobacteria1940Open in IMG/M
3300002914|JGI25617J43924_10273938All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300004091|Ga0062387_100818329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae696Open in IMG/M
3300004091|Ga0062387_101209141Not Available592Open in IMG/M
3300004091|Ga0062387_101422452All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300004114|Ga0062593_100198032All Organisms → cellular organisms → Bacteria → Proteobacteria1596Open in IMG/M
3300004152|Ga0062386_100012173All Organisms → cellular organisms → Bacteria6144Open in IMG/M
3300004479|Ga0062595_101786842All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005093|Ga0062594_102145407All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300005171|Ga0066677_10209864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300005335|Ga0070666_10008890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686246Open in IMG/M
3300005344|Ga0070661_100440005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1036Open in IMG/M
3300005347|Ga0070668_100013131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686174Open in IMG/M
3300005364|Ga0070673_100095713All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300005366|Ga0070659_100883826All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300005468|Ga0070707_100791361All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300005532|Ga0070739_10174108All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300005544|Ga0070686_100339412All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300005559|Ga0066700_10147249All Organisms → cellular organisms → Bacteria → Acidobacteria1592Open in IMG/M
3300005610|Ga0070763_10175252All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300005712|Ga0070764_10156177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1257Open in IMG/M
3300005718|Ga0068866_10891032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300005764|Ga0066903_101783259All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300005834|Ga0068851_10378772All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005921|Ga0070766_10415039All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005993|Ga0080027_10275388All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300006042|Ga0075368_10386942All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006046|Ga0066652_100264423All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis1512Open in IMG/M
3300006162|Ga0075030_100513462Not Available953Open in IMG/M
3300006162|Ga0075030_100828232All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300006174|Ga0075014_100277146Not Available876Open in IMG/M
3300006176|Ga0070765_101872186All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300006177|Ga0075362_10538133All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006195|Ga0075366_10802200All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006358|Ga0068871_100187048All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300006797|Ga0066659_10659647All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300006804|Ga0079221_10075236All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300006854|Ga0075425_100100280All Organisms → cellular organisms → Bacteria3291Open in IMG/M
3300006894|Ga0079215_10288009All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300009088|Ga0099830_10231947All Organisms → cellular organisms → Bacteria → Acidobacteria1455Open in IMG/M
3300009088|Ga0099830_11062608All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300009522|Ga0116218_1499823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300009698|Ga0116216_10141985All Organisms → cellular organisms → Bacteria → Acidobacteria1476Open in IMG/M
3300009759|Ga0116101_1079817Not Available740Open in IMG/M
3300009824|Ga0116219_10653543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300010046|Ga0126384_11397633All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300010329|Ga0134111_10291768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300010333|Ga0134080_10122250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1087Open in IMG/M
3300010360|Ga0126372_12007527All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010364|Ga0134066_10190148All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300010371|Ga0134125_12678294All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300010379|Ga0136449_103981908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300010401|Ga0134121_13219628All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300010403|Ga0134123_13040712All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300012096|Ga0137389_11190119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae653Open in IMG/M
3300012198|Ga0137364_10095281All Organisms → cellular organisms → Bacteria2086Open in IMG/M
3300012201|Ga0137365_11185665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300012357|Ga0137384_10641635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300012359|Ga0137385_10614028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300012360|Ga0137375_10525405All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300012958|Ga0164299_11284743Not Available559Open in IMG/M
3300012986|Ga0164304_11738239All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300014169|Ga0181531_10536853All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300014169|Ga0181531_10724910All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300014969|Ga0157376_12010274All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300015052|Ga0137411_1273295All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300015373|Ga0132257_101043152All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300017821|Ga0187812_1142479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae773Open in IMG/M
3300017930|Ga0187825_10135370All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300017942|Ga0187808_10454161All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300017972|Ga0187781_11058156All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300018060|Ga0187765_11177006All Organisms → cellular organisms → Archaea536Open in IMG/M
3300018432|Ga0190275_13591954All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018476|Ga0190274_13147792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300020075|Ga0206349_1965629All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300020076|Ga0206355_1520962All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300020082|Ga0206353_11376623All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300020579|Ga0210407_11374347All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300020583|Ga0210401_10571511All Organisms → cellular organisms → Bacteria → Acidobacteria992Open in IMG/M
3300020610|Ga0154015_1070137All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300021082|Ga0210380_10459093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300021178|Ga0210408_11109557All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300021388|Ga0213875_10102686All Organisms → cellular organisms → Bacteria → Acidobacteria1335Open in IMG/M
3300021401|Ga0210393_10962281All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300021477|Ga0210398_10137735All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300021560|Ga0126371_11083172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300022893|Ga0247787_1050825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300025878|Ga0209584_10199318All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300025893|Ga0207682_10326935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300025899|Ga0207642_10703695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300025916|Ga0207663_10612148All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300025920|Ga0207649_11012082All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025923|Ga0207681_11409597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300025925|Ga0207650_11058450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300025926|Ga0207659_11586776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300025942|Ga0207689_11415487All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300025945|Ga0207679_12023792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300026067|Ga0207678_11319903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300026315|Ga0209686_1000049All Organisms → cellular organisms → Bacteria52141Open in IMG/M
3300026514|Ga0257168_1109408All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300026523|Ga0209808_1115914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1108Open in IMG/M
3300027381|Ga0208983_1034763All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300027641|Ga0208827_1036454All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300027662|Ga0208565_1053412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1291Open in IMG/M
3300027765|Ga0209073_10031655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1642Open in IMG/M
3300027787|Ga0209074_10380592All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027826|Ga0209060_10540610All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300027853|Ga0209274_10118963All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300027884|Ga0209275_10548621All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300027911|Ga0209698_10960572Not Available638Open in IMG/M
3300028047|Ga0209526_10473039All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300028379|Ga0268266_11165005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300028714|Ga0307309_10169906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300028780|Ga0302225_10560680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae531Open in IMG/M
3300028811|Ga0307292_10415096All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300029943|Ga0311340_11107182All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300029999|Ga0311339_10907388All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300030580|Ga0311355_10568800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1075Open in IMG/M
3300030707|Ga0310038_10039292All Organisms → cellular organisms → Bacteria2750Open in IMG/M
3300030943|Ga0311366_11615338All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031231|Ga0170824_116623485All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300031249|Ga0265339_10513101All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300031545|Ga0318541_10731962All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300031640|Ga0318555_10718752All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031708|Ga0310686_107992805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae676Open in IMG/M
3300031708|Ga0310686_111194614All Organisms → cellular organisms → Bacteria3005Open in IMG/M
3300031747|Ga0318502_10536511All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031763|Ga0318537_10165636All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300031796|Ga0318576_10613002All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031837|Ga0302315_10053675All Organisms → cellular organisms → Bacteria → Acidobacteria2779Open in IMG/M
3300031854|Ga0310904_10150415Not Available1351Open in IMG/M
3300031858|Ga0310892_11201866All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300031903|Ga0307407_10698745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300031908|Ga0310900_11659575All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300031940|Ga0310901_10518192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031941|Ga0310912_10763782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae748Open in IMG/M
3300031946|Ga0310910_10032234All Organisms → cellular organisms → Bacteria → Acidobacteria3573Open in IMG/M
3300032000|Ga0310903_10240866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300032001|Ga0306922_10664540Not Available1099Open in IMG/M
3300032002|Ga0307416_102107322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300032041|Ga0318549_10196984All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300032059|Ga0318533_10398303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1005Open in IMG/M
3300032066|Ga0318514_10712721All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032068|Ga0318553_10580518All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032089|Ga0318525_10679011All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300032205|Ga0307472_100203583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300032261|Ga0306920_101543144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300032770|Ga0335085_10790803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.1045Open in IMG/M
3300032892|Ga0335081_11209062All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon861Open in IMG/M
3300032896|Ga0335075_11450045All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300032898|Ga0335072_10018903All Organisms → cellular organisms → Bacteria → Acidobacteria9726Open in IMG/M
3300033134|Ga0335073_11250259All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300033550|Ga0247829_10207745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1559Open in IMG/M
3300033550|Ga0247829_11538658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300033561|Ga0371490_1101731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300034124|Ga0370483_0037316All Organisms → cellular organisms → Bacteria1497Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.10%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.18%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.18%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.18%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.55%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.91%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.91%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.27%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.27%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.27%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.64%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.64%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.64%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1258395613300000789SoilQALAAGATEHSQVTEEYFVTQGPEPVRRITQGAVVDPFGHIWLIGKILE*
JGIcombinedJ26739_10019039233300002245Forest SoilDDPIAVHRRALDAGATEHSPVEEHTHQTIGPKPIKRILQGALVDPFGHVWLIGKVVE*
JGI25617J43924_1027393813300002914Grasslands SoilMFKALAAGAMERNPVVEHQHETIGPNPIRRMLQGAVVDPFGHMWLIGKILE*
Ga0062387_10081832923300004091Bog Forest SoilTTVRIELFVNDPVAVHKRALAAGAVERSPVVEHEHSTTGPQPIAKMLQGSVRDPFGHIWLIGKFLE*
Ga0062387_10120914113300004091Bog Forest SoilQAGANDRSPVEEHEHDTSGPWPLKRMLQGAVLDPSGHMWLIGKILG*
Ga0062387_10142245213300004091Bog Forest SoilPIALHRQALAAGAADRSRVVEHTHSTSGPQPIKRMLQGSVVDPFGHMWLIGKILE*
Ga0062593_10019803213300004114SoilGGVERNPVTEHTHETVGPRPIKRMLQGGVTDPFGHMWLIGKFLE*
Ga0062386_10001217383300004152Bog Forest SoilVRIELFVADPTEVHRQALAAGATERSPVVEHNHETIGPKPIKRMLQGALVDPFGHLWLIGKIVE*
Ga0062595_10178684223300004479SoilATEHSPVEEHEHDVIGPKPIKRMLQGAVLDPFGHLWLIGKFLE*
Ga0062594_10214540713300005093SoilVHSKALAAGAVEHSPVEEHTHATAGPHPIKRMLQGAVVDPFGHLWLIGKFLE*
Ga0066677_1020986423300005171SoilSRPHGQRFPVAVQRKALAVGAREHSPVEEHKHETKGPQPIRRMLQGAVLDPFGHLWLIGKILE*
Ga0070666_1000889013300005335Switchgrass RhizosphereVHRQALAAGATTHSPVLEHTHLTTGPRPIKRMLQGSVSDPFGHVWLIGKFLE*
Ga0070661_10044000523300005344Corn RhizosphereDPVAVYRRAVAAGATDRDPVREHTHETTGPRPIRRMLQGSVVDPSGHRWLIGKFLD*
Ga0070668_10001313113300005347Switchgrass RhizosphereAAGATTHSPVLEHTHSTTGPRPIKRMLQGSVSDPFGHVWLIGKFLE*
Ga0070673_10009571323300005364Switchgrass RhizosphereELFVDDPVAVYRRAVAAGATDRDPVREHTHETTGPRPIRRMLQGSVVDPSGHRWLIGKFLD*
Ga0070659_10088382633300005366Corn RhizosphereDDPVAVHTLAIAAGAVEHSPVREHTHPTVGPRPIRRMLQGSVTDPFGHIWLIGKFLE*
Ga0070707_10079136113300005468Corn, Switchgrass And Miscanthus RhizosphereAVEHSPVNEHAHEMCGPKPIKRMLQGAVVDPFGHMWLIGKILE*
Ga0070739_1017410813300005532Surface SoilSRAVAAGAIERSPIREHNYQTIGPQPIGKMLQGSVTDPFGHIWLIGKFLD*
Ga0070686_10033941213300005544Switchgrass RhizosphereQAVAAGATNHSPVNQHDHRTEGPHPIRRMLQGAVVDPFGHLWLIGKFLDTD*
Ga0066700_1014724923300005559SoilHRQALAAGAIDQDPVVEHEHQTIGPNPIKRMLQGAVVDPFGHMWLVGKILE*
Ga0070763_1017525213300005610SoilVDDPLAVQSKAVAAGAKQHSEVKEHKYPVVGPKPIGRMLQGGVVDPFGHMWLIGKFLD*
Ga0070764_1015617723300005712SoilDPVAIHKRAVSAGAVDRSPVVEHHYATVGPHPIGRMLQGAVTDPSGHLWLIGKFLE*
Ga0068866_1089103213300005718Miscanthus RhizosphereAGATDRDPVREHTHETVGPRPIRRMLQGSVVDPSGHKWLIGKFLE*
Ga0066903_10178325943300005764Tropical Forest SoilDRYEMEGTEPIRRMLQGSVVDPFGHRWLIGRIFE*
Ga0068851_1037877223300005834Corn RhizosphereELFVDDPITVHRQALAAGATTHSPVLEHTHLTTGPRPIKRMLQGSVSDPFGHVWLIGKFLE*
Ga0070766_1041503933300005921SoilEHMHSTTGPRPIRRMLQGSVLDPFGHMWLIGKILE*
Ga0080027_1027538823300005993Prmafrost SoilAGANEGSPMVEHHYETMGPKPIKKMLQGSVVDPFGHKWLIGKILE*
Ga0075368_1038694233300006042Populus EndosphereVRTDRFVRVLEHTHETIGPHPISRMLQGAVTDPFGHLWLIGKFLD*
Ga0066652_10026442323300006046SoilQRKALAAGAREHSPVREHEHETTGPRPIRRMLQGAVVDPFGHLWLIGKILE*
Ga0075030_10051346213300006162WatershedsLAAGAVEHSPVEEHEHPTAGPKLIRRMLQGAVVDPFGHMWLIGKFLE*
Ga0075030_10082823213300006162WatershedsHEHPTTGPKPIRRMLQGAVVDPFGHMWLIGKFLE*
Ga0075014_10027714633300006174WatershedsPIAVHDRALAAGAVEHSPVEEHEHPTAGPKPIRRMLQGAVVDPFGHMWLIGKFLG*
Ga0070765_10187218623300006176SoilVDDPIAVQAKAVSAGAKQHSEVKEHNYPTVGPKPIGRMLQGGVVDPFGHMWLIGRFLD*
Ga0075362_1053813333300006177Populus EndosphereHSPVLEHTHETIGPHPISRMLQGAVTDPFGHLWLIGKFLD*
Ga0075366_1080220023300006195Populus EndosphereAVQARAIAAGAIEKDPVREHEHATHGPRPIHRMLQGAVFDPSGHLWLIGTFLD*
Ga0068871_10018704813300006358Miscanthus RhizosphereVAAGAKEHSPVEEHTHETAGPQLIKRMLQGAILDPFGHVWLIGKILE*
Ga0066659_1065964723300006797SoilEEHEHETTGPRPIRRMLQGAVVDPFGHLWLIGKILE*
Ga0079221_1007523643300006804Agricultural SoilAGARQHSPVEHHEYKTVGPKRIRRMIQGAVVDPFGHMWLIGKFLD*
Ga0075425_10010028013300006854Populus RhizosphereHSPVQEHEHETVGPQPIRRMLQGAVVDPFGHLWLIGKVLE*
Ga0079215_1028800923300006894Agricultural SoilVSDPVAIHAQALAAGATEQSPVTEHTHATTGPHPIKRMLQGAVVDPFGHMWLVGKILA*
Ga0099830_1023194723300009088Vadose Zone SoilVELFVDDPITVQRRALAAGAVELSPVSEEEFQMTGPDPIRRILQGAVVDPFGHMWLIGKIIA*
Ga0099830_1106260813300009088Vadose Zone SoilRSPVSEHEHETIGPQPIKRMLQGAIIDPFGHMWLVGKILE*
Ga0116218_149982313300009522Peatlands SoilVQRQALAAGAVFRSPVEEHTHSTTGPYPIKRMLQGVVIDPSGHCWLIGKILE*
Ga0116216_1014198513300009698Peatlands SoilAVHRQALAAGATERSPVVEHKYEMIGPKPIKSMLQGAVVDPFGHMWLIGKILE*
Ga0116101_107981733300009759PeatlandVLSHALAAGATAHSPVEQHEHIMVGPKPIKRMLQGAVIDPFGHMWLIGKVLE*
Ga0116219_1065354313300009824Peatlands SoilRQALAAGAVFRSPVEEHTHSTTGPYPIKRMLQGAVIDPSGHCWLIGKILE*
Ga0126384_1139763313300010046Tropical Forest SoilAIQHSPVNEHAHITEGPRPIRRMLQGAVVDPFGHLWLIGKFLD*
Ga0134111_1029176813300010329Grasslands SoilVERSPVIEHKHEMSGPRPIKRMLQGGLVDPFGHMWLVGKILE*
Ga0134080_1012225033300010333Grasslands SoilFVHDPIAVQRQAIAAGAVENSPVREHEHETAGPQPIKRMLQGAVIDPFGHMWLVGKILE*
Ga0126372_1200752723300010360Tropical Forest SoilVDDPHSVHHSALAAGATEHSPIEEHKHETVGPQPIRRMLQGAVVDPFGHMWLIGKILD*
Ga0134066_1019014813300010364Grasslands SoilTEKDPVREHEHATVGPHPIRRMLQGAVIDPFGHMWLVGKILG*
Ga0134125_1267829423300010371Terrestrial SoilVEHHEYKTVGPKRIRRMIQGAVVDPFGHMWLIGKFLD*
Ga0136449_10398190813300010379Peatlands SoilEHAYSMAGPRPIRRMLQGSVVDPFGHMWLIGKVLE*
Ga0134121_1321962813300010401Terrestrial SoilPVVEHAHTTTGPKPIRRMLQGGIIDPSGHHWLIGKFLE*
Ga0134123_1304071223300010403Terrestrial SoilFVDDPIAVQRRAVAAGATEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE*
Ga0137389_1119011923300012096Vadose Zone SoilVRIELFVDDPIAVHRRALEAGAVEYSPVLEHSHEMSGPKPIKRTMQGAVVDPFGHMRLIGKILE*
Ga0137364_1009528113300012198Vadose Zone SoilHSPVREHEHETTGPRPIRRMLQGAVVDPFGHLWLIGKILE*
Ga0137365_1118566513300012201Vadose Zone SoilFVEDPVAVQMRALGAGATEHSPIEEHTHATTGPRPVTRMLQGAVLDPFGHIWLIGKILE*
Ga0137384_1064163533300012357Vadose Zone SoilDDPVAVHRQALVAGAIEKDPVREHKHTTAGPSSIKSMLQGAVLDPFGHIWLIGKILE*
Ga0137385_1061402813300012359Vadose Zone SoilDDPVAVHRQDLAAGAIGKDPVREHTHTTAGPSPIKSMLQGAVLDPFGQIWLIGKILE*
Ga0137375_1052540533300012360Vadose Zone SoilLFVDDPVAVHRRALAAGAVERSPVSEQKHSMTGPHPIKQMLQGALVDPFGHMWLIGKILE
Ga0164299_1128474323300012958SoilLFVDDPIAVHKRAVAAGGVERSPVREHTHETVGLRPIKRMLQGAVTDPFGHMWLIGKFLE
Ga0164304_1173823913300012986SoilAGAVERDPVREHAHTTAGPRPITRMLQGAIVDPFGHMWLVGKFLE*
Ga0181531_1053685313300014169BogPAEVHAQALAAGAADRSPVVEHEYTMSGPQPIRRMLQGAVIDPFGHMWLIGKNLE*
Ga0181531_1072491013300014169BogVLEHTHETIGPRPIRRMLQGAVVDPSGHKWLIGKFLE*
Ga0157376_1201027413300014969Miscanthus RhizospherePVLEHTHSTTGPRPIKRMLQGSVSDPFGHVWLIGKFLE*
Ga0137411_127329523300015052Vadose Zone SoilAAGARDRSAVEEHQYPMEGPQPIQRMLQGSVVDPFGHMWLVGKILE*
Ga0132257_10104315213300015373Arabidopsis RhizospherePVAAGATDHSPVEEHTHLTTGSQPIERMLQGAVVDPFGHLWLIGKFLPS*
Ga0187812_114247913300017821Freshwater SedimentLRSPVQAHTHPTIGPRPIHRMLQVSVLDPFGHIWLIGKFLD
Ga0187825_1013537023300017930Freshwater SedimentHKKALAAGAQQHSPVEHHEYKTVGPKRIRRMIQGAVVDPFGHMWLIGKFLD
Ga0187808_1045416123300017942Freshwater SedimentDPVAVQSKDLAAGALERSPIEEHEHPTTGPKPIRRMLQGAVVDLFGHMWLIGKFLE
Ga0187781_1105815613300017972Tropical PeatlandRALAAGAVERSPVSEDEYQMAGPCPIKRILQGAVIDPFGHMWLIGKIIE
Ga0187765_1117700613300018060Tropical PeatlandAVELNPVVEHEYKTTGKSPINKMLQGAIRDPFGHMWLIGCILN
Ga0190275_1359195413300018432SoilRAVAAGATEKDPVLEHTHETYGPRPVRRMLQGAIIDPAGHMWLVGKFLE
Ga0190274_1314779213300018476SoilVSAGAVEKDPVLEHTHETQGPRPVRRMLQGAVVDPSGHMWLIGRFLD
Ga0206349_196562933300020075Corn, Switchgrass And Miscanthus RhizosphereDDPVAVHTLAIAAGAVEHSPVREHTHPTVGPRPIRRMLQGSVTDPFGHIWLIGKFLE
Ga0206355_152096233300020076Corn, Switchgrass And Miscanthus RhizosphereVYTLAIAAGAVEHSLVREHTHPTVGPRPIRRMLQGSVTDPFGHIWLIGKFLE
Ga0206353_1137662313300020082Corn, Switchgrass And Miscanthus RhizosphereLFVDDPVAVHTLAIAAGAVEHSPVREHTHPTVGPRPIRRMLQGSVTDPFGHIWLIGKFLE
Ga0210407_1137434723300020579SoilLAAGAVLRSPVTEHSYSVNGPHPIRRMLQGSVVDPFGHMWLIGKILE
Ga0210401_1057151113300020583SoilQRRAVTAGAVSKDPVREHTHPTSGPRPIRRMLQGAVVDPFGHMWLIGKILE
Ga0154015_107013733300020610Corn, Switchgrass And Miscanthus RhizosphereAVHTLAIAAGAVEHSPVREHTHPTVGPRPIRRILQGSVTDPFGHIWLIGKFLE
Ga0210380_1045909323300021082Groundwater SedimentATDRDPVREHTHETHGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0210408_1110955723300021178SoilFVDDPAAVHAKAIAAGARQHSEVKEHEYPVVGPKPIGRMLQGAVVDPFGHMWLVGRFLD
Ga0213875_1010268613300021388Plant RootsYEVHRRAVAAGAIDCDPVIEHNYPMSGPHPIKRMLQGGVTDPFGHRWLIGKVLE
Ga0210393_1096228113300021401SoilDPVAVQAKAVSAGAKQHSEVKEHNYPTVGPKPIGKMLQGGVVDPFGHMWLIGKFLD
Ga0210398_1013773533300021477SoilNPLGVQSKAVAAGATQRSEVKEHKYPVVGPKPIGRMLQGAVVDPFGHMWLIGKFLD
Ga0126371_1108317213300021560Tropical Forest SoilSPGNTTTGPRPIKRRFEGAVLDPFGHLCLVGKIFE
Ga0247787_105082523300022893SoilRAVAAGATEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0209584_1019931823300025878Arctic Peat SoilEYNYTTAGPHPIGRMLQGSVVDPFGHRWLIGKFLE
Ga0207682_1032693513300025893Miscanthus RhizosphereREHTHETTGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0207642_1070369513300025899Miscanthus RhizosphereAVAAGATDRDPVREHTHETVGPRPIRRMLQGSVVDPSGHKWLIGKFLE
Ga0207663_1061214823300025916Corn, Switchgrass And Miscanthus RhizosphereQEHNYQTVGPKPIGKMLQGSVVDPFGHLWLIGKFLD
Ga0207649_1101208233300025920Corn RhizosphereREHTHPTVGPRPIRRMLQGSVTDPFGHIWLIGKFLE
Ga0207681_1140959713300025923Switchgrass RhizosphereKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0207650_1105845023300025925Switchgrass RhizosphereAGATDRDPVREHTHETVGPRPIRRMLQGSVVDPSGHKWLIGKFLE
Ga0207659_1158677623300025926Miscanthus RhizosphereTEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0207689_1141548713300025942Miscanthus RhizosphereLFVDDPIAVQRRAVAAGATEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0207679_1202379213300025945Corn RhizosphereVAAGATDRDPVREHTHETVGPRPIRRMLQGSVVDPSGHKWLIGKFLE
Ga0207678_1131990323300026067Corn RhizosphereAVQRRAVAAGATEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0209686_1000049443300026315SoilAVQKKALAAGARVHSPVEEHEHETTGPRPIRRMLQGAVVDPFGHLWLIGKILE
Ga0257168_110940813300026514SoilELFVDDPVSVHKRAVAAGAIERSPVVEYEHQTIGPAPIKRMLQGAVADPFGHLWLIGKFL
Ga0209808_111591413300026523SoilVREHEHETKGPRPIRRMLQGAVLDPFGHLWLIGKFLE
Ga0208983_103476313300027381Forest SoilGAGAVNHSPVEQHTHETIGTRPIKRMLQGAVVDPFGHMWLIGRILE
Ga0208827_103645413300027641Peatlands SoilGAVFRSPVEEHTHSTTGPYPIKRMLQGAVIDPSGHCWLIGKILE
Ga0208565_105341213300027662Peatlands SoilVDDPEAVQRQALAAGAVFRSPVEEHTHSTTGPYPIKRMLQGAVIDPSGHCWLIGKILQ
Ga0209073_1003165523300027765Agricultural SoilIELFVNDPVAVHGKALAAGAREHSPLQEHEHETVGPQPIRRMLQGAVVDPFGHLWLIGKVLE
Ga0209074_1038059213300027787Agricultural SoilALVAGARQHSPVEHHEYKTVGPKRIRRMIQGAVVDPFGHMWLIGKFLD
Ga0209060_1054061013300027826Surface SoilEMFVDDPAAVQAKAVTAGAKQRSEIKEHNYDTKGPKPIRRMLQGSVVDPFGHLWLIGKFL
Ga0209274_1011896313300027853SoilKENSPVEEHTHETVGPKPIERMLQGAVVDPFGHMWLIGKVLA
Ga0209275_1054862123300027884SoilNPLVVQSKAVAAGATQRSEVKEHKYPVVGPKPIGRMLQGAVVDPFGHMWLIGKFLD
Ga0209698_1096057213300027911WatershedsGAVEHSLVEEHEHPTTGPKPIRRMLQGAVVDPFGHMWLIGKFLE
Ga0209526_1047303923300028047Forest SoilFTTVRIELFVDDPVAVHSQALAAVAIERSPVSEHKHSMTGLRPIRRMLQGALEDPFGHIWLIGKILQ
Ga0268266_1116500523300028379Switchgrass RhizosphereAGAFEKDPVREHEHDTVGPHPIRRMRQGAVIDPSGHMWLIGVILE
Ga0307309_1016990623300028714SoilAVQRRAVAAGAREKDPVQEHTHDTVGPQPIRRMLQGAVIDPAGHMWLIGRILA
Ga0302225_1056068013300028780PalsaHSPVEEHKHPTTGPRPINRMLQGAVVDPFGHMWLIGKILD
Ga0307292_1041509613300028811SoilLAAGAIEHSPVREHTHATIGPRPISRMLQGAVVDPFGHLWLVGKILE
Ga0311340_1110718223300029943PalsaHGKARAAGAINHSPVEEHKHPTTGPRPINRMLQGAVVDPFGHMWLIGKILD
Ga0311339_1090738813300029999PalsaPVIEHEHSVGGSEPAMRMLQGALMDPFGHIWLIGKFL
Ga0311355_1056880013300030580PalsaVEEHRHSTTGPRPIKRMLQGAVVDPFGHMWLIGKILD
Ga0310038_1003929213300030707Peatlands SoilELFVDDPEAVQRQALAAGAVFRSPVEEHTHSTTGPYPIKRMLQGAVIDPSGHCWLIGKIL
Ga0311366_1161533823300030943FenPVAVYRKAVAAGATDYHPVQAHEHPTVGPRPIKKMLQGTVIDPFGHKWLIGKFLE
Ga0170824_11662348513300031231Forest SoilAGFTTVRIELFVGDSVAVHMRALRAGAAEHSPVEEHTDAMTGPRPITRMLQGAVTDPFGHIWLIGKILE
Ga0265339_1051310123300031249RhizosphereAGARLRNPVQEYVYPTTGPAPIRRMLQGSVSDPFGHIWLIGKFLE
Ga0318541_1073196213300031545SoilALAAGAVEHSPVVEHQYSTTGPQPIKKMLQGASVDPFGHMWLVGKVLE
Ga0318555_1071875223300031640SoilFVDDPIAVQRRALAAGAREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0310686_10799280533300031708SoilEAVQLRALAAGAVLRSPVTEHSYSMNGPQPIRHMLQGSVVDPFGHMWLIGKILE
Ga0310686_11119461453300031708SoilVDDPVAVHKRAVSAGAVDRSPVVEHHYATVGPHPIGRMLQGAVTDPSGHLWLIGKFLE
Ga0318502_1053651113300031747SoilEHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0318537_1016563613300031763SoilAGAREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0318576_1061300223300031796SoilPIAVQRRALAAGVREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0302315_1005367513300031837PalsaSPVEEHNHSTTGPRPIKRMLQGAVVDPFGHMWLIGKILD
Ga0310904_1015041523300031854SoilLFVDDPVAVHERAVTAGATEHSPVREYSHETVGPRPISRMLQGAVVDPFGHLWLIGKFLD
Ga0310892_1120186623300031858SoilRIETIVDDPIAVQRRAVAAGATEKDPVREHAHDTVGPRPIRRMLQGAVIDPSGHMWLIGRILE
Ga0307407_1069874513300031903RhizosphereGATEKDPVLEHTHETTGPHPIRRMLQGAVVDPFGHMWLIGRFLD
Ga0310900_1165957513300031908SoilELFVDDPVAVHERAVTAGATEHSPVREHSHETVGPRPISRMLQGAVVDPFGHLWLIGKFL
Ga0310901_1051819213300031940SoilVAAGATDRDPVREHTHETHGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0310912_1076378213300031941SoilGAVHSRVLAAGAVERSPVVEHKHSVTGPRPITKMLQGALVDPFGHMWFIGKVLQ
Ga0310910_1003223413300031946SoilYGTRGPASVGFTTVRIELFVDDPVAVHRQALASGAVDHSPVIEQVHDTKGPNPIKRLLQGAIVDSSGHMWLIGKILE
Ga0310903_1024086613300032000SoilVREHTHETHGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0306922_1066454013300032001SoilHSPVIEQVHDTKGPNPIKRLLQGAIVDSSGHMWLIGKILE
Ga0307416_10210732223300032002RhizosphereRAIAAGATEKDPVLEHAHETHGPRPIHRMLQGAVFDPCGHMWLIGKFLD
Ga0318549_1019698423300032041SoilAAGAREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0318533_1039830313300032059SoilVHSRVLAAGAVERSPVVEHKHSVTGPRPITKMLQGALVDPFGHMWLIGKVLE
Ga0318514_1071272123300032066SoilVREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0318553_1058051813300032068SoilFVDDPIAVQRRALAAGVREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0318525_1067901123300032089SoilAREHSPVTEEQFAMTGPGPIKRMLQGAIVDPFGHIWLIGKTME
Ga0307472_10020358313300032205Hardwood Forest SoilAGAVENSPVREHEHETAGPQPIKRMLQGALIDPFGHMWLVGKILE
Ga0306920_10154314413300032261SoilELFVGNPVGVHQQALAAGATEHSPVLEHEHETTGPRPIRRMFQGAVVDPFGHMWLIGKFV
Ga0335085_1079080323300032770SoilLAAGATEHSPVSEDQFQMTGPDPIRRMVQGAVVDPFGHMWLIGKILE
Ga0335081_1120906223300032892SoilMKALAAGAVEKSPVTEHSYPTIGSKPIKRMLQGAVVDPFGHMWLIGKVLE
Ga0335075_1145004513300032896SoilHKKAIAAGAREHSPVDHHEYKTTGRKRKLRMLQGAVIDPFGHMWLIGKFLD
Ga0335072_10018903103300032898SoilHALAAGAVEHSPVQEHNYPTNGPHPIGRMLQGAVVDPFGHMWLIGKFLD
Ga0335073_1125025913300033134SoilPVEEHAYPMSGPQPIKRMLQGSVLDPFGHMWLIGKILEE
Ga0247829_1020774523300033550SoilREHTHETHGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0247829_1153865823300033550SoilVCGAVAAGATDRDPVREHTHETHGPRPIRRMLQGSVVDPSGHRWLIGKFLD
Ga0371490_110173113300033561Peat SoilAVQRQALAAGAVLRGPVVEHTHSTTGPRPIRRMLQGSVIDPFGHMWLIGKFLE
Ga0370483_0037316_1301_14953300034124Untreated Peat SoilVRIELFVEDPETVHQQALAAGAVFHSPVAEHTYATIGPRPIRRMSQGAVVDPFGHLWLIGKILE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.