NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F043429

Metagenome Family F043429

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043429
Family Type Metagenome
Number of Sequences 156
Average Sequence Length 40 residues
Representative Sequence VSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRAGQEG
Number of Associated Samples 137
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 50.64 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 95.51 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.897 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.026 % of family members)
Environment Ontology (ENVO) Unclassified
(21.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.026 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.57%    β-sheet: 0.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF01402RHH_1 62.82
PF13655RVT_N 3.21
PF00078RVT_1 2.56
PF08240ADH_N 0.64
PF00239Resolvase 0.64
PF08388GIIM 0.64
PF03050DDE_Tnp_IS66 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.64
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.64
COG3436TransposaseMobilome: prophages, transposons [X] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.18 %
UnclassifiedrootN/A12.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000443|F12B_10071014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2126Open in IMG/M
3300000550|F24TB_11162327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales590Open in IMG/M
3300002568|C688J35102_118966090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300002568|C688J35102_119435862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300003351|JGI26346J50198_1025869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae582Open in IMG/M
3300003989|Ga0055473_10207905All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300005166|Ga0066674_10495678All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300005467|Ga0070706_100840858Not Available849Open in IMG/M
3300005541|Ga0070733_10873978All Organisms → cellular organisms → Bacteria → Terrabacteria group604Open in IMG/M
3300005559|Ga0066700_11160044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba504Open in IMG/M
3300005610|Ga0070763_10717269All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300005617|Ga0068859_101737338All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300005952|Ga0080026_10197180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis595Open in IMG/M
3300006046|Ga0066652_101466139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300006102|Ga0075015_100021197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2878Open in IMG/M
3300006358|Ga0068871_101540719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis629Open in IMG/M
3300006804|Ga0079221_10066078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1673Open in IMG/M
3300007076|Ga0075435_100804392All Organisms → cellular organisms → Bacteria → Terrabacteria group818Open in IMG/M
3300009098|Ga0105245_12632004Not Available556Open in IMG/M
3300009522|Ga0116218_1561371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis507Open in IMG/M
3300009523|Ga0116221_1373251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300009525|Ga0116220_10156237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300009805|Ga0105079_1038243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba535Open in IMG/M
3300010036|Ga0126305_10148351Not Available1456Open in IMG/M
3300010337|Ga0134062_10362714Not Available700Open in IMG/M
3300010366|Ga0126379_12958223All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300010379|Ga0136449_101344549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1109Open in IMG/M
3300010379|Ga0136449_103445297All Organisms → cellular organisms → Bacteria → Terrabacteria group604Open in IMG/M
3300010379|Ga0136449_103834126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae565Open in IMG/M
3300011270|Ga0137391_10183281All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300012045|Ga0136623_10247080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis760Open in IMG/M
3300012093|Ga0136632_10176939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces977Open in IMG/M
3300012096|Ga0137389_11483281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae574Open in IMG/M
3300012183|Ga0136624_1251199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis556Open in IMG/M
3300012184|Ga0136610_1102575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis1007Open in IMG/M
3300012185|Ga0136619_10216631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis728Open in IMG/M
3300012198|Ga0137364_11061305Not Available611Open in IMG/M
3300012198|Ga0137364_11441579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba508Open in IMG/M
3300012201|Ga0137365_10207154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1464Open in IMG/M
3300012210|Ga0137378_10212630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1800Open in IMG/M
3300012210|Ga0137378_10607163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1004Open in IMG/M
3300012210|Ga0137378_11410727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis610Open in IMG/M
3300012212|Ga0150985_113829106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300012285|Ga0137370_10693413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300012359|Ga0137385_11211355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis617Open in IMG/M
3300012359|Ga0137385_11674631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis500Open in IMG/M
3300012906|Ga0157295_10152453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales694Open in IMG/M
3300012917|Ga0137395_10210806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1355Open in IMG/M
3300012924|Ga0137413_11013748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii652Open in IMG/M
3300013105|Ga0157369_11050472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae833Open in IMG/M
3300013297|Ga0157378_11613168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis695Open in IMG/M
3300014200|Ga0181526_10488161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300014501|Ga0182024_12061969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii629Open in IMG/M
3300014838|Ga0182030_11061796All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus706Open in IMG/M
3300016294|Ga0182041_11177785All Organisms → cellular organisms → Bacteria → Terrabacteria group698Open in IMG/M
3300016371|Ga0182034_11270764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae641Open in IMG/M
3300016445|Ga0182038_10997927All Organisms → cellular organisms → Bacteria → Terrabacteria group741Open in IMG/M
3300017821|Ga0187812_1197552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii643Open in IMG/M
3300017925|Ga0187856_1255769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300017928|Ga0187806_1217595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii652Open in IMG/M
3300017928|Ga0187806_1320197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis550Open in IMG/M
3300017933|Ga0187801_10133783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia958Open in IMG/M
3300017942|Ga0187808_10236921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300018053|Ga0184626_10225784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300018469|Ga0190270_11755032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300018482|Ga0066669_11737307Not Available574Open in IMG/M
3300019767|Ga0190267_10789795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii629Open in IMG/M
3300020581|Ga0210399_10950611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300021086|Ga0179596_10214074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis942Open in IMG/M
3300021178|Ga0210408_10746289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300021439|Ga0213879_10188199All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300021479|Ga0210410_11762529Not Available513Open in IMG/M
3300025878|Ga0209584_10128839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300025898|Ga0207692_10621099All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300025898|Ga0207692_10897387Not Available583Open in IMG/M
3300025906|Ga0207699_11190621Not Available564Open in IMG/M
3300025928|Ga0207700_10297689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1392Open in IMG/M
3300025928|Ga0207700_10655657All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300025929|Ga0207664_10256424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1528Open in IMG/M
3300025929|Ga0207664_11467085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae603Open in IMG/M
3300025934|Ga0207686_10005952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6548Open in IMG/M
3300025938|Ga0207704_11624036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis555Open in IMG/M
3300026041|Ga0207639_11014311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300026075|Ga0207708_11188416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis667Open in IMG/M
3300026490|Ga0257153_1090214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae612Open in IMG/M
3300027497|Ga0208199_1126485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis522Open in IMG/M
3300027636|Ga0214469_1048997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1320Open in IMG/M
3300027662|Ga0208565_1022784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2229Open in IMG/M
3300027812|Ga0209656_10229416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300027825|Ga0209039_10158873Not Available937Open in IMG/M
3300027873|Ga0209814_10045026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1839Open in IMG/M
3300027875|Ga0209283_10596540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300028710|Ga0307322_10171433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis584Open in IMG/M
3300028742|Ga0302220_10082088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1291Open in IMG/M
3300028759|Ga0302224_10341652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300028768|Ga0307280_10106045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300028778|Ga0307288_10485508Not Available510Open in IMG/M
3300028808|Ga0302228_10420173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300030056|Ga0302181_10157293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300030339|Ga0311360_11144026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300030491|Ga0302211_10158944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300030509|Ga0302183_10434791Not Available502Open in IMG/M
3300030521|Ga0307511_10449205All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300030524|Ga0311357_11211628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. Llam0652Open in IMG/M
3300030580|Ga0311355_11569837Not Available566Open in IMG/M
3300030706|Ga0310039_10180532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300030707|Ga0310038_10375676All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300031028|Ga0302180_10048888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2563Open in IMG/M
3300031525|Ga0302326_11020981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1159Open in IMG/M
3300031525|Ga0302326_12159176All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus712Open in IMG/M
3300031546|Ga0318538_10295949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae872Open in IMG/M
3300031549|Ga0318571_10106984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300031572|Ga0318515_10284029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300031708|Ga0310686_118957738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300031715|Ga0307476_10794550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300031740|Ga0307468_101395464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis643Open in IMG/M
3300031765|Ga0318554_10696738Not Available570Open in IMG/M
3300031770|Ga0318521_10301342Not Available943Open in IMG/M
3300031771|Ga0318546_10854733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae640Open in IMG/M
3300031782|Ga0318552_10288336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae834Open in IMG/M
3300031799|Ga0318565_10032261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2372Open in IMG/M
3300031799|Ga0318565_10418587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba649Open in IMG/M
3300031805|Ga0318497_10426580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba742Open in IMG/M
3300031820|Ga0307473_10833757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300031833|Ga0310917_10856587Not Available612Open in IMG/M
3300031860|Ga0318495_10415323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae592Open in IMG/M
3300031890|Ga0306925_10709141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300031890|Ga0306925_11554473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis645Open in IMG/M
3300031910|Ga0306923_12282678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis540Open in IMG/M
3300031911|Ga0307412_11693193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba579Open in IMG/M
3300031912|Ga0306921_10264308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2015Open in IMG/M
3300031954|Ga0306926_11715656All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031954|Ga0306926_12238133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae607Open in IMG/M
3300031981|Ga0318531_10371033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300031981|Ga0318531_10455114Not Available579Open in IMG/M
3300031995|Ga0307409_101331941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300031995|Ga0307409_101951572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300032001|Ga0306922_11432934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300032001|Ga0306922_11741638All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300032005|Ga0307411_11481452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300032005|Ga0307411_11786387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis570Open in IMG/M
3300032008|Ga0318562_10170833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii1256Open in IMG/M
3300032025|Ga0318507_10105195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1180Open in IMG/M
3300032035|Ga0310911_10087529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1690Open in IMG/M
3300032043|Ga0318556_10561632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba596Open in IMG/M
3300032055|Ga0318575_10462114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba644Open in IMG/M
3300032076|Ga0306924_11897775Not Available618Open in IMG/M
3300032089|Ga0318525_10057341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1941Open in IMG/M
3300032160|Ga0311301_12419575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300032180|Ga0307471_103218838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis579Open in IMG/M
3300032783|Ga0335079_11968119Not Available564Open in IMG/M
3300032828|Ga0335080_10862742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia931Open in IMG/M
3300033004|Ga0335084_12181969Not Available537Open in IMG/M
3300033289|Ga0310914_10860638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae805Open in IMG/M
3300033550|Ga0247829_11175543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis636Open in IMG/M
3300034065|Ga0334827_171633All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.49%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.21%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.21%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.56%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.64%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.64%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.64%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.64%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.64%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.64%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.64%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.64%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.64%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.64%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.64%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.64%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300003989Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012183Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06)EnvironmentalOpen in IMG/M
3300012184Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06)EnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F12B_1007101423300000443SoilVNDRLVETEFVFDRHAATDLSVAYAILVPQRQVRIVRSGQEASLCHD*
F24TB_1116232713300000550SoilVSERAVESEYVFDRYAATDLSVAYAILGPHREARVRAGQEGTPP
C688J35102_11896609013300002568SoilVNDRVVETQCVFDRHAATDLSVAYAILVPQRRARVLRAGQEGRPQ
C688J35102_11943586213300002568SoilVNDRVVETRFVFDRHAATDLSVAYAILVPQRRTRAARAGQEGRPQH
JGI26346J50198_102586923300003351Bog Forest SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARLVRAGQE
Ga0055473_1020790513300003989Natural And Restored WetlandsVTGRVVQAEYMFDRHAATDLSVAYTILVPQRRARVQPASTEGGPRDDKRGNLC
Ga0066674_1049567823300005166SoilVSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRAGQEG
Ga0070706_10084085813300005467Corn, Switchgrass And Miscanthus RhizosphereVSNRAVETQFVFGRHAAAELSVAYAILVPQRRARMSRAGQ
Ga0070733_1087397813300005541Surface SoilVTGKAVEAVFCFDRHAAADLSVAYAILVPARRARTG
Ga0066700_1116004423300005559SoilVKSKVVETEFVFDRHAASDLSLAYAILVPQRRARTGRAGQEG
Ga0070763_1071726933300005610SoilVSVRAVETESVFGRHAATELSVAYAILVPQRRARIVRAGQE
Ga0068859_10173733833300005617Switchgrass RhizosphereVVETLFVFDRHGAADVSAAFQVLVPQRRARIEWGAGKRS
Ga0080026_1019718033300005952Permafrost SoilVNDRVVGTEFVFDRHAATDLSVAYAILVPQRRARIRAGQEGRPPRD
Ga0066652_10146613933300006046SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIVRAGQEG
Ga0075015_10002119763300006102WatershedsVSDRTVETESVFGRHAATELSVAYAILVPQRQARI
Ga0068871_10154071913300006358Miscanthus RhizosphereVVDSEFVFDRHAATDVSVAYAILVPQRRARIGRAGQEGRPRND
Ga0079221_1006607843300006804Agricultural SoilVSDRAVETEFVFGRHAATELPVAYAILAPRRQARIARPGQEG
Ga0075435_10080439243300007076Populus RhizosphereVSGREVETAFVFDRHAATDVSVAYAILVPQRRARLGRAGQEG
Ga0105245_1263200423300009098Miscanthus RhizosphereVNDRVVETQFVFDSHAATGLSVDYTILVPQLRVRISR
Ga0116218_156137123300009522Peatlands SoilVNDRVVGTEFVFGRHAAADLSVAYAILVPQRQARIVRAGQEGRPPR
Ga0116221_137325123300009523Peatlands SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIRAG
Ga0116220_1015623733300009525Peatlands SoilVNDRAVETEFVFGRHAATELSVAYAILAPQRQARIVRPGQ
Ga0105079_103824323300009805Groundwater SandVNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARS
Ga0126305_1014835123300010036Serpentine SoilMLTVNDRVVETQFVFDRHAATDLSVAYTILVPQRRA
Ga0134062_1036271423300010337Grasslands SoilVNARRIETRFVFDRHAAADLSVAYTILVPQRQARTRRAGPEGR
Ga0126379_1295822323300010366Tropical Forest SoilETAFVFDRHAATDVSVAYVILVPQRRARLGRAGQEGTAGR*
Ga0136449_10134454913300010379Peatlands SoilVNSRRVEAEFVFDRHAATDLSVAYAILVPQRRARTGRPGQEGHAD
Ga0136449_10344529733300010379Peatlands SoilVSDRAVEAESVFGRHAAAELSVAYAILVPQRQARIVRAGQEGWPPRD
Ga0136449_10383412613300010379Peatlands SoilVSDRAVEAEFVFGRHAATELTVAYAILVPQRQARI
Ga0137391_1018328123300011270Vadose Zone SoilVSDRAVETESVFGRHAVTELSVGCAILVRQRQAVIRPASNEGRP*
Ga0136623_1024708013300012045Polar Desert SandLIGWHRLNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQEG
Ga0136632_1017693913300012093Polar Desert SandVNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQEG
Ga0137389_1148328113300012096Vadose Zone SoilVNDRVVGTEFVFGRHAAADLSVAYAILVPQRQARIVR
Ga0136624_125119923300012183Polar Desert SandVSDRAVEGEFVFDRHAATDLSVAYAILVPQRRARIRAGQKGRPPD
Ga0136610_110257513300012184Polar Desert SandLIGWHRLNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQ
Ga0136619_1021663133300012185Polar Desert SandVSDRAVEGEFVFDRHAATDLSVAYAILVPQRRARIRAGEKGRPPD
Ga0137364_1106130523300012198Vadose Zone SoilVNARRIETRFVFDRHAAADLSVAYTILVPQRQART
Ga0137364_1144157923300012198Vadose Zone SoilVKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTGRAGQEG
Ga0137365_1020715413300012201Vadose Zone SoilVSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRA
Ga0137378_1021263013300012210Vadose Zone SoilVNNRTVETESVFGRHAATELSVACAILVPQRRARI
Ga0137378_1060716313300012210Vadose Zone SoilVSDRAVGTEFVFDRHAATDLSVAYAILVPQRRARIV
Ga0137378_1141072713300012210Vadose Zone SoilVSGRAVETEFVFGRHGAAELSVAYAILVPQRRARI
Ga0150985_11382910613300012212Avena Fatua RhizosphereVNDWVVETRFVFDRHAATDLSVAYAILVPQRRVRAARAGQEG
Ga0137370_1069341333300012285Vadose Zone SoilVKSKVVETEFVFDRHAASDLSLAYAILVPQRRART
Ga0137385_1121135523300012359Vadose Zone SoilVTGRGVEVQYVFGRHAAAELSVAYGILVPQRRARIVRPGQE
Ga0137385_1167463113300012359Vadose Zone SoilVRDRAVEGEFVFGRHAATDLPVAYAILVPQRRARIVRPGQE
Ga0157295_1015245333300012906SoilVVDTEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGR
Ga0137395_1021080613300012917Vadose Zone SoilVNDRAVETESVFGRHAATELSVAYAILAPQRRARI
Ga0137413_1101374833300012924Vadose Zone SoilVNDRVVEAEFVFDRNAATDMSVAYAILVPARRARL
Ga0157369_1105047233300013105Corn RhizosphereVNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPG
Ga0157378_1161316813300013297Miscanthus RhizosphereVNDRVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGP
Ga0181526_1048816133300014200BogVNRRRVEAEFVFDRHAATDLSVAYAILVPQRRARIA
Ga0182024_1206196933300014501PermafrostVSDRVVGTEFVFGRHAATDLSVAYAILVPQRRARIRAGQ
Ga0182030_1106179633300014838BogVNDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRP
Ga0182041_1117778523300016294SoilVSSRPVEAEFVFGRHWAAELSAAYAILVPQRKARIPANH
Ga0182034_1127076423300016371SoilVNSRRVEAEFVFGRHQAAELPAAYAILVPQRKARIPDNHLE
Ga0182038_1099792743300016445SoilVSGRAVEAVFVFDRHAATDLSVAYAILVPARRARMGRAG
Ga0187812_119755213300017821Freshwater SedimentVSGRAVEAEFVFGRHAATELSVAYAILVPQRQARIVR
Ga0187856_125576923300017925PeatlandVSDRAVGTEYVFGRHAATDLSVAYAILVQQRRARIRAGQEGRPP
Ga0187806_121759513300017928Freshwater SedimentVNDRTVEAEFVFGRHAATELSVAYAILVPQRQARIVR
Ga0187806_132019723300017928Freshwater SedimentVTGREVEAVFVSGRHAAADLSVAYAILVPQRRARTSRAGQEG
Ga0187801_1013378343300017933Freshwater SedimentVNGRKVEAQFVFDRHAATDLSLAYAILVPQRRARIARDGQEGR
Ga0187808_1023692113300017942Freshwater SedimentVSGRRVETQFVSGRQAATDLSVAYGILVPQRRARTSRDGQEGQA
Ga0184626_1022578413300018053Groundwater SedimentVNDRLVQTEFVFDRHAATDLSVAYAILVPQRRVRIARSGQEASRCHDE
Ga0190270_1175503213300018469SoilVSDRLVETESVFDRHAATDLSVAYAILVPQRRARIARAGQE
Ga0066669_1173730723300018482Grasslands SoilVNARRIETRFVFDRHAAADLSVAYTILVPQRQARTRRAGP
Ga0190267_1078979513300019767SoilVNDRVVETQFVFDRHAATDLSVAYTILVPQRRVRIARAGQ
Ga0210399_1095061133300020581SoilVSGRQVETQFVFDRHAATDLSVAYAILVPQRRARIG
Ga0179596_1021407433300021086Vadose Zone SoilVSDRAVEMQFVFGRHAATDLSVAYAILVPQRRARIRAGQEGR
Ga0210408_1074628933300021178SoilVSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGGQEGQAD
Ga0213879_1018819913300021439Bulk SoilVNDRVVTTEYVFDRHAATDLSVAYTILVPQRRARVQQ
Ga0210410_1176252913300021479SoilVNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPGQE
Ga0209584_1012883933300025878Arctic Peat SoilMPVVETEFVFDRHAATDLSVAYAILVPQRRARTRAGQEGEPQ
Ga0207692_1062109913300025898Corn, Switchgrass And Miscanthus RhizosphereVNDRVVETQFVFDRHAATDLSVAYAILVPPRRARLVRAGQE
Ga0207692_1089738713300025898Corn, Switchgrass And Miscanthus RhizosphereVNRQRVEAEFVFDRHAATDLSVAYAILVPQRRARIARDG
Ga0207699_1119062113300025906Corn, Switchgrass And Miscanthus RhizosphereVNRQRVEAEFVFDRHAATDLSVAYAILVPQRRARIA
Ga0207700_1029768913300025928Corn, Switchgrass And Miscanthus RhizosphereVSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGG
Ga0207700_1065565713300025928Corn, Switchgrass And Miscanthus RhizosphereVNRQQVETEFVFDRHAASDLSVAYAILVPQRRARIA
Ga0207664_1025642413300025929Agricultural SoilVSGRQVETQFVFDRHAATDLSVAYGILVPRRRARTSRGGQEGQ
Ga0207664_1146708513300025929Agricultural SoilVNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPGQEGRPQH
Ga0207686_1000595273300025934Miscanthus RhizosphereVVDTEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGRP
Ga0207704_1162403613300025938Miscanthus RhizosphereVNDRVVETQFVFDRHAATDLSVAYAILVPPRRARL
Ga0207639_1101431133300026041Corn RhizosphereVVDSEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGRPRNDQC
Ga0207708_1118841613300026075Corn, Switchgrass And Miscanthus RhizosphereVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGPRNDK
Ga0257153_109021413300026490SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARL
Ga0208199_112648513300027497Peatlands SoilVNDRVVEAEFVFGRHAAADLSVAYAILVPQRQARIA
Ga0214469_104899733300027636SoilMVAGEFVFDRHAAADVSVAYAILVPQRRARIGRPGQEGVS
Ga0208565_102278413300027662Peatlands SoilVSGRAVGTEFVFDRHAAADLSVAYAILVPQRRARIRA
Ga0209656_1022941633300027812Bog Forest SoilVNRRRVEAEFVFDRRAATDLSVAYAILVPQRRARIARAGQEGR
Ga0209039_1015887343300027825Bog Forest SoilVNRRRVEAEFVFDQRAATDLSVAYAILVPQRRARIAR
Ga0209814_1004502653300027873Populus RhizosphereVNDRLVETEFVFDRHAAADLSVAYAILVPQRRVRIARSGQEASLC
Ga0209283_1059654033300027875Vadose Zone SoilVSRRDVEAVFVFDRHAATDLSVAYAILVPQRRARL
Ga0307322_1017143333300028710SoilVNERVVETQFVFDRYAATDLSVAYTILVPQRRARV
Ga0302220_1008208843300028742PalsaVNGRAVEAVFVFGRHSAADLSVAYAILVPQRRARAA
Ga0302224_1034165223300028759PalsaVSDRAVETESVFGRHAATELPVAYAILVPQRQARIVRPGQEGR
Ga0307280_1010604533300028768SoilVNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSG
Ga0307288_1048550823300028778SoilVSERAVESEYVFDRYAATDLSVAYAILGPQRQARVRAGQEGTPP
Ga0302228_1042017313300028808PalsaVSDRAVETESVFGRHAATELPVAYAILVPQRQARIVRPGQEG
Ga0302181_1015729313300030056PalsaVSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRPGQE
Ga0311360_1114402613300030339BogVSERAVEMVFVFDRLAGTDLSVAYALLLPERRARRAAAQEGRS
Ga0302211_1015894433300030491FenVSERAVEMVFVFDRLAGTDLSVAYAILLPERRARRAAAQ
Ga0302183_1043479123300030509PalsaVSDRAVETEFVFGRHAATELSVAYAILVPQRQARIVRPGQEG
Ga0307511_1044920523300030521EctomycorrhizaVSGRLVETEAVFDRHAAADLSAAYAVLVPQRRARVRA
Ga0311357_1121162813300030524PalsaVSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRP
Ga0311355_1156983713300030580PalsaVSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRPGQ
Ga0310039_1018053233300030706Peatlands SoilVSDRAVEAEFVFGRHAATELTVAYAILVPQRQARIARPGQEGRPQH
Ga0310038_1037567613300030707Peatlands SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRQARIVR
Ga0302180_1004888853300031028PalsaVNGRKVEVQFVFDRHAATDLSVAYAILVPQRRARTGR
Ga0302326_1102098113300031525PalsaVKDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRPP
Ga0302326_1215917633300031525PalsaVNDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRPP
Ga0318538_1029594943300031546SoilVNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRA
Ga0318571_1010698433300031549SoilVNDRAVEAESVFGRHAAAELSVAYAILVPQRQARIARAGQE
Ga0318515_1028402913300031572SoilVNRRRVETQCVFDRHAATDLSVAYAILVPQRRARI
Ga0310686_11895773813300031708SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIARA
Ga0307476_1079455013300031715Hardwood Forest SoilVSTRAVEAEFVFGRHAASDLSVAYAILVPQRRARIAGAGQKGQ
Ga0307468_10139546423300031740Hardwood Forest SoilVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGP
Ga0318554_1069673813300031765SoilVNGRRVETEFVFGRHWAADLSAAYAILVPQRKARISARVEKGR
Ga0318521_1030134213300031770SoilVNGRPVGAEFVFDRHAAAVLSAAYAILVPQRRARTGRAGQ
Ga0318546_1085473323300031771SoilVNGRPVGAEFVFDRHAAAVLSAAYAILVPQRRARTGRAGQEGR
Ga0318552_1028833613300031782SoilVNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIARPGQEGQ
Ga0318565_1003226113300031799SoilVSSRPVETAFVFDRHAATDLSVAYSILVPQRRGPPGGG
Ga0318565_1041858713300031799SoilVKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGQEGE
Ga0318497_1042658023300031805SoilVKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGREGER
Ga0307473_1083375723300031820Hardwood Forest SoilVNDRPVETESVFGRHAATELSVAYAILVPQRQARIAGPGQEG
Ga0310917_1085658713300031833SoilVNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIARPGQ
Ga0318495_1041532333300031860SoilVNGRPVETEFVFGRHWAAELSAAYAILVPQRKARIPDNHL
Ga0306925_1070914143300031890SoilVSGREVETQFVFDRHAATDLSVAYGILVPQRRARTGRAGQEGQ
Ga0306925_1155447323300031890SoilVNDRVIETEFVFDRHAATDLSVAYAILVPQRRVRIERADEEG
Ga0306923_1228267823300031910SoilVSGRAVEAVFVFDRHAATDLSVAYAILVPARRARMGRAGQE
Ga0307412_1169319333300031911RhizosphereVNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSGQ
Ga0306921_1026430843300031912SoilVTGRAVEAVFCFDRHAASDLSVAYAILVPARRARTGRAGQEG
Ga0306926_1171565623300031954SoilVSGRAVEAVFCFDRHAATDLSVAYAILVPARRARTGRAGQE
Ga0306926_1223813323300031954SoilVSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARIP
Ga0318531_1037103333300031981SoilVNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRAGQE
Ga0318531_1045511413300031981SoilVNGRRVETEFVFGRHWAAELSAAYAILVPQRKARIPDN
Ga0307409_10133194113300031995RhizosphereVSERAVESEYVFDRYAATDLSVAYAILGPQRQVRVRAGQE
Ga0307409_10195157213300031995RhizosphereVNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSGQEASLC
Ga0306922_1143293413300032001SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIARAGQ
Ga0306922_1174163813300032001SoilVNDRAVEAESVFGRHAAAELSVAYAILVPQRQARIARAGQEGRP
Ga0307411_1148145213300032005RhizosphereVTDRVVETESVFDRHAATDLSVAYAILVPQRRARVLRAGQEGR
Ga0307411_1178638713300032005RhizosphereVNERVVETQFVFDRHAATDLSVAYTILVPQRRARVD
Ga0318562_1017083333300032008SoilVNDRAVEAEFVFGRHAATELSVAYAILVPQRQARIARAGQEG
Ga0318507_1010519513300032025SoilVSSRPVETAFVFDRHAATDLSVAYSILVPQRRARLG
Ga0310911_1008752933300032035SoilVSGRAVEAVFCFDRHAATDLSVAYAILVPARRARTGRAGQEGRLPHD
Ga0318556_1056163223300032043SoilVKSARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGQEGVR
Ga0318575_1046211413300032055SoilVNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRAGQEGPAHD
Ga0306924_1189777523300032076SoilVSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGGQEGQADDE
Ga0318525_1005734143300032089SoilVSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARIPAN
Ga0311301_1241957513300032160Peatlands SoilVSDRAVEAEFVFGRHAATELSVAYAILVPQRRARNRAGQ
Ga0307471_10321883823300032180Hardwood Forest SoilVNDRVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEG
Ga0335079_1196811913300032783SoilVSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARI
Ga0335080_1086274243300032828SoilVNRRQVEAEFVFDRHAASDLSVAYAILVPQRRARIA
Ga0335084_1218196913300033004SoilVTGRSVEMVFVFDRLVGTDLSVAYAILVPERRARRAAAQKGRS
Ga0310914_1086063813300033289SoilVNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIAR
Ga0247829_1117554313300033550SoilVNDRVVETQFVFDRHTATDLSVAYTILVPQRRVRIDRAGQEGRPQ
Ga0334827_171633_524_6613300034065SoilMSDRVVGTEFVFGRHAATDLSVAYAILVPQRRARIRAGQEGRPPRD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.