NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043458

Metagenome / Metatranscriptome Family F043458

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043458
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 75 residues
Representative Sequence MKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSF
Number of Associated Samples 125
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.28 %
% of genes near scaffold ends (potentially truncated) 30.77 %
% of genes from short scaffolds (< 2000 bps) 86.54 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.359 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.128 % of family members)
Environment Ontology (ENVO) Unclassified
(38.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.436 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.54%    β-sheet: 0.00%    Coil/Unstructured: 51.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF01227GTP_cyclohydroI 5.77
PF09995MPAB_Lcp_cat 5.77
PF12681Glyoxalase_2 5.13
PF14534DUF4440 1.92
PF09110HAND 1.28
PF13473Cupredoxin_1 1.28
PF05368NmrA 0.64
PF13474SnoaL_3 0.64
PF13485Peptidase_MA_2 0.64
PF00903Glyoxalase 0.64
PF07885Ion_trans_2 0.64
PF00561Abhydrolase_1 0.64
PF13396PLDc_N 0.64
PF10851DUF2652 0.64
PF13585CHU_C 0.64
PF09335SNARE_assoc 0.64
PF01135PCMT 0.64
PF14248DUF4345 0.64
PF00171Aldedh 0.64
PF06283ThuA 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.64
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.64
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.64
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.64
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.64
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.64
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.64
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.64
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.64
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.64
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.36 %
UnclassifiedrootN/A0.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_101887243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium594Open in IMG/M
3300000956|JGI10216J12902_100031184All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300000956|JGI10216J12902_105928850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1054Open in IMG/M
3300002128|JGI24036J26619_10039682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium905Open in IMG/M
3300004114|Ga0062593_101719843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes686Open in IMG/M
3300004157|Ga0062590_102740287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300004643|Ga0062591_100532235All Organisms → cellular organisms → Bacteria → FCB group1019Open in IMG/M
3300004643|Ga0062591_101911897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium609Open in IMG/M
3300005289|Ga0065704_10390482All Organisms → cellular organisms → Bacteria → FCB group763Open in IMG/M
3300005290|Ga0065712_10004166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5206Open in IMG/M
3300005290|Ga0065712_10017467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1534Open in IMG/M
3300005290|Ga0065712_10764189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300005293|Ga0065715_10150707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1733Open in IMG/M
3300005294|Ga0065705_10218243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1332Open in IMG/M
3300005331|Ga0070670_101405172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300005331|Ga0070670_101445128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300005338|Ga0068868_100591793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes982Open in IMG/M
3300005343|Ga0070687_100195900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1221Open in IMG/M
3300005355|Ga0070671_101776131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300005356|Ga0070674_100464134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1048Open in IMG/M
3300005365|Ga0070688_100062548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2357Open in IMG/M
3300005456|Ga0070678_102325923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300005459|Ga0068867_101375424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300005566|Ga0066693_10109450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1005Open in IMG/M
3300005578|Ga0068854_101349979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes643Open in IMG/M
3300005617|Ga0068859_100169453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2264Open in IMG/M
3300005617|Ga0068859_101074538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales885Open in IMG/M
3300005617|Ga0068859_101144305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium856Open in IMG/M
3300005718|Ga0068866_10942213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300005719|Ga0068861_101183191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes738Open in IMG/M
3300005841|Ga0068863_100006763All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11243Open in IMG/M
3300005844|Ga0068862_100823651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes908Open in IMG/M
3300006046|Ga0066652_100515218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium1114Open in IMG/M
3300006237|Ga0097621_102116366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300006844|Ga0075428_101598142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium682Open in IMG/M
3300006918|Ga0079216_11388278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300009094|Ga0111539_10136275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2875Open in IMG/M
3300009094|Ga0111539_10694111All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300009156|Ga0111538_10053806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5149Open in IMG/M
3300009176|Ga0105242_10075577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2805Open in IMG/M
3300009176|Ga0105242_11324417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300009177|Ga0105248_12282530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300009553|Ga0105249_10014735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6910Open in IMG/M
3300009553|Ga0105249_10020865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5858Open in IMG/M
3300010036|Ga0126305_10190962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1294Open in IMG/M
3300010037|Ga0126304_10529826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium792Open in IMG/M
3300010154|Ga0127503_10779098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium948Open in IMG/M
3300010400|Ga0134122_11829155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300012668|Ga0157216_10177073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1019Open in IMG/M
3300012885|Ga0157287_1021400Not Available849Open in IMG/M
3300012892|Ga0157294_10008443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1717Open in IMG/M
3300012892|Ga0157294_10074075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes825Open in IMG/M
3300012893|Ga0157284_10166029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300012895|Ga0157309_10015970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1582Open in IMG/M
3300012895|Ga0157309_10226893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300012899|Ga0157299_10109776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes726Open in IMG/M
3300012900|Ga0157292_10092729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes888Open in IMG/M
3300012901|Ga0157288_10097543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes792Open in IMG/M
3300012901|Ga0157288_10156796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium685Open in IMG/M
3300012903|Ga0157289_10017585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1511Open in IMG/M
3300012905|Ga0157296_10151997All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012908|Ga0157286_10044537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1110Open in IMG/M
3300012909|Ga0157290_10459621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300012910|Ga0157308_10179049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300012912|Ga0157306_10248211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300012915|Ga0157302_10058440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1112Open in IMG/M
3300012916|Ga0157310_10014280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1969Open in IMG/M
3300012916|Ga0157310_10128501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes850Open in IMG/M
3300012984|Ga0164309_10253121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1243Open in IMG/M
3300012984|Ga0164309_11278588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300013104|Ga0157370_11043249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes739Open in IMG/M
3300013297|Ga0157378_11923681All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes641Open in IMG/M
3300013297|Ga0157378_13033685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300013306|Ga0163162_10195581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2151Open in IMG/M
3300013306|Ga0163162_12972354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter chinensis545Open in IMG/M
3300013308|Ga0157375_11054243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter950Open in IMG/M
3300013308|Ga0157375_12760641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300014326|Ga0157380_10873186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes923Open in IMG/M
3300014326|Ga0157380_12664695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300014968|Ga0157379_10929815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes826Open in IMG/M
3300014969|Ga0157376_10361642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1392Open in IMG/M
3300014969|Ga0157376_11173051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium795Open in IMG/M
3300015077|Ga0173483_10596432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300015200|Ga0173480_10645455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes656Open in IMG/M
3300015374|Ga0132255_101964992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes890Open in IMG/M
3300017792|Ga0163161_11076169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium690Open in IMG/M
3300017792|Ga0163161_11438650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300018031|Ga0184634_10197794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes915Open in IMG/M
3300018051|Ga0184620_10090355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes930Open in IMG/M
3300018067|Ga0184611_1001255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5284Open in IMG/M
3300018072|Ga0184635_10264591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium679Open in IMG/M
3300018073|Ga0184624_10117408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1150Open in IMG/M
3300018429|Ga0190272_11903270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium625Open in IMG/M
3300018469|Ga0190270_10115928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2093Open in IMG/M
3300018476|Ga0190274_10004879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8048Open in IMG/M
3300018476|Ga0190274_10947259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300018476|Ga0190274_11625330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium739Open in IMG/M
3300018476|Ga0190274_11720248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes721Open in IMG/M
3300018481|Ga0190271_10543256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1277Open in IMG/M
3300018481|Ga0190271_10808619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1062Open in IMG/M
3300018481|Ga0190271_11947708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium697Open in IMG/M
3300019263|Ga0184647_1007114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300019356|Ga0173481_10228489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes824Open in IMG/M
3300019361|Ga0173482_10452621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300019361|Ga0173482_10564824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium565Open in IMG/M
3300019362|Ga0173479_10643494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium562Open in IMG/M
3300019867|Ga0193704_1049665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes822Open in IMG/M
3300019884|Ga0193741_1022466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1626Open in IMG/M
3300020000|Ga0193692_1029284All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1291Open in IMG/M
3300020016|Ga0193696_1020268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1788Open in IMG/M
3300020020|Ga0193738_1000222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes40067Open in IMG/M
3300021415|Ga0193694_1000001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1862607Open in IMG/M
3300022870|Ga0247782_1013926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1043Open in IMG/M
3300022880|Ga0247792_1016241All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300022886|Ga0247746_1082919All Organisms → cellular organisms → Bacteria → FCB group769Open in IMG/M
3300022899|Ga0247795_1003974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2404Open in IMG/M
3300022899|Ga0247795_1004645All Organisms → cellular organisms → Bacteria2219Open in IMG/M
3300022906|Ga0247766_1023015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1507Open in IMG/M
3300023064|Ga0247801_1029150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes780Open in IMG/M
3300023070|Ga0247755_1032936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1024Open in IMG/M
3300023073|Ga0247744_1046810All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300023077|Ga0247802_1008340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Olivibacter → unclassified Olivibacter → Olivibacter sp. SDN31321Open in IMG/M
3300023077|Ga0247802_1062693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300023168|Ga0247748_1010630All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300023260|Ga0247798_1069231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300023265|Ga0247780_1026234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1398Open in IMG/M
3300024055|Ga0247794_10008556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2320Open in IMG/M
3300025321|Ga0207656_10155405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1085Open in IMG/M
3300025905|Ga0207685_10033112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1865Open in IMG/M
3300025918|Ga0207662_10014962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4358Open in IMG/M
3300025930|Ga0207701_10636413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes906Open in IMG/M
3300025931|Ga0207644_11838599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300025940|Ga0207691_10224775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1627Open in IMG/M
3300025961|Ga0207712_10444250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1099Open in IMG/M
3300025961|Ga0207712_10506543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1033Open in IMG/M
3300025986|Ga0207658_11072177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium736Open in IMG/M
3300026023|Ga0207677_10918985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes790Open in IMG/M
3300026088|Ga0207641_10003368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes14188Open in IMG/M
3300026088|Ga0207641_11704621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium632Open in IMG/M
3300026089|Ga0207648_10336562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1358Open in IMG/M
3300026095|Ga0207676_10176159All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1868Open in IMG/M
3300026285|Ga0209438_1099787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes881Open in IMG/M
3300026306|Ga0209468_1077370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1113Open in IMG/M
3300027907|Ga0207428_10203311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1490Open in IMG/M
3300028380|Ga0268265_10315738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1413Open in IMG/M
3300028802|Ga0307503_10325462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300028876|Ga0307286_10221759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300030905|Ga0308200_1147762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium541Open in IMG/M
3300031538|Ga0310888_10013801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3196Open in IMG/M
3300031547|Ga0310887_10474685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes749Open in IMG/M
3300031847|Ga0310907_10841153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium516Open in IMG/M
3300031854|Ga0310904_10412654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes887Open in IMG/M
3300031892|Ga0310893_10104437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1045Open in IMG/M
3300031944|Ga0310884_10427035All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300032421|Ga0310812_10537519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter chinensis525Open in IMG/M
3300033412|Ga0310810_11201850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium614Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil7.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.21%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.56%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.28%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.64%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022870Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10188724313300000559SoilMKELQDFQPLQLVNLLAEQTITYYKLIGYGASVEECTQCNDRINQIQKELASRRNPXXXXXXXXXXXXXXXLYSF*
JGI10216J12902_10003118413300000956SoilMKEFQDFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEMELNSRRNSHDRNILNRQYKSSSVEYSF*
JGI10216J12902_10592885023300000956SoilMMDLQHFQPSQLVRLIAQETISYYRLIGDGASVEECAQCNNRIKQIEMELESRRNKDEKNILQRQPISESVEYSN*
JGI24036J26619_1003968223300002128Corn, Switchgrass And Miscanthus RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNIL
Ga0062593_10171984323300004114SoilFMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN*
Ga0062590_10274028713300004157SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQCKTPSPEYSY*
Ga0062591_10053223513300004643SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPGYYL*
Ga0062591_10191189713300004643SoilKELQDFQPTQLVNLLAKETITYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0065704_1039048223300005289Switchgrass RhizosphereMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPEYYL*
Ga0065712_1000416653300005290Miscanthus RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN*
Ga0065712_1001746723300005290Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQY
Ga0065712_1076418913300005290Miscanthus RhizosphereKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY*
Ga0065715_1015070723300005293Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0065705_1021824323300005294Switchgrass RhizosphereMKELQDFQPLQLVNLLAEQTITYYKLIGYGASVEECTQCNDRINQIQKELASRRNPEERDILERQYAAAEPEYSF*
Ga0070670_10140517213300005331Switchgrass RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPAEYSIASN*
Ga0070670_10144512813300005331Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSASAEYSF*
Ga0068868_10059179313300005338Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDIEERNILNRQYKTPSPEYSF*
Ga0070687_10019590013300005343Switchgrass RhizospherePFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0070671_10177613123300005355Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSF*
Ga0070674_10046413423300005356Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSF*
Ga0070688_10006254813300005365Switchgrass RhizospherePFMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPAEYSIASN*
Ga0070678_10232592313300005456Miscanthus RhizospherePFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY*
Ga0068867_10137542413300005459Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRKYKSASAEYSF*
Ga0066693_1010945023300005566SoilMKELQDFQPLQLANLLAHETIAYYKLIGDDASVEECTQCNERIRQIERELESRRDPHERNILNRQYKLSPPEYSF*
Ga0068854_10134997923300005578Corn RhizosphereFMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPAEYSIASN*
Ga0068859_10016945323300005617Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQ
Ga0068859_10107453823300005617Switchgrass RhizosphereMKEFQNFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIKLELDSRRDPHDRNILTRQYKLPSPEYSF*
Ga0068859_10114430513300005617Switchgrass RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEY
Ga0068866_1094221323300005718Miscanthus RhizosphereLFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDIEERNILNRQYKTPSPEYSY*
Ga0068861_10118319113300005719Switchgrass RhizosphereMKELQDFQPLQLVNLLAEQTITYYKLIGYGASVEECTQCNDRIRQIQKELASRRNPEERNILERQYAAAEPEYSF*
Ga0068863_10000676373300005841Switchgrass RhizosphereMAFHFFLAHRLLFSFIKYPFMNELQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQCNDKIRQIEIELNSRRDSQERNILNRQYKLPTPEYSF*
Ga0068862_10082365123300005844Switchgrass RhizosphereMKELQDFQPSQLVNLLAQETITYYKLIGDDASVEDCTQCNDRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN*
Ga0066652_10051521833300006046SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIEVELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0097621_10211636623300006237Miscanthus RhizosphereELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0075428_10159814213300006844Populus RhizosphereMNELQYFQPLQLGNLLAKETISYYKLIGDGASLEECTQCNNRIRQIEMELDSKRPREGNILKRPSKSVP
Ga0079216_1138827813300006918Agricultural SoilMKEFQDFQPSQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIEMELDSRRDPQERNILSREYKIASPEYSF*
Ga0111539_1013627533300009094Populus RhizosphereMKELQDFQPTQLVNLLAKETILYYKLIGDDASVEECTQCNDRIRQIEIELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0111539_1069411123300009094Populus RhizosphereMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYQAASSEYSF*
Ga0111538_1005380623300009156Populus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIEIELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0105242_1007557733300009176Miscanthus RhizosphereMNELQDFPSAQLVNLLAEQTISYYKLIGDNASVEECTQCNDRIRQIEIELNSRRDPQERNILNRQYKLPTPEYSF*
Ga0105242_1132441723300009176Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRKYKTPSPEYSY*
Ga0105248_1228253023300009177Switchgrass RhizosphereMNELQDFPSAQLVNLLAQQTISYYKLIGDDASVEECTQCNDRIRQIEIELNSRRDPHERNILTRQYKLPSPEYSF*
Ga0105249_1001473523300009553Switchgrass RhizosphereMLNLQDFQPSQLVNLIAQETRSYYRLIGDGASVEECTQCNSRIKQIEMELDSRRNQEEKSITSRQPAPLEYSY*
Ga0105249_1002086563300009553Switchgrass RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNDRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN*
Ga0126305_1019096223300010036Serpentine SoilMKELHDFQTSQPVNLLAQETISYYKLVGYDASVEECTQCNNRIKQIQMELDSRRNKEEKNIIQRLPKSEHPEYAV*
Ga0126304_1052982623300010037Serpentine SoilMKELQDFQPSQLVNLLARETISYYKLIGDDASVEECTQCNDRIRQIEMELNSRRNSHDRNILNRQYKSASAEYSF*
Ga0127503_1077909823300010154SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0134122_1182915513300010400Terrestrial SoilMKELQDFPSTQLVNLLAQQTISYYKLIGDDASVEECTQCNDKIRQIEIELNSRRDPQERNILNRQYKLPAAEYSF*
Ga0157216_1017707333300012668Glacier Forefield SoilQKLQLVNLLAEETITYYKLIGYEASVEECAQCNNRIKEIQMELDSRTNPEERNIFQREFRSAPHEYSF*
Ga0157287_102140023300012885SoilMKEFQDFQPSQLVNLLAQETISYYKMIGDDASVEECTQCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF*
Ga0157294_1000844343300012892SoilVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPLPEYSN*
Ga0157294_1007407523300012892SoilMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKAASSEYSF*
Ga0157284_1016602913300012893SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILNRQYKTPSPEYSY*
Ga0157309_1001597023300012895SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF*
Ga0157309_1022689313300012895SoilYLFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY*
Ga0157299_1010977623300012899SoilMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF*
Ga0157292_1009272923300012900SoilMKELQEFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0157288_1009754313300012901SoilMKELQDFQPTQLVNLLAKETITYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0157288_1015679613300012901SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPGYY
Ga0157289_1001758523300012903SoilMKEFQDFQPSQLVNLLAQETISYYNLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKAASSEYSF*
Ga0157296_1015199713300012905SoilMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYQAASSEYSF*
Ga0157286_1004453723300012908SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPE
Ga0157290_1045962113300012909SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF*
Ga0157308_1017904913300012910SoilMKELQDFQPTQLVNLLAKETITYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0157306_1024821123300012912SoilLFIKYLFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0157302_1005844023300012915SoilMKELQNFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF*
Ga0157310_1001428023300012916SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKAASSEYSF*
Ga0157310_1012850123300012916SoilFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERDILNRQYKTPSSEYSN*
Ga0164309_1025312133300012984SoilMKELQDFQPTQLANLLAQETISYYKLIGDNASVEECTQCNDRIRQIEMELGSRRDPQERNILNRQYTTPSPEYSY*
Ga0164309_1127858813300012984SoilMKELQDFQPTQLVDLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSASAEYSF*
Ga0157370_1104324913300013104Corn RhizosphereELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN*
Ga0157378_1192368123300013297Miscanthus RhizosphereNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPAEYSIASN*
Ga0157378_1303368523300013297Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSA
Ga0163162_1019558133300013306Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRGDPEERNILNRHYKTPSPEYSF*
Ga0163162_1297235413300013306Switchgrass RhizosphereMAFHFFLAHRLLFSFIKYPFMNELQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQWNDKIRQIEIELDSRRDSQERNILNRQYNLPTPEYSF*
Ga0157375_1105424323300013308Miscanthus RhizosphereMAFHFFLAHRLLFSFIKYPFMNELQDFPSAQLVNLLAEQTISYYKLIGDNASVEECTQCNDRIRQIEIELNSRRDPQERNILNRQYKLPTPEYSL*
Ga0157375_1276064123300013308Miscanthus RhizosphereMKEFQNFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEIELDSRRDPHERNILTRQYKLPSPE
Ga0157380_1087318613300014326Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY*
Ga0157380_1266469513300014326Switchgrass RhizosphereDFQPTQLVNLLAKETITYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY*
Ga0157379_1092981513300014968Switchgrass RhizosphereMKEFQNFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIKLELDSRRDPHERNILTRQYKLPSPEYSF*
Ga0157376_1036164223300014969Miscanthus RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAKYSIASN*
Ga0157376_1117305113300014969Miscanthus RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPSAKYSIASN*
Ga0173483_1059643223300015077SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSY*
Ga0173480_1064545513300015200SoilVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY*
Ga0132255_10196499223300015374Arabidopsis RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNIL
Ga0163161_1107616913300017792Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF
Ga0163161_1143865023300017792Switchgrass RhizosphereMKEFQNFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIKLELDSRRDPHDRNILTRQYKLPSPEYSY
Ga0184634_1019779423300018031Groundwater SedimentMKELQDFQPTQLVNLLAKETITYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSY
Ga0184620_1009035513300018051Groundwater SedimentMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDIEERNILNRQYKTPSPEYSF
Ga0184611_100125523300018067Groundwater SedimentMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY
Ga0184635_1026459113300018072Groundwater SedimentMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQRNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSY
Ga0184624_1011740823300018073Groundwater SedimentMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY
Ga0190272_1190327023300018429SoilMKELQGYQKFQLVNLLAQETKTYYKLIGYDASVEECTQCNNRIRQIQMELDSRTNSDEKNILQREYKPAVPEYSF
Ga0190270_1011592813300018469SoilMKEFQDFQPLQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEIELNSRRGLHDRNILHRQYKLPSSEY
Ga0190274_1000487953300018476SoilMKEFRDFQPLQLVNLLAQETISYYKLIGDDASVEECTQCNARIKQIEMELDSRRGPHDRNILNRQYKLPSPEYSF
Ga0190274_1094725923300018476SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTQCNNRIRQIEMELNGRRDVHDRNILNREYKIASPEYSF
Ga0190274_1162533023300018476SoilMKELQNFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY
Ga0190274_1172024813300018476SoilQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSY
Ga0190271_1054325623300018481SoilMKEFQDFQPLQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEMELNSRRDLHERNILTREYKIASPEYSF
Ga0190271_1080861923300018481SoilMKEFQDFQPSQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIEMELDSRRDPQERNILSREYKIASPEYSF
Ga0190271_1194770823300018481SoilMKEFQDFQPLQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEMELNSRRDPHERNILNREYKIVSPEYSY
Ga0184647_100711423300019263Groundwater SedimentMKELQNFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSY
Ga0173481_1022848923300019356SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPGYYL
Ga0173482_1045262123300019361SoilMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKASSSEYSF
Ga0173482_1056482413300019361SoilDFQPTQLANLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSASAEYSF
Ga0173479_1064349423300019362SoilFLFIKYLFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDSQERNILNRQYKTPSPEYSY
Ga0193704_104966523300019867SoilMKELQDFQPTQLVNLLANETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSPEYSF
Ga0193741_102246623300019884SoilMKELQDFQPSQLVNLLAQETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPHERNILNREYRIATPEYSF
Ga0193692_102928423300020000SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEIELNSRRDPHERNILNRQYKASSPEYSF
Ga0193696_102026823300020016SoilMKELQEFQPSKLVNLLAQETISYYKLIGDGASVEECTQCNNRIRQIEMELGSRRNPEERNILKQPSKSVPYEYSF
Ga0193738_1000222223300020020SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEMELNGRRDVHDRNILNREYKIASPEYSF
Ga0193694_10000016753300021415SoilMKELQDFQPTQLVNLLAKETISYYKLIGDAASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPSPEYSY
Ga0247782_101392623300022870Plant LitterMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSASAEYSF
Ga0247792_101624133300022880SoilMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQKKNILNRQYKAASSEYSF
Ga0247746_108291923300022886SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPEYYL
Ga0247795_100397433300022899SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDEEPEYYL
Ga0247795_100464513300022899SoilMNELQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQCNDKIRQIEIELNSRRDSQERNILNRQYKLPTPEYS
Ga0247766_102301523300022906Plant LitterMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKAASSEYSF
Ga0247801_102915013300023064SoilIKYPFMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSASAEYSF
Ga0247755_103293623300023070Plant LitterLHTVCYFLFIKYPFMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF
Ga0247744_104681023300023073SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNNRIRQIEMELDSRRDPQEKNILNRQYQAASSEYSF
Ga0247802_100834013300023077SoilMNELKDFEPLQLRTLLSQETVSYYKLIGFGASVEECTQCNDRIKQIQQELASRRDPEERNILDRQYVDAEPG
Ga0247802_106269323300023077SoilMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYKAASSEYSF
Ga0247748_101063013300023168SoilYSLFIKYPFMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF
Ga0247798_106923123300023260SoilLHTVCYFLFIKYPFMKEFQDFQPSQLVNLLAQETISYYKLIGDDASVEECTHCNDRIRQIEMELDSRRDPQEKNILNRQYKAASSEYSF
Ga0247780_102623413300023265Plant LitterMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELDSRRDPQERNILTRQYKSAS
Ga0247794_1000855623300024055SoilMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPAEYSIASN
Ga0207656_1015540533300025321Corn RhizosphereNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN
Ga0207685_1003311223300025905Corn, Switchgrass And Miscanthus RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN
Ga0207662_1001496223300025918Switchgrass RhizosphereMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNNRIRQIEMELNSRRDPNERNILNRQYKSPSAEYSIASN
Ga0207701_1063641313300025930Corn, Switchgrass And Miscanthus RhizosphereMKELQDFQPSQLVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEIELNSRRDPHERNILTRQYKLPSPEYSF
Ga0207644_1183859913300025931Switchgrass RhizosphereRFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN
Ga0207691_1022477523300025940Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNREYKTPSPEYSF
Ga0207712_1044425013300025961Switchgrass RhizosphereMLNLQDFQPSQLVNLIAQETRSYYRLIGDGASVEECTQCNSRIKQIEMELDSRRNQEEKSITSRQPAPLEYSY
Ga0207712_1050654313300025961Switchgrass RhizosphereMKELQDFQPSQLVNLLAQETITYYKLIGDDASVEDCTQCNDRIRQIEMELNSRRDPHERNILNRQYKSPSAEY
Ga0207658_1107217723300025986Switchgrass RhizosphereMKEFQNFQPSELVNLLAQETISYYKLIGDDASVEECTQCNDRIRQIEIELDSRRDPHERNILTRQYKLPSPEYSF
Ga0207677_1091898523300026023Miscanthus RhizosphereFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDIEERNILNRQYKTPSPEYSF
Ga0207641_10003368113300026088Switchgrass RhizosphereMAFHFFLAHRLLFSFIKYPFMNELQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQCNDKIRQIEIELNSRRDSQERNILNRQYKLPTPEYSF
Ga0207641_1170462113300026088Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRHYKTPSPEYSF
Ga0207648_1033656213300026089Miscanthus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSF
Ga0207676_1017615913300026095Switchgrass RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYKTPSP
Ga0209438_109978723300026285Grasslands SoilMTELQDFQPSQLVNLLAQETISYYKLIGDGASVEECAHCNNRIKQIEMELDSRRNPEEKSLFRRQTVSALPEFSF
Ga0209468_107737023300026306SoilMKELQDFQPLQLANLLAHETIAYYKLIGDDASVEECTQCNERIRQIERELESRRDPHERNILNRQYKLSPPEYSF
Ga0207428_1020331133300027907Populus RhizosphereMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIEIELGSRRDPQERNILNRQYKTPSPEYSY
Ga0268265_1031573833300028380Switchgrass RhizosphereMKELQDFQPSQLVNLLAQETITYYKLIGDDASVEDCTQCNDRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN
Ga0307503_1032546213300028802SoilMKELQDFQPTQLVNLLAQETITYYKLIGDDASVEDCTQCNDRIRQIEMELNSRRDPHERNILNRQYKSPSAEYSIASN
Ga0307286_1022175923300028876SoilMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDKIRQIEMELNSRRDPEERNILNRQYK
Ga0308200_114776213300030905SoilLQNFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPEYSF
Ga0310888_1001380143300031538SoilMKELQDFQPSQLVNLLAQETISYYKLIGDNASVEECTQCNDRIRQIEIELNSRRDPLERNILNRQYKLPAPEYSF
Ga0310887_1047468523300031547SoilMKELQDFQPSQLVNLLAQETISYYKLIGDNASVEECTQCNDRIRQIEIELNSRRNPLERNILNRQYKLPAPEYSF
Ga0310907_1084115313300031847SoilLNLFLHNFCYSLFIKYLFMKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNDRIRQIELELGSRRDPQERNILNRQYKTPSPE
Ga0310904_1041265423300031854SoilKELQDFQPTQLVNLLAKETISYYKLIGDDASVEECTQCNKRIRQIQMEVESRRSNEEKNIFHDQDISAPAEYSY
Ga0310893_1010443723300031892SoilMKELQDFQPSQLVNLLAQETISYYKLIGDNASVEECTQCNDRIRQIEIELNSRRNPLERNILNRQYKLPAPEYSL
Ga0310884_1042703513300031944SoilPFMKEFQDFQPSQLVSLLAQETISYYKLIGDDASVEECTHCNNRIRQIEMELDSRRDPQKKNILNRQYQAASSEYSF
Ga0310812_1053751913300032421SoilMNELQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQWNDKIRQIEIELDSRRDSQERNILNRQYKLPTPEYSF
Ga0310810_1120185013300033412SoilMNKLQDFPSAQLVNLLAQQTISYYKLIGDGASVEECTQWNDKIRQIEIELDSRRDSQERNILNRQYKLPTPEYSF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.