Basic Information | |
---|---|
Family ID | F043315 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 156 |
Average Sequence Length | 42 residues |
Representative Sequence | LPNKRLKLPGPAFKGTVRLCASELVPQGGALAPAGARPAA |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 43.92 % |
% of genes near scaffold ends (potentially truncated) | 66.67 % |
% of genes from short scaffolds (< 2000 bps) | 71.15 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.538 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (35.897 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.513 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 156 Family Scaffolds |
---|---|---|
PF14534 | DUF4440 | 3.21 |
PF07883 | Cupin_2 | 2.56 |
PF09932 | DUF2164 | 1.92 |
PF12681 | Glyoxalase_2 | 1.92 |
PF07927 | HicA_toxin | 1.92 |
PF13474 | SnoaL_3 | 1.28 |
PF00903 | Glyoxalase | 1.28 |
PF03544 | TonB_C | 1.28 |
PF05163 | DinB | 1.28 |
PF09413 | DUF2007 | 1.28 |
PF04893 | Yip1 | 1.28 |
PF01872 | RibD_C | 1.28 |
PF07311 | Dodecin | 1.28 |
PF13540 | RCC1_2 | 1.28 |
PF04365 | BrnT_toxin | 0.64 |
PF04993 | TfoX_N | 0.64 |
PF12158 | DUF3592 | 0.64 |
PF12680 | SnoaL_2 | 0.64 |
PF00127 | Copper-bind | 0.64 |
PF13602 | ADH_zinc_N_2 | 0.64 |
PF13826 | DUF4188 | 0.64 |
PF07045 | DUF1330 | 0.64 |
PF11528 | DUF3224 | 0.64 |
PF04191 | PEMT | 0.64 |
PF13643 | DUF4145 | 0.64 |
PF14137 | DUF4304 | 0.64 |
PF00005 | ABC_tran | 0.64 |
PF14106 | DUF4279 | 0.64 |
PF14485 | DUF4431 | 0.64 |
PF00144 | Beta-lactamase | 0.64 |
PF06348 | DUF1059 | 0.64 |
PF01965 | DJ-1_PfpI | 0.64 |
PF08592 | Anthrone_oxy | 0.64 |
PF13936 | HTH_38 | 0.64 |
PF13683 | rve_3 | 0.64 |
PF02861 | Clp_N | 0.64 |
PF13184 | KH_5 | 0.64 |
PF00717 | Peptidase_S24 | 0.64 |
COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
---|---|---|---|
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.92 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.28 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.28 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.28 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.28 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.28 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.64 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.64 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.64 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.64 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.54 % |
Unclassified | root | N/A | 38.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1074299 | Not Available | 554 | Open in IMG/M |
3300002561|JGI25384J37096_10048542 | Not Available | 1619 | Open in IMG/M |
3300002562|JGI25382J37095_10028463 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
3300002562|JGI25382J37095_10067926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1334 | Open in IMG/M |
3300002562|JGI25382J37095_10154180 | Not Available | 745 | Open in IMG/M |
3300002908|JGI25382J43887_10073158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1850 | Open in IMG/M |
3300002908|JGI25382J43887_10405044 | Not Available | 576 | Open in IMG/M |
3300005171|Ga0066677_10009311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4190 | Open in IMG/M |
3300005174|Ga0066680_10025099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3310 | Open in IMG/M |
3300005175|Ga0066673_10795656 | Not Available | 541 | Open in IMG/M |
3300005176|Ga0066679_10484433 | Not Available | 808 | Open in IMG/M |
3300005178|Ga0066688_10621852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. B05 | 693 | Open in IMG/M |
3300005178|Ga0066688_11018658 | Not Available | 504 | Open in IMG/M |
3300005179|Ga0066684_11009970 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005187|Ga0066675_10021306 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
3300005187|Ga0066675_10074096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2175 | Open in IMG/M |
3300005187|Ga0066675_10967641 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005446|Ga0066686_10644788 | Not Available | 719 | Open in IMG/M |
3300005468|Ga0070707_100169972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWB2_55_19 | 2124 | Open in IMG/M |
3300005518|Ga0070699_100731578 | Not Available | 904 | Open in IMG/M |
3300005529|Ga0070741_10008894 | All Organisms → cellular organisms → Bacteria | 19865 | Open in IMG/M |
3300005552|Ga0066701_10411085 | Not Available | 838 | Open in IMG/M |
3300005553|Ga0066695_10514135 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005553|Ga0066695_10625693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 642 | Open in IMG/M |
3300005556|Ga0066707_10656117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300005557|Ga0066704_10203714 | Not Available | 1338 | Open in IMG/M |
3300005557|Ga0066704_11038742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300005558|Ga0066698_10360996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1003 | Open in IMG/M |
3300005561|Ga0066699_10242774 | Not Available | 1268 | Open in IMG/M |
3300005561|Ga0066699_10699378 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300005566|Ga0066693_10061251 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300005569|Ga0066705_10582422 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005569|Ga0066705_10600185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 675 | Open in IMG/M |
3300005569|Ga0066705_10653359 | Not Available | 639 | Open in IMG/M |
3300005574|Ga0066694_10471495 | Not Available | 586 | Open in IMG/M |
3300005575|Ga0066702_10845454 | Not Available | 545 | Open in IMG/M |
3300005576|Ga0066708_10079039 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300005587|Ga0066654_10444571 | All Organisms → cellular organisms → Bacteria → FCB group | 708 | Open in IMG/M |
3300006031|Ga0066651_10006582 | All Organisms → cellular organisms → Bacteria | 4545 | Open in IMG/M |
3300006034|Ga0066656_10024562 | All Organisms → cellular organisms → Bacteria | 3276 | Open in IMG/M |
3300006034|Ga0066656_11066463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
3300006034|Ga0066656_11091981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300006046|Ga0066652_101238081 | Not Available | 706 | Open in IMG/M |
3300006791|Ga0066653_10440582 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006791|Ga0066653_10519838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
3300006796|Ga0066665_11465118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
3300006797|Ga0066659_10625936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 875 | Open in IMG/M |
3300006797|Ga0066659_10727323 | Not Available | 814 | Open in IMG/M |
3300006797|Ga0066659_10768569 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300006797|Ga0066659_11856448 | Not Available | 511 | Open in IMG/M |
3300006903|Ga0075426_10036522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3512 | Open in IMG/M |
3300009012|Ga0066710_102961834 | Not Available | 663 | Open in IMG/M |
3300009012|Ga0066710_104137101 | Not Available | 542 | Open in IMG/M |
3300009012|Ga0066710_104681518 | Not Available | 511 | Open in IMG/M |
3300009090|Ga0099827_10009735 | Not Available | 6123 | Open in IMG/M |
3300010304|Ga0134088_10212130 | Not Available | 928 | Open in IMG/M |
3300010304|Ga0134088_10508777 | Not Available | 594 | Open in IMG/M |
3300010304|Ga0134088_10528797 | Not Available | 582 | Open in IMG/M |
3300010304|Ga0134088_10569058 | Not Available | 562 | Open in IMG/M |
3300010323|Ga0134086_10071040 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300010323|Ga0134086_10363657 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300010325|Ga0134064_10148688 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300010326|Ga0134065_10336229 | Not Available | 589 | Open in IMG/M |
3300010329|Ga0134111_10200361 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300010335|Ga0134063_10320939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
3300010364|Ga0134066_10332234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300012198|Ga0137364_10009262 | All Organisms → cellular organisms → Bacteria | 5532 | Open in IMG/M |
3300012198|Ga0137364_10873044 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300012198|Ga0137364_11363351 | Not Available | 526 | Open in IMG/M |
3300012199|Ga0137383_10095538 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300012199|Ga0137383_10517928 | Not Available | 873 | Open in IMG/M |
3300012200|Ga0137382_11283972 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300012201|Ga0137365_10023240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4802 | Open in IMG/M |
3300012206|Ga0137380_10347408 | Not Available | 1323 | Open in IMG/M |
3300012206|Ga0137380_10637368 | Not Available | 929 | Open in IMG/M |
3300012207|Ga0137381_10098391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2478 | Open in IMG/M |
3300012207|Ga0137381_10209671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1689 | Open in IMG/M |
3300012208|Ga0137376_10139396 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300012208|Ga0137376_10445181 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300012208|Ga0137376_11796619 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 503 | Open in IMG/M |
3300012209|Ga0137379_10099436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2799 | Open in IMG/M |
3300012209|Ga0137379_10550620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1061 | Open in IMG/M |
3300012211|Ga0137377_10825564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 859 | Open in IMG/M |
3300012211|Ga0137377_11352957 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012211|Ga0137377_11539618 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300012211|Ga0137377_11766487 | Not Available | 539 | Open in IMG/M |
3300012285|Ga0137370_10256455 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300012350|Ga0137372_10052007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3614 | Open in IMG/M |
3300012351|Ga0137386_10247647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1281 | Open in IMG/M |
3300012356|Ga0137371_10168389 | Not Available | 1719 | Open in IMG/M |
3300012357|Ga0137384_10037252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4008 | Open in IMG/M |
3300012361|Ga0137360_10834868 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300012362|Ga0137361_10042245 | Not Available | 3707 | Open in IMG/M |
3300012388|Ga0134031_1281049 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012683|Ga0137398_10866487 | Not Available | 630 | Open in IMG/M |
3300012925|Ga0137419_10173509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1576 | Open in IMG/M |
3300012925|Ga0137419_11374638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
3300012929|Ga0137404_11603117 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012930|Ga0137407_10057254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3192 | Open in IMG/M |
3300012930|Ga0137407_11073278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 763 | Open in IMG/M |
3300012972|Ga0134077_10154777 | Not Available | 916 | Open in IMG/M |
3300012972|Ga0134077_10334456 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012975|Ga0134110_10251933 | Not Available | 752 | Open in IMG/M |
3300012977|Ga0134087_10624119 | Not Available | 561 | Open in IMG/M |
3300012977|Ga0134087_10802868 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300014154|Ga0134075_10010069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3636 | Open in IMG/M |
3300014157|Ga0134078_10211217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
3300015357|Ga0134072_10416671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300015358|Ga0134089_10123157 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300015358|Ga0134089_10361428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
3300017657|Ga0134074_1207384 | Not Available | 697 | Open in IMG/M |
3300017657|Ga0134074_1303381 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300018431|Ga0066655_10019574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3126 | Open in IMG/M |
3300018433|Ga0066667_12184727 | Not Available | 515 | Open in IMG/M |
3300018482|Ga0066669_10574790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 985 | Open in IMG/M |
3300018482|Ga0066669_11269763 | Not Available | 665 | Open in IMG/M |
3300018482|Ga0066669_12052711 | Not Available | 537 | Open in IMG/M |
3300018482|Ga0066669_12249374 | Not Available | 518 | Open in IMG/M |
3300026277|Ga0209350_1009948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3105 | Open in IMG/M |
3300026277|Ga0209350_1017554 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
3300026296|Ga0209235_1043957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2199 | Open in IMG/M |
3300026297|Ga0209237_1048958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RIFCSPLOWO2_12_FULL_68_9 | 2139 | Open in IMG/M |
3300026297|Ga0209237_1154067 | Not Available | 881 | Open in IMG/M |
3300026307|Ga0209469_1122055 | Not Available | 634 | Open in IMG/M |
3300026310|Ga0209239_1030279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2580 | Open in IMG/M |
3300026313|Ga0209761_1030571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3237 | Open in IMG/M |
3300026313|Ga0209761_1032476 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
3300026314|Ga0209268_1169345 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300026315|Ga0209686_1005870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5389 | Open in IMG/M |
3300026316|Ga0209155_1056091 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300026326|Ga0209801_1273512 | Not Available | 617 | Open in IMG/M |
3300026329|Ga0209375_1007440 | All Organisms → cellular organisms → Bacteria | 7050 | Open in IMG/M |
3300026331|Ga0209267_1295752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
3300026332|Ga0209803_1092052 | Not Available | 1252 | Open in IMG/M |
3300026333|Ga0209158_1315302 | Not Available | 540 | Open in IMG/M |
3300026527|Ga0209059_1187286 | Not Available | 710 | Open in IMG/M |
3300026528|Ga0209378_1031043 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
3300026538|Ga0209056_10380171 | Not Available | 895 | Open in IMG/M |
3300026538|Ga0209056_10462504 | Not Available | 702 | Open in IMG/M |
3300026538|Ga0209056_10529753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → Desulfuromonas soudanensis | 605 | Open in IMG/M |
3300026540|Ga0209376_1191271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 940 | Open in IMG/M |
3300026542|Ga0209805_1118747 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300026547|Ga0209156_10001713 | All Organisms → cellular organisms → Bacteria | 17651 | Open in IMG/M |
3300026548|Ga0209161_10271905 | Not Available | 857 | Open in IMG/M |
3300026550|Ga0209474_10363080 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300027706|Ga0209581_1001926 | All Organisms → cellular organisms → Bacteria | 21960 | Open in IMG/M |
3300027882|Ga0209590_10001129 | All Organisms → cellular organisms → Bacteria | 9854 | Open in IMG/M |
3300027903|Ga0209488_10034957 | All Organisms → cellular organisms → Bacteria | 3670 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 35.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.56% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10742992 | 3300002557 | Grasslands Soil | WGARLTALPNKRLKLTGPAFRGSVGLRSNELVRQGVVLAPTGVRPAA* |
JGI25384J37096_100485423 | 3300002561 | Grasslands Soil | MTAAQRGPPNKRLKLTGPAFRGSGRLSTGPQIPQGGPLAPAGPRP |
JGI25382J37095_100284633 | 3300002562 | Grasslands Soil | MVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPAGTRPAA* |
JGI25382J37095_100679261 | 3300002562 | Grasslands Soil | LPNKRLKLTGPAFRGGVRLCPSRPVPQAGALAPAGRRPAA* |
JGI25382J37095_101541802 | 3300002562 | Grasslands Soil | EVKQPPNMRLKLTGPALKGSVRLCAGEPVAQRRALAPAGLRPAA* |
JGI25382J43887_100731584 | 3300002908 | Grasslands Soil | MPNKRLKLTGPAFKGSMCLCANPQIPQHGALAPAGARPAA* |
JGI25382J43887_104050443 | 3300002908 | Grasslands Soil | PPNKRLKLTGPAFRGSLRLCANELVRQGGVLAPAGARTAA* |
Ga0066677_100093111 | 3300005171 | Soil | PVNPGAVMPNKRLKLPGPAFRGSGRLCTGEPVPQGGALALAGFRPAA* |
Ga0066680_100250994 | 3300005174 | Soil | MVVKLLPNKRLKLAGPAFRGSVPLSPSELVPQGGALAPTGARTAA* |
Ga0066673_107956562 | 3300005175 | Soil | RQPPNKRLKLTGPAFKGTGRLCASRRVTQGGALAPVGARPAA* |
Ga0066679_104844332 | 3300005176 | Soil | MNMLVPNKRLKLTGPAFRGSVCLCANELVLQGRALAPAGHRPAA* |
Ga0066688_106218521 | 3300005178 | Soil | VLPNKRLKLTGPAFKGTLRLSANELVPQREVLAPSGARPAA* |
Ga0066688_110186582 | 3300005178 | Soil | PNKRLKLAGPAFRGGVRLCTNDLVPQGGALAPAGVRPAA* |
Ga0066684_110099702 | 3300005179 | Soil | SNKRLKLPGPAFRGSVRLRARQQVTQGGVLAPASRRPAA* |
Ga0066675_100213068 | 3300005187 | Soil | MPNKRLKLPGPAFKGTVRLSAGQLVTQGGALAPASARPAA* |
Ga0066675_100740962 | 3300005187 | Soil | MLLPNKPLKLAGPALKGTLLLCASQLVTQGGALAPVGARPAA* |
Ga0066675_109676411 | 3300005187 | Soil | LKAPRPNKRLKLAGPAFKGSLRLCARQQVTQGRALAPAGRCPAA* |
Ga0066686_106447881 | 3300005446 | Soil | MRLPNMRLKLPGPVFRGSVRLCPDELVPQGEALAPAGARPAA* |
Ga0070707_1001699724 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPNMRLKLAGPAFRGSERLCASPHVPQRGVLAPAGARPAA* |
Ga0070699_1007315782 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLPNMRLKLTGPAFKGILRLCASRLVTQSMVLAPAGARPAA* |
Ga0070741_1000889429 | 3300005529 | Surface Soil | MIKQPPNKRLKLTGLAFKGSVRSCASQLVPQGGALAPACARPAA* |
Ga0066701_104110852 | 3300005552 | Soil | TWGIVSLEPPNKRLKLPGPAFRGTVRLCVNQLVPQGRVLAPAGARPAA* |
Ga0066695_105141352 | 3300005553 | Soil | MSPRKLPNKRLKLTGPPFRGGVRLCASALVPQGRVLAPAGARPAA* |
Ga0066695_106190391 | 3300005553 | Soil | VKSLEPLIRAVRPNKRLKLTGPAFRGGVCLCANELVPQGGALAPASLRPA |
Ga0066695_106256931 | 3300005553 | Soil | APPNMRLKLAGPALKGTVRLSASQPVTHGGALALAGARPAA* |
Ga0066707_106561171 | 3300005556 | Soil | SHRDCEHVWPRPNKRLKLTGPAFRGSVCLSADELVPQGGVLAPAGARPAA* |
Ga0066704_102037141 | 3300005557 | Soil | KLPGPAFRGSVRLCANELVPEGGVLVPAGARPAA* |
Ga0066704_110387421 | 3300005557 | Soil | RPNKRLKLAGPAFRGGVRLCANDLVPQGGELAPTGVRPAA* |
Ga0066698_103609961 | 3300005558 | Soil | VLPNKRLKLTGPAFKGRVRLCARKQVTQGGALAPAGARPAA* |
Ga0066699_102427743 | 3300005561 | Soil | MVVKLLPNKRLKLAGPAFRGSVRLSPSELVPQGGALAPTGARPAA* |
Ga0066699_106993783 | 3300005561 | Soil | NKRLKLAGPAFRGSVRLRTRVQIPQYGALAPAGARPAA* |
Ga0066693_100612514 | 3300005566 | Soil | MPPNKRLKLPGPAFEDSVRLCPNQLVQQGGVLAPASARPAA* |
Ga0066705_105824221 | 3300005569 | Soil | APNKRLKLPGPAFRGSVRLRARQQVTQGGVLAPASRRPAA* |
Ga0066705_106001851 | 3300005569 | Soil | NKRLKLTGPAFKGSVRLCANELVPQGGVLAPAGARPTA* |
Ga0066705_106533592 | 3300005569 | Soil | PNKRLKVAGPAFRGSTRLRAGQPVPLGGVLAPAGARPAA* |
Ga0066694_104714952 | 3300005574 | Soil | MPPNKRLKVAGPAFRGSVRLCANGLVPQCAALAPAG |
Ga0066702_108454541 | 3300005575 | Soil | PPNKRLKLAGPAFRGGVRLCPGEAVPQGVVLAPAGARPAA* |
Ga0066708_100790391 | 3300005576 | Soil | PLPNKRLKLTGPAFRGSVRLCANALVPQGAVLAPTGARPAA* |
Ga0066654_104445712 | 3300005587 | Soil | LPNKRLKLPGPAFKGSIRLCTSLPIPQHEALAPVGARPAP* |
Ga0066651_100065826 | 3300006031 | Soil | VTPLSNKRLKLAGPAFRGSVRLRTSVQIPQYGALAPAGARPAA* |
Ga0066656_100245625 | 3300006034 | Soil | MLPNKRLKLAGPAFRGGGSLCASQPMTQGEALAPTCPRPAA* |
Ga0066656_110664632 | 3300006034 | Soil | WPPSNKRLKLAGPTFRGGVRLYANELVPRGGVLAPAGARPPA* |
Ga0066656_110919812 | 3300006034 | Soil | QPNKRLKLTGPALRGSGGLCASKLVPQAEVLVPGRVRPAA* |
Ga0066652_1012380811 | 3300006046 | Soil | KRLKLAGPVLKESVRLCANELVPQGEALAPAGVRPAA* |
Ga0066653_104405823 | 3300006791 | Soil | LPNKRLKLTGPAFRGGVGLCADELVPQGGALAPTGARPAA* |
Ga0066653_105198382 | 3300006791 | Soil | LPNKRLKLTGPALRRSVRLCAGQQFTQQGALAPAGVRPAA* |
Ga0066665_114651182 | 3300006796 | Soil | MIGTWLPNKRLKLTGPAFRGSERLCPSPLIPQGGVLAPAGARPAA |
Ga0066659_106259361 | 3300006797 | Soil | PPNKRLKLAGPAFKGTVRLSASQPVTHGGALALAGARPAA* |
Ga0066659_107273231 | 3300006797 | Soil | MRESRERRPNKRLKLTWPALRGTVNLPANGLVTQGGALAPPGTRPAA* |
Ga0066659_107685692 | 3300006797 | Soil | MRLKLPGPALNGTVRSSAGGQVTQRGALAPVGVRPAA* |
Ga0066659_118564481 | 3300006797 | Soil | LPNKRLKLPGPAFKGTVRLCASELVPQGGALAPAGARPAA* |
Ga0075426_100365222 | 3300006903 | Populus Rhizosphere | MIGRGAVAPNKRLQLSGPAFRGRVRLCASEQIPQRGVLAPTGARPAA* |
Ga0066710_1029618341 | 3300009012 | Grasslands Soil | VAVPPNKRLKLPGPAFRGCVRLCANVLVPQGEALAPAGARPAA |
Ga0066710_1041371011 | 3300009012 | Grasslands Soil | VGWLPNKRLKLPGPAFGGSVRLCTSQVIPQGGALAPAGARP |
Ga0066710_1046815182 | 3300009012 | Grasslands Soil | LPNKRLKLAGPASKGSVRLCARQQVTEGGALGLPGR |
Ga0099827_100097355 | 3300009090 | Vadose Zone Soil | MMPPNKRLKVAGPAFRGRVRLCASPQVPQGGALAPAGARPAA* |
Ga0134088_102121303 | 3300010304 | Grasslands Soil | MLLPPNKRLKLAGPALKGSVRLCPDELVPHGEALAPAGVRPAA |
Ga0134088_105087771 | 3300010304 | Grasslands Soil | TAFVAAVLPNMRLKLAGLALKGSRHLCGSRPVTQGGALAPARARPAA* |
Ga0134088_105287972 | 3300010304 | Grasslands Soil | PNKRLKLPGPAFRGNVRLFTGELIPQGGALAPAGVRPAA* |
Ga0134088_105690581 | 3300010304 | Grasslands Soil | LMPLPNKRLKLTAPALKGNARLRASQLVPQDGALAPAGPRPAA* |
Ga0134086_100710402 | 3300010323 | Grasslands Soil | WERSVRAQPNKRLKLPGPAFRGSVRLCPNKLVPQRGALAPAGVRPAA* |
Ga0134086_103636571 | 3300010323 | Grasslands Soil | VIKWCARVRPNKRLKLTGPAFRGTRRLCADELVPQGRALAPAGARP |
Ga0134064_101486881 | 3300010325 | Grasslands Soil | YECTPPNKRLKLTGPAFRGSVRLCPTQLVTQGGALAPAGARPAA* |
Ga0134065_103362292 | 3300010326 | Grasslands Soil | LKVTGPAFKGGVGLCTNPLVQQGGALAPASARPAA* |
Ga0134111_102003611 | 3300010329 | Grasslands Soil | PNKRLKLPGPAFRGDVRLCANEVVPQGGVLAPADPRPAA* |
Ga0134063_103209392 | 3300010335 | Grasslands Soil | LKSVPPNKRLKLTGPAFKGSVRLCANELVPQGGVLAPAGARPTA* |
Ga0134066_103322342 | 3300010364 | Grasslands Soil | MPPNKRLKLPGPAFEDSVRLCPNQLVQQGGVLAPA |
Ga0137364_100092628 | 3300012198 | Vadose Zone Soil | MGPLPNKRLKLTGPAFKGSPRLCARQQVTQGGALAPAGARPAA* |
Ga0137364_108730441 | 3300012198 | Vadose Zone Soil | MPPNKRLKLTGPAFRGSVRVRTSLLVPQGGALAPT |
Ga0137364_113633511 | 3300012198 | Vadose Zone Soil | MPPNKRLKLPGPAFRGSVRLCASLHIPQPEALAPVSVRPA |
Ga0137383_100955381 | 3300012199 | Vadose Zone Soil | MLRPNKRLKLPGPVFRGSVRLCANKLVPQGWALAPAGARPAA |
Ga0137383_105179281 | 3300012199 | Vadose Zone Soil | VALPNKRLKLPGPAFRGTVRLCANQPIPQGGALAPAGARPAA* |
Ga0137382_112839722 | 3300012200 | Vadose Zone Soil | MPPNKRLKLAGPAFRGSGGLCTSHLIPQGGALAPVG |
Ga0137365_100232405 | 3300012201 | Vadose Zone Soil | VKGLLPNKRLKLAGPAFRGSRRLCANELVPQGGALAPASARPAA* |
Ga0137380_103474082 | 3300012206 | Vadose Zone Soil | MHSAQRPNKRLKLPGPAFSGGVRLCPSQQVPQDGALAPASGRPAA |
Ga0137380_106373683 | 3300012206 | Vadose Zone Soil | GALMPNKRLKLPGPAFRGGVRLCADELVPQGAVLAPAGARPAA* |
Ga0137381_100983915 | 3300012207 | Vadose Zone Soil | MISLVCVLRLPNKRLKLAGPAFRGGVRLCASELVPQGGVLAPAGARPAA* |
Ga0137381_102096711 | 3300012207 | Vadose Zone Soil | TRTSGLNSLDRLPNKRLKLAGPAFRGSVRLCPSEPIPQGAVLAPVGGRPAA* |
Ga0137376_101393961 | 3300012208 | Vadose Zone Soil | MSAPPNKRLKLTGPGFRGSVRLCSNELVPQGAVLAPVGARPAA* |
Ga0137376_104451812 | 3300012208 | Vadose Zone Soil | MSSGALPNKRLKLTGRAFRGNGGLCPSQLVTQGGALAPAGARPAA* |
Ga0137376_117966191 | 3300012208 | Vadose Zone Soil | MKRTPNKPLKLAGRAFKGSVRLFANELVPQGGVLAP |
Ga0137379_100994363 | 3300012209 | Vadose Zone Soil | METLPNKRLKLPGPAFRGGGRLCANELVPQGGELAPADARPAA* |
Ga0137379_105506203 | 3300012209 | Vadose Zone Soil | MLPNKRLKLAGPAFRGSAPLCTSRQIPQHGALAPVGA |
Ga0137377_108255641 | 3300012211 | Vadose Zone Soil | LKLPGPALKGSVRLYTNELVPQGGALAPAGARPAA* |
Ga0137377_113529571 | 3300012211 | Vadose Zone Soil | MRLPNKRLKLPGPALKGTVRLCTSQPISQSGALAPAG |
Ga0137377_115396181 | 3300012211 | Vadose Zone Soil | MSDSERRQPNKRLKLAGPALSGSVRLCPDEAVPQGGALVPAGA |
Ga0137377_117664871 | 3300012211 | Vadose Zone Soil | RLKLPGPAFKGCVRLCANELVPQAGALAPAGVRPAA* |
Ga0137370_102564551 | 3300012285 | Vadose Zone Soil | VQMTFRQPSNKRLKLAGPAFRGSLRLCAHQQVTQGGALAPSGARPAA* |
Ga0137372_100520077 | 3300012350 | Vadose Zone Soil | MTRLVGGRVPNKRLKLAGPAFSGSVGLCANELVPQGGPLAPAGASPAA* |
Ga0137386_102476471 | 3300012351 | Vadose Zone Soil | MSGREPPNKRLKLPGPAFRRDVRLRASQLVPQGGVLAPAGARPAAKA |
Ga0137371_101683894 | 3300012356 | Vadose Zone Soil | RNTRLVASNLHLVRQQPNKRLKLPGPAFKGSGRFCTNQPVPQGGALAPAGVRPAA* |
Ga0137384_100372521 | 3300012357 | Vadose Zone Soil | MYPLQPNKRLKLTGPAFRGSVRLCANEFVPQGGVLAPAGARPAA* |
Ga0137360_1001469911 | 3300012361 | Vadose Zone Soil | RRCGLGPMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPVGTRPAA* |
Ga0137360_108348682 | 3300012361 | Vadose Zone Soil | MRLKLAGPAFKGTLRLCTSQPVTQGEALAPASPRPAAYARSVR |
Ga0137360_110401971 | 3300012361 | Vadose Zone Soil | MRRLGLGTMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPAGTRPA |
Ga0137361_100422456 | 3300012362 | Vadose Zone Soil | MRLKLTGPAFRGSARLCASLQIPQLWALAPAGVRPAA* |
Ga0137361_102701822 | 3300012362 | Vadose Zone Soil | MRRLGLGTMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPAGTRPAA* |
Ga0134031_12810492 | 3300012388 | Grasslands Soil | MPNKRLKLPGPAFRGDVRLCTNELVPQGGVLAPAGARPA |
Ga0137398_108664871 | 3300012683 | Vadose Zone Soil | MGRTPPNKRLKLTGPAFRGIVRLCSSLQIPQHGALAPADACA |
Ga0137395_100300256 | 3300012917 | Vadose Zone Soil | GLGPMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPVGTRPAA* |
Ga0137395_107299161 | 3300012917 | Vadose Zone Soil | MRRLGLGPMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLL |
Ga0137359_100076992 | 3300012923 | Vadose Zone Soil | MRRCGLGPMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPVGTRPAA* |
Ga0137419_101735091 | 3300012925 | Vadose Zone Soil | KLTGPAFKGTVRLCANDLVPQGRVLAPASLRPAA* |
Ga0137419_113746381 | 3300012925 | Vadose Zone Soil | VHPGAVMPNKRLKLPGPAFKGYIRLRANELIPQSEALAPVGLRPAA* |
Ga0137404_116031171 | 3300012929 | Vadose Zone Soil | LALPNKRLKLPGPAFRGGVRLYANELVPQGDVLAPVGARPAA* |
Ga0137407_100572545 | 3300012930 | Vadose Zone Soil | MNFVEHRPNKRLKLPGPAFRGIVRLCPCQPAPQCGALAPAGARPAA* |
Ga0137407_110732781 | 3300012930 | Vadose Zone Soil | NKRLKLAGPALKGSVRLCANELVPQGEALAPAGVRPAA* |
Ga0134077_101547772 | 3300012972 | Grasslands Soil | MMPKLLPNKRLKLAGPALKGSVRLCPDELVPHGEALAPAGVRPAA* |
Ga0134077_103344563 | 3300012972 | Grasslands Soil | MPNKRLKPGPAFRGGVRLCADELVPQGAVLAPAGARP |
Ga0134110_102519332 | 3300012975 | Grasslands Soil | PGAVMPNKRLKLPGPAFKGTVRLSAGQLVTQGGALAPASARPAA* |
Ga0134087_106241191 | 3300012977 | Grasslands Soil | MVVKLLPNKRLKLAGPAFRGSVRLSPSELVPQGGALPPTG |
Ga0134087_108028681 | 3300012977 | Grasslands Soil | HLKLPGPAFKGTVRLSAGQLVTQGGALALASARPAA* |
Ga0134075_100100692 | 3300014154 | Grasslands Soil | MKVRPNKRLKLAGPAFRGGIRLCANGLVPQGGVLAPPSVRPAA* |
Ga0134078_102112171 | 3300014157 | Grasslands Soil | NMRLKLTGLAFRGSVRLRANVLVPQGRVLAPPSARPAA* |
Ga0134072_104166712 | 3300015357 | Grasslands Soil | CQGALSLPPNMPLKLAGPAFKGSLRFCAGEPVTQGGALAPVGARPAA* |
Ga0134089_101231574 | 3300015358 | Grasslands Soil | VTQQPNKRLKLPGPAFKGTVRLSANELVPQGGALAPTGAR |
Ga0134089_103614282 | 3300015358 | Grasslands Soil | VLPNKRLKLPGPAFRGSVRLCPSQLVPQRGALAPAGA |
Ga0134074_12073842 | 3300017657 | Grasslands Soil | VPPNKRLKLTGPASRGSLRLCASELVRQGGALAPAS |
Ga0134074_13033811 | 3300017657 | Grasslands Soil | KRLKLPGPAFRGDVRLCANEVVPQGGVLAPADPRPAA |
Ga0066655_100195742 | 3300018431 | Grasslands Soil | MLPNKRLKLAGPAFRGGGSLCASQPMTQGEALAPTCPRPAA |
Ga0066667_121847271 | 3300018433 | Grasslands Soil | NKRLKLAGPAFKGTVRSSANELVLQGGALAPAGARPAA |
Ga0066669_105747901 | 3300018482 | Grasslands Soil | PNKRLKLPGPAFKGCVRLCANDLVPQGGALAPAGPRPAA |
Ga0066669_112697631 | 3300018482 | Grasslands Soil | RVPNKRLKLPGPAFKGCVRLCANELVPQGEALAPAGARPAA |
Ga0066669_120527112 | 3300018482 | Grasslands Soil | MKGLLPNKRLKLAGPALKGSRRLCANELVPQGGALAPAGARP |
Ga0066669_122493741 | 3300018482 | Grasslands Soil | MARLAIVRVQPNKRLKLPGPAFKGCVRLCANELVPQGGALAPAGARPAA |
Ga0137417_14480984 | 3300024330 | Vadose Zone Soil | MQRLGLGPMVKGGLPDQRLKLTGPAFRGSGRLCPGQLVPQGGALAPAGTRPAA |
Ga0209350_10099485 | 3300026277 | Grasslands Soil | MNMLVPNKRLKLTGPAFRGSVCLCANELVLQGRALAPAGHRPAA |
Ga0209350_10175541 | 3300026277 | Grasslands Soil | LSNKRLKLAGPAFRGSVRLRTSVQIPQYGALAPADARPAA |
Ga0209235_10439571 | 3300026296 | Grasslands Soil | MVVKLLPNKRLKLAGPAFRGSVPLSPSELVPQGGALAPTGARTAA |
Ga0209237_10489583 | 3300026297 | Grasslands Soil | MSGREPPNKRLKLPGPAFRGDVRLRASQFVAQGRVLAPAGARPAA |
Ga0209237_11540671 | 3300026297 | Grasslands Soil | MPSASRAPNKRLKLAGPAFRGMVRLCASQPVAQGGAL |
Ga0209469_11220551 | 3300026307 | Soil | PNKRLKLTGPAFRGGVCLCANELVPQGGALAPASLRPAA |
Ga0209239_10302791 | 3300026310 | Grasslands Soil | VIAGLWPNKRLKLAGPAFSGSECLCTSRPIPQGEALAPAGA |
Ga0209761_10305712 | 3300026313 | Grasslands Soil | MSVPPNKRLKLAGPAFRGSRRLCADELVPQGGALALAGARPAA |
Ga0209761_10324761 | 3300026313 | Grasslands Soil | LHLLYESAPPNKRLKLTGPAFKGTVRLCANDLVPQGGVLA |
Ga0209268_11693452 | 3300026314 | Soil | HEGEAALPNKRLKLTGPAFRGGVGLCADELVPQGGALAPTGARPAA |
Ga0209686_100587010 | 3300026315 | Soil | MPNKRLKLPGPAFRGSGRLCTGEPVPQGGALALAGFRPAA |
Ga0209155_10560914 | 3300026316 | Soil | GLRLKSVPPNKRLKLAGPAFKGSVRLCASRRVPQHGALAPAGAYPAA |
Ga0209801_12735122 | 3300026326 | Soil | RLKLPGPAFRGSVRLCANELVPEGGVLVPAGARPAA |
Ga0209375_10074404 | 3300026329 | Soil | VGWLPNKRLKLPGPAFGGSVRLCTSQVIPQGGALAPAGARPAA |
Ga0209267_12957521 | 3300026331 | Soil | MVVKLLPNKRLKLAGPAFRGSVRLAPSELVPQGGALAP |
Ga0209803_10920522 | 3300026332 | Soil | KRLKLAGPAFKGTVRLPANELVPQSGALAPAGVRPAA |
Ga0209158_13153022 | 3300026333 | Soil | NKRLKLAGPAFKGTVRLPANELVPQSGALAPAGVRPAA |
Ga0209059_11872862 | 3300026527 | Soil | MPPPNKRLKLAGPALRGILRLCASQPVPQGGELAPAG |
Ga0209378_10310434 | 3300026528 | Soil | VTPLSNKRLKLAGPAFRGSVRLRTSVQIPQYGALAPAGARPAA |
Ga0209056_103801713 | 3300026538 | Soil | LKLAGPAFKGTVRLSASQPVTHGGALALAGARPAA |
Ga0209056_104625041 | 3300026538 | Soil | NKRLKLPGPAFRGSGRLCTGEPVPQGGALALAGFRPAA |
Ga0209056_105297531 | 3300026538 | Soil | MRSRVIAMGCQPPNKRLKLTGPAFRGGVRLCASQPVPQGGALAPASARPAA |
Ga0209376_11912712 | 3300026540 | Soil | VPNKRLKLPGPAFRGDVRLCANELVPQGGVLASAG |
Ga0209805_11187473 | 3300026542 | Soil | MVVKLLPNKRLKLAGPAFRGSVRLSPSELVPQGGALAPTGARPAA |
Ga0209156_100017135 | 3300026547 | Soil | MPNKRLKLPGPAFRRRVRLCANELVPQVGVLAPAGARPAA |
Ga0209161_102719051 | 3300026548 | Soil | VKPRPNKRLKLAGPAFKGTVRLPANELVPQSGALAPAGVRPAA |
Ga0209474_103630801 | 3300026550 | Soil | SVAGTLPNKRLKLTGPAFKGSGRLCTSQPIPQGGALAPAGTLPAA |
Ga0209581_100192629 | 3300027706 | Surface Soil | MIKQPPNKRLKLTGLAFKGSVRSCASQLVPQGGALAPACARPAA |
Ga0209590_1000112914 | 3300027882 | Vadose Zone Soil | MMPPNKRLKVAGPAFRGRVRLCASPQVPQGGALAPAGARPAA |
Ga0209488_100349572 | 3300027903 | Vadose Zone Soil | MRRLGLGTMVKGGLPNQRLKLAGPAFRGSVRLCASDLVPQGGLLAPAGTRPAA |
⦗Top⦘ |