Basic Information | |
---|---|
Family ID | F043089 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 157 |
Average Sequence Length | 42 residues |
Representative Sequence | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Number of Associated Samples | 129 |
Number of Associated Scaffolds | 157 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 66.88 % |
% of genes near scaffold ends (potentially truncated) | 48.41 % |
% of genes from short scaffolds (< 2000 bps) | 77.07 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.618 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (20.382 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.153 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.357 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 80.95% β-sheet: 0.00% Coil/Unstructured: 19.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 157 Family Scaffolds |
---|---|---|
PF04205 | FMN_bind | 32.48 |
PF07396 | Porin_O_P | 7.64 |
PF12705 | PDDEXK_1 | 3.82 |
PF13172 | Obsolete Pfam Family | 3.18 |
PF03929 | PepSY_TM | 2.55 |
PF11924 | IAT_beta | 1.27 |
PF02926 | THUMP | 0.64 |
PF00196 | GerE | 0.64 |
PF13679 | Methyltransf_32 | 0.64 |
PF01170 | UPF0020 | 0.64 |
PF01926 | MMR_HSR1 | 0.64 |
COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
---|---|---|---|
COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 7.64 |
COG3182 | PepSY-associated TM region | Function unknown [S] | 2.55 |
COG3295 | Uncharacterized conserved protein | Function unknown [S] | 2.55 |
COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.64 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.64 |
COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.64 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.62 % |
Unclassified | root | N/A | 20.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573028|GS313G0146KB_1112157313214 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300000101|DelMOSum2010_c10023051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3582 | Open in IMG/M |
3300000101|DelMOSum2010_c10097845 | Not Available | 1230 | Open in IMG/M |
3300000167|SI39nov09_120mDRAFT_c1035085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
3300000170|SI36aug09_135mDRAFT_c1049751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → unclassified Gallionellaceae → Gallionellaceae bacterium | 554 | Open in IMG/M |
3300000192|SI60aug11_100mDRAFT_c1001724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 6866 | Open in IMG/M |
3300000226|SI34jun09_135mDRAFT_1007472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4056 | Open in IMG/M |
3300000257|LP_F_10_SI03_100DRAFT_1070244 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300001348|JGI20154J14316_10038789 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2205 | Open in IMG/M |
3300001348|JGI20154J14316_10084560 | Not Available | 1090 | Open in IMG/M |
3300001349|JGI20160J14292_10054570 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1765 | Open in IMG/M |
3300001351|JGI20153J14318_10089235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 895 | Open in IMG/M |
3300001352|JGI20157J14317_10230415 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300001353|JGI20159J14440_10020138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3157 | Open in IMG/M |
3300001354|JGI20155J14468_10034008 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2379 | Open in IMG/M |
3300001354|JGI20155J14468_10078446 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1242 | Open in IMG/M |
3300001354|JGI20155J14468_10228826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
3300001355|JGI20158J14315_10061492 | Not Available | 1495 | Open in IMG/M |
3300001940|GOS2222_1010108 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1825 | Open in IMG/M |
3300003478|JGI26238J51125_1015956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 1912 | Open in IMG/M |
3300003478|JGI26238J51125_1089188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 588 | Open in IMG/M |
3300003494|JGI26240J51127_1003117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 4798 | Open in IMG/M |
3300003495|JGI26244J51143_1000463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 16807 | Open in IMG/M |
3300003498|JGI26239J51126_1007735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 3162 | Open in IMG/M |
3300003501|JGI26243J51142_1039995 | Not Available | 946 | Open in IMG/M |
3300003583|JGI26253J51717_1070238 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300003590|JGI26251J51716_1027658 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300003595|JGI26263J51726_1014764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
3300003601|JGI26382J51730_1000200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 32064 | Open in IMG/M |
3300004277|Ga0066611_10161215 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300004280|Ga0066606_10029086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2328 | Open in IMG/M |
3300004448|Ga0065861_1199612 | Not Available | 721 | Open in IMG/M |
3300005239|Ga0073579_1008221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 1446 | Open in IMG/M |
3300005239|Ga0073579_1009677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 1581 | Open in IMG/M |
3300005239|Ga0073579_1191595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 176981 | Open in IMG/M |
3300005239|Ga0073579_1687843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2653 | Open in IMG/M |
3300005239|Ga0073579_1691772 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300006164|Ga0075441_10015665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 3174 | Open in IMG/M |
3300007229|Ga0075468_10046097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1496 | Open in IMG/M |
3300007962|Ga0102907_1176185 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009003|Ga0102813_1062919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga sulfidovorans | 1232 | Open in IMG/M |
3300009071|Ga0115566_10156738 | Not Available | 1416 | Open in IMG/M |
3300009071|Ga0115566_10371892 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009071|Ga0115566_10475647 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300009071|Ga0115566_10642829 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300009076|Ga0115550_1114670 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300009077|Ga0115552_1041237 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2143 | Open in IMG/M |
3300009132|Ga0118730_1088863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2103 | Open in IMG/M |
3300009172|Ga0114995_10049548 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
3300009172|Ga0114995_10128335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga sulfidovorans | 1418 | Open in IMG/M |
3300009426|Ga0115547_1021818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2511 | Open in IMG/M |
3300009434|Ga0115562_1116772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1032 | Open in IMG/M |
3300009445|Ga0115553_1110704 | Not Available | 1160 | Open in IMG/M |
3300009445|Ga0115553_1391308 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300009447|Ga0115560_1058657 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1675 | Open in IMG/M |
3300009467|Ga0115565_10219402 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 874 | Open in IMG/M |
3300009472|Ga0115554_1159146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 931 | Open in IMG/M |
3300009495|Ga0115571_1101689 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1246 | Open in IMG/M |
3300009496|Ga0115570_10071851 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
3300009496|Ga0115570_10130359 | Not Available | 1195 | Open in IMG/M |
3300009505|Ga0115564_10177915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 1123 | Open in IMG/M |
3300009512|Ga0115003_10149126 | Not Available | 1421 | Open in IMG/M |
3300010883|Ga0133547_12064191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1041 | Open in IMG/M |
3300010883|Ga0133547_12154212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1014 | Open in IMG/M |
3300011248|Ga0151670_1074054 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1223 | Open in IMG/M |
3300012413|Ga0138258_1291056 | Not Available | 1477 | Open in IMG/M |
3300012414|Ga0138264_1818009 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300017824|Ga0181552_10022518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 3931 | Open in IMG/M |
3300018982|Ga0192947_10215156 | Not Available | 628 | Open in IMG/M |
3300020165|Ga0206125_10018814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4235 | Open in IMG/M |
3300020165|Ga0206125_10301793 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300020166|Ga0206128_1107559 | Not Available | 1194 | Open in IMG/M |
3300020166|Ga0206128_1185087 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300020169|Ga0206127_1103100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
3300020358|Ga0211689_1104604 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300020365|Ga0211506_1068537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1003 | Open in IMG/M |
3300020438|Ga0211576_10055384 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
3300020452|Ga0211545_10199560 | Not Available | 924 | Open in IMG/M |
3300020595|Ga0206126_10098251 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300020595|Ga0206126_10199858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 931 | Open in IMG/M |
3300021085|Ga0206677_10053936 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2073 | Open in IMG/M |
3300021085|Ga0206677_10152182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 1033 | Open in IMG/M |
3300021185|Ga0206682_10213617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
3300021350|Ga0206692_1620634 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300021371|Ga0213863_10126465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga aminisulfidivorans | 1191 | Open in IMG/M |
3300021389|Ga0213868_10127051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1608 | Open in IMG/M |
3300021958|Ga0222718_10182621 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1158 | Open in IMG/M |
(restricted) 3300022888|Ga0233428_1034183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 2254 | Open in IMG/M |
(restricted) 3300022912|Ga0233430_1295809 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10118718 | Not Available | 1149 | Open in IMG/M |
(restricted) 3300022933|Ga0233427_10008613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 7418 | Open in IMG/M |
(restricted) 3300022933|Ga0233427_10222600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
3300023709|Ga0232122_1024989 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1575 | Open in IMG/M |
3300024180|Ga0228668_1052092 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300024180|Ga0228668_1092705 | Not Available | 543 | Open in IMG/M |
3300024185|Ga0228669_1096651 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300024191|Ga0228636_1122069 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300024229|Ga0233402_1064873 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300024236|Ga0228655_1134535 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300024248|Ga0228676_1106731 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10144731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1162 | Open in IMG/M |
3300024292|Ga0228630_1074790 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300024293|Ga0228651_1126041 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300024294|Ga0228664_1106452 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
(restricted) 3300024302|Ga0233449_1240700 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300024318|Ga0233400_1022289 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1780 | Open in IMG/M |
3300024318|Ga0233400_1102040 | Not Available | 644 | Open in IMG/M |
(restricted) 3300024324|Ga0233443_1001416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 21100 | Open in IMG/M |
(restricted) 3300024324|Ga0233443_1020361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3188 | Open in IMG/M |
3300024415|Ga0228662_1086484 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300025431|Ga0209449_1008536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2990 | Open in IMG/M |
3300025488|Ga0209141_1045975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 998 | Open in IMG/M |
3300025547|Ga0209556_1035445 | Not Available | 1343 | Open in IMG/M |
3300025547|Ga0209556_1118322 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300025596|Ga0209662_1152882 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300025614|Ga0209665_1064813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1071 | Open in IMG/M |
3300025643|Ga0209151_1019813 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2212 | Open in IMG/M |
3300025680|Ga0209306_1023388 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2175 | Open in IMG/M |
3300025700|Ga0209661_1151884 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300025722|Ga0209660_1198146 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300025729|Ga0209558_1169551 | Not Available | 717 | Open in IMG/M |
3300025803|Ga0208425_1035640 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1276 | Open in IMG/M |
3300025809|Ga0209199_1092301 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1276 | Open in IMG/M |
3300025849|Ga0209603_1096936 | Not Available | 1329 | Open in IMG/M |
3300025869|Ga0209308_10306542 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300025874|Ga0209533_1024636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4125 | Open in IMG/M |
3300025880|Ga0209534_10074864 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2028 | Open in IMG/M |
3300025890|Ga0209631_10505746 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026390|Ga0247558_122898 | Not Available | 607 | Open in IMG/M |
3300026448|Ga0247594_1031315 | Not Available | 897 | Open in IMG/M |
3300026466|Ga0247598_1044069 | Not Available | 1256 | Open in IMG/M |
3300026466|Ga0247598_1151032 | Not Available | 553 | Open in IMG/M |
3300026471|Ga0247602_1167105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 506 | Open in IMG/M |
3300026503|Ga0247605_1061415 | Not Available | 933 | Open in IMG/M |
3300026504|Ga0247587_1077368 | Not Available | 820 | Open in IMG/M |
3300027522|Ga0209384_1002581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8273 | Open in IMG/M |
3300027553|Ga0208947_1079588 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300027687|Ga0209710_1017619 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 3822 | Open in IMG/M |
3300027687|Ga0209710_1175165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → unclassified Gallionellaceae → Gallionellaceae bacterium | 754 | Open in IMG/M |
3300027704|Ga0209816_1147139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
3300027752|Ga0209192_10033935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2406 | Open in IMG/M |
3300027791|Ga0209830_10015483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4637 | Open in IMG/M |
3300027810|Ga0209302_10518991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 526 | Open in IMG/M |
3300028102|Ga0247586_1012658 | Not Available | 1410 | Open in IMG/M |
3300028106|Ga0247596_1152935 | Not Available | 527 | Open in IMG/M |
3300028110|Ga0247584_1026674 | Not Available | 1414 | Open in IMG/M |
3300028110|Ga0247584_1076058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
3300028111|Ga0233397_1082991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 835 | Open in IMG/M |
3300028119|Ga0247561_109757 | Not Available | 729 | Open in IMG/M |
3300028126|Ga0228648_1059679 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300028198|Ga0257121_1227322 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300028282|Ga0256413_1145639 | Not Available | 859 | Open in IMG/M |
3300028297|Ga0228617_1106074 | Not Available | 679 | Open in IMG/M |
3300028391|Ga0233394_1122977 | Not Available | 518 | Open in IMG/M |
3300031519|Ga0307488_10103926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 2066 | Open in IMG/M |
3300031626|Ga0302121_10160881 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031851|Ga0315320_10788398 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 20.38% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 15.92% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 13.38% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 8.28% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.01% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.01% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.73% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.46% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.18% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.55% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.27% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.27% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.27% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.27% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.27% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.27% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.64% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.64% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.64% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.64% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.64% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.64% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573028 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15m | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
3300000170 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135m | Environmental | Open in IMG/M |
3300000192 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 100m | Environmental | Open in IMG/M |
3300000226 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m | Environmental | Open in IMG/M |
3300000257 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100 | Environmental | Open in IMG/M |
3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
3300003494 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA | Environmental | Open in IMG/M |
3300003495 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA | Environmental | Open in IMG/M |
3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
3300003501 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA | Environmental | Open in IMG/M |
3300003583 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA | Environmental | Open in IMG/M |
3300003590 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_200m_DNA | Environmental | Open in IMG/M |
3300003595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA | Environmental | Open in IMG/M |
3300003601 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA | Environmental | Open in IMG/M |
3300004277 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m | Environmental | Open in IMG/M |
3300004280 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011248 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.2 | Environmental | Open in IMG/M |
3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012414 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
3300022912 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MG | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
3300024318 | Seawater microbial communities from Monterey Bay, California, United States - 46D | Environmental | Open in IMG/M |
3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
3300024415 | Seawater microbial communities from Monterey Bay, California, United States - 76D | Environmental | Open in IMG/M |
3300025431 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025488 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025614 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025643 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes) | Environmental | Open in IMG/M |
3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
3300025700 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025729 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300026390 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028102 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028111 | Seawater microbial communities from Monterey Bay, California, United States - 35D | Environmental | Open in IMG/M |
3300028119 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GS313G0146KB_00266870 | 2189573028 | Marine Estuarine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
DelMOSum2010_100230513 | 3300000101 | Marine | MTRLDKNYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL* |
DelMOSum2010_100978452 | 3300000101 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
SI39nov09_120mDRAFT_10350852 | 3300000167 | Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI* |
SI36aug09_135mDRAFT_10497512 | 3300000170 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQ |
SI60aug11_100mDRAFT_10017248 | 3300000192 | Marine | MTRXHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL* |
SI34jun09_135mDRAFT_10074724 | 3300000226 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYXVRLIQQTKEXHL* |
LP_F_10_SI03_100DRAFT_10702441 | 3300000257 | Marine | FESKMTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL* |
JGI20154J14316_100387891 | 3300001348 | Pelagic Marine | LDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
JGI20154J14316_100845602 | 3300001348 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQ |
JGI20160J14292_100545701 | 3300001349 | Pelagic Marine | ERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
JGI20153J14318_100892351 | 3300001351 | Pelagic Marine | LLWLLKEIQKSESLWKDELGYAVKLIQQKKEDYL* |
JGI20157J14317_102304152 | 3300001352 | Pelagic Marine | IIERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKEIHL* |
JGI20159J14440_100201386 | 3300001353 | Pelagic Marine | MTALDKNXLLWLLKEIQKSESLWKDELGYAVKLXQQKKEDHL* |
JGI20155J14468_100340085 | 3300001354 | Pelagic Marine | RLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
JGI20155J14468_100784463 | 3300001354 | Pelagic Marine | NYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
JGI20155J14468_102288261 | 3300001354 | Pelagic Marine | MTGLDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKED* |
JGI20158J14315_100614921 | 3300001355 | Pelagic Marine | MTGLDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKE |
GOS2222_10101085 | 3300001940 | Marine | RLDKNYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKENYL* |
JGI26238J51125_10159562 | 3300003478 | Marine | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL* |
JGI26238J51125_10891882 | 3300003478 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
JGI26240J51127_10031174 | 3300003494 | Marine | MTRXHENYLLWLLREIQKSDSLWKDELGYAVRLIQQTKENHL* |
JGI26244J51143_10004632 | 3300003495 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKENHL* |
JGI26239J51126_10077355 | 3300003498 | Marine | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQXTKEDXL* |
JGI26243J51142_10399952 | 3300003501 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQTKENHL* |
JGI26253J51717_10702382 | 3300003583 | Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL* |
JGI26251J51716_10276582 | 3300003590 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL* |
JGI26263J51726_10147643 | 3300003595 | Marine | MTRXHENYLLWLLREIQKSDSLWKDELGYXVRLIQQTKENHL* |
JGI26382J51730_100020027 | 3300003601 | Marine | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEXHL* |
Ga0066611_101612152 | 3300004277 | Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0066606_100290863 | 3300004280 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKEIHL* |
Ga0065861_11996121 | 3300004448 | Marine | LDINSKVKTLERKMTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0073579_10082211 | 3300005239 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI* |
Ga0073579_10096772 | 3300005239 | Marine | LDINSKVKILERKMTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0073579_119159566 | 3300005239 | Marine | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0073579_16878433 | 3300005239 | Marine | MTSLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQNKKENHL* |
Ga0073579_16917721 | 3300005239 | Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQNKETHL* |
Ga0075441_100156653 | 3300006164 | Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0075468_100460972 | 3300007229 | Aqueous | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0102907_11761852 | 3300007962 | Estuarine | MTSLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0102813_10629192 | 3300009003 | Estuarine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQNKEIHL* |
Ga0115566_101567382 | 3300009071 | Pelagic Marine | MTGLDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL* |
Ga0115566_103718922 | 3300009071 | Pelagic Marine | MTRLDENYLLWLLKEIEKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0115566_104756471 | 3300009071 | Pelagic Marine | RKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
Ga0115566_106428292 | 3300009071 | Pelagic Marine | MTALDKNYLLWLLKEIQKSKSLWKDELGYAVKLIQQKKEDHL* |
Ga0115550_11146702 | 3300009076 | Pelagic Marine | VEKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0115552_10412375 | 3300009077 | Pelagic Marine | ERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
Ga0118730_10888633 | 3300009132 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQKKKENHL* |
Ga0114995_100495482 | 3300009172 | Marine | MTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0114995_101283352 | 3300009172 | Marine | MTRLDKNYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKENYL* |
Ga0115547_10218182 | 3300009426 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDYL* |
Ga0115562_11167722 | 3300009434 | Pelagic Marine | MTSLDEKYLLWLLREMQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0115553_11107042 | 3300009445 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAMKLIQQKKEDHL* |
Ga0115553_13913082 | 3300009445 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKED* |
Ga0115560_10586571 | 3300009447 | Pelagic Marine | ILERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL* |
Ga0115565_102194021 | 3300009467 | Pelagic Marine | MTALDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
Ga0115554_11591461 | 3300009472 | Pelagic Marine | KMTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL* |
Ga0115571_11016891 | 3300009495 | Pelagic Marine | ILERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL* |
Ga0115570_100718513 | 3300009496 | Pelagic Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRK |
Ga0115570_101303591 | 3300009496 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESIWKDELGYAVKLIQQKKEDHL* |
Ga0115564_101779152 | 3300009505 | Pelagic Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKFIQHNKQTHL* |
Ga0115003_101491261 | 3300009512 | Marine | MTGLDKNYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKENHL* |
Ga0133547_120641912 | 3300010883 | Marine | LDINSRVKKLERKMTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKEN |
Ga0133547_121542122 | 3300010883 | Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQNKKENHL* |
Ga0151670_10740542 | 3300011248 | Marine | MTTLDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKENHL* |
Ga0138258_12910561 | 3300012413 | Polar Marine | MTGLDKNYLLWLLKEIQKGDSVWKDELGYAVKLIQKKKENHL* |
Ga0138264_18180092 | 3300012414 | Polar Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQ |
Ga0181552_100225185 | 3300017824 | Salt Marsh | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL |
Ga0192947_102151562 | 3300018982 | Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQKKKKKKK |
Ga0206125_100188146 | 3300020165 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL |
Ga0206125_103017931 | 3300020165 | Seawater | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0206128_11075592 | 3300020166 | Seawater | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKGDHL |
Ga0206128_11850871 | 3300020166 | Seawater | YSLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL |
Ga0206127_11031003 | 3300020169 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0211689_11046042 | 3300020358 | Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQNKKENHL |
Ga0211506_10685371 | 3300020365 | Marine | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQKKKENHL |
Ga0211576_100553843 | 3300020438 | Marine | MTRLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQNKKENHL |
Ga0211545_101995602 | 3300020452 | Marine | MTSLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQKKKENHL |
Ga0206126_100982513 | 3300020595 | Seawater | MTTLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0206126_101998583 | 3300020595 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKESHL |
Ga0206677_100539363 | 3300021085 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0206677_101521822 | 3300021085 | Seawater | MTRLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0206682_102136172 | 3300021185 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQ |
Ga0206692_16206342 | 3300021350 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKEIHL |
Ga0213863_101264652 | 3300021371 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0213868_101270513 | 3300021389 | Seawater | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0222718_101826212 | 3300021958 | Estuarine Water | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKK |
(restricted) Ga0233428_10341832 | 3300022888 | Seawater | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
(restricted) Ga0233430_12958091 | 3300022912 | Seawater | MTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQTKENHL |
(restricted) Ga0233426_101187182 | 3300022920 | Seawater | MTSLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQNKKENHL |
(restricted) Ga0233427_100086138 | 3300022933 | Seawater | KMTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
(restricted) Ga0233427_102226001 | 3300022933 | Seawater | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDH |
Ga0232122_10249892 | 3300023709 | Salt Marsh | MTELDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL |
Ga0228668_10520923 | 3300024180 | Seawater | NYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228668_10927051 | 3300024180 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQ |
Ga0228669_10966512 | 3300024185 | Seawater | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQNKETHL |
Ga0228636_11220692 | 3300024191 | Seawater | RLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0233402_10648732 | 3300024229 | Seawater | EEKMTSLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228655_11345351 | 3300024236 | Seawater | ENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228676_11067312 | 3300024248 | Seawater | ENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHI |
(restricted) Ga0233444_101447311 | 3300024264 | Seawater | YLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228630_10747902 | 3300024292 | Seawater | ENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228651_11260411 | 3300024293 | Seawater | IKILERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0228664_11064521 | 3300024294 | Seawater | YLLWLLKEIQKSDSLWRDELGYAVKLIQQNKETHL |
(restricted) Ga0233449_12407002 | 3300024302 | Seawater | YIFEGKMTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQTKENHL |
Ga0233400_10222891 | 3300024318 | Seawater | KMTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0233400_11020401 | 3300024318 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQK |
(restricted) Ga0233443_100141618 | 3300024324 | Seawater | SAYIFERKMTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
(restricted) Ga0233443_10203612 | 3300024324 | Seawater | MTRLHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKENHL |
Ga0228662_10864842 | 3300024415 | Seawater | MTTLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQNKETHL |
Ga0209449_10085361 | 3300025431 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQT |
Ga0209141_10459752 | 3300025488 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
Ga0209556_10354452 | 3300025547 | Marine | MTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQ |
Ga0209556_11183221 | 3300025547 | Marine | LDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0209662_11528821 | 3300025596 | Marine | KMTRLHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKENHL |
Ga0209665_10648131 | 3300025614 | Marine | VLLNYIEEKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0209151_10198131 | 3300025643 | Marine | IFERKMTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
Ga0209306_10233881 | 3300025680 | Pelagic Marine | ERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQRKKETHL |
Ga0209661_11518841 | 3300025700 | Marine | EKMTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0209660_11981462 | 3300025722 | Marine | YIFERKMTRSHENYLLWLLREIQKSDSLWKDELGYLVRLIQQTKEDHL |
Ga0209558_11695511 | 3300025729 | Marine | MTRLHENYLLWLLREIQKSDSLWKDELGYAVRLIQQTK |
Ga0208425_10356403 | 3300025803 | Aqueous | LDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDHL |
Ga0209199_10923012 | 3300025809 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKE |
Ga0209603_10969362 | 3300025849 | Pelagic Marine | MTALDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKEDH |
Ga0209308_103065422 | 3300025869 | Pelagic Marine | MTGLDKNYLLWLLKEIQKSESLWKDELGYAVKLIQQKKED |
Ga0209533_10246365 | 3300025874 | Pelagic Marine | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQK |
Ga0209534_100748645 | 3300025880 | Pelagic Marine | ERKMTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0209631_105057461 | 3300025890 | Pelagic Marine | KMTRLDENYLLWLLREIQKSNSLWKDELGYAVKLIQKKKETHL |
Ga0247558_1228982 | 3300026390 | Seawater | MTRLDENYLLWLLKEIQKSDILWKDELGYAVKLIQQKKETHL |
Ga0247594_10313151 | 3300026448 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETH |
Ga0247598_10440691 | 3300026466 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETH |
Ga0247598_11510322 | 3300026466 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELDYAVKLIQQKKE |
Ga0247602_11671051 | 3300026471 | Seawater | MTRLDENYLLWLLREIQKSDSLWNDELGYAVKLIQQKKET |
Ga0247605_10614152 | 3300026503 | Seawater | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKVIQ |
Ga0247587_10773681 | 3300026504 | Seawater | MTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKET |
Ga0209384_10025818 | 3300027522 | Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKENHL |
Ga0208947_10795882 | 3300027553 | Marine | RLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0209710_10176195 | 3300027687 | Marine | MTRLDKNYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKENYL |
Ga0209710_11751651 | 3300027687 | Marine | MTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENYL |
Ga0209816_11471392 | 3300027704 | Marine | MTGLDKNYLLWLLKEIQKSDSLWKDELGYAVKLIQKKKENHI |
Ga0209192_100339353 | 3300027752 | Marine | MTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL |
Ga0209830_100154832 | 3300027791 | Marine | MTRLDKNYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENYL |
Ga0209302_105189911 | 3300027810 | Marine | EGKMTTLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0247586_10126582 | 3300028102 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQPKKET |
Ga0247596_11529351 | 3300028106 | Seawater | MTRLDENYLLWLLKEMQKSDSLWKDELGYAVKLIQQKKET |
Ga0247584_10266742 | 3300028110 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKE |
Ga0247584_10760582 | 3300028110 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKES |
Ga0233397_10829911 | 3300028111 | Seawater | YLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0247561_1097572 | 3300028119 | Seawater | MTRLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKK |
Ga0228648_10596792 | 3300028126 | Seawater | LEGKMTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKETHI |
Ga0257121_12273222 | 3300028198 | Marine | NYIEEKMTSLDENYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKETHL |
Ga0256413_11456392 | 3300028282 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKE |
Ga0228617_11060741 | 3300028297 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQK |
Ga0233394_11229772 | 3300028391 | Seawater | MTRLDENYLLWLLREIQKSDSLWKDELGYAVKLIQQKKEIHL |
Ga0307488_101039262 | 3300031519 | Sackhole Brine | LDINSRVKTLERKMTRLDENYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENHL |
Ga0302121_101608812 | 3300031626 | Marine | MTGLDKNYLLWLLREMQKSDSLWKDELGYAVKLIQQKKENH |
Ga0315320_107883982 | 3300031851 | Seawater | MTRLDESYLLWLLKEIQKSDSLWKDELGYAVKLIQQKKEIHL |
⦗Top⦘ |