Basic Information | |
---|---|
Family ID | F044025 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 155 |
Average Sequence Length | 46 residues |
Representative Sequence | MTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 155 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.52 % |
% of genes near scaffold ends (potentially truncated) | 29.68 % |
% of genes from short scaffolds (< 2000 bps) | 86.45 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.581 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.419 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.677 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.710 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.33% β-sheet: 2.67% Coil/Unstructured: 72.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 155 Family Scaffolds |
---|---|---|
PF05922 | Inhibitor_I9 | 11.61 |
PF13528 | Glyco_trans_1_3 | 7.10 |
PF00082 | Peptidase_S8 | 3.87 |
PF00155 | Aminotran_1_2 | 3.23 |
PF04101 | Glyco_tran_28_C | 2.58 |
PF00892 | EamA | 1.94 |
PF13183 | Fer4_8 | 1.29 |
PF02402 | Lysis_col | 0.65 |
PF00300 | His_Phos_1 | 0.65 |
PF13517 | FG-GAP_3 | 0.65 |
PF13522 | GATase_6 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
---|---|---|---|
COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 11.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.58 % |
Unclassified | root | N/A | 17.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459021|G14TP7Y02GLT28 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 566 | Open in IMG/M |
2199352025|deepsgr__Contig_189603 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Thermoflavifilum | 936 | Open in IMG/M |
3300000789|JGI1027J11758_12952886 | Not Available | 801 | Open in IMG/M |
3300000881|JGI10215J12807_1019516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4105 | Open in IMG/M |
3300000891|JGI10214J12806_11177930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1410 | Open in IMG/M |
3300000953|JGI11615J12901_10193446 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 836 | Open in IMG/M |
3300000956|JGI10216J12902_101705330 | Not Available | 512 | Open in IMG/M |
3300000956|JGI10216J12902_104621385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella → Niabella soli | 1225 | Open in IMG/M |
3300000956|JGI10216J12902_122473276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 916 | Open in IMG/M |
3300002100|JGI24809J26612_1000703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 11611 | Open in IMG/M |
3300002124|C687J26631_10038589 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300003267|soilL1_10137642 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1034 | Open in IMG/M |
3300003319|soilL2_10021669 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3505 | Open in IMG/M |
3300003890|Ga0063162_1016597 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1278 | Open in IMG/M |
3300004047|Ga0055499_10019870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 886 | Open in IMG/M |
3300004157|Ga0062590_102681081 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 531 | Open in IMG/M |
3300004463|Ga0063356_100861978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1273 | Open in IMG/M |
3300004479|Ga0062595_102606161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 507 | Open in IMG/M |
3300004779|Ga0062380_10214543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 783 | Open in IMG/M |
3300005175|Ga0066673_10541957 | Not Available | 682 | Open in IMG/M |
3300005183|Ga0068993_10355891 | Not Available | 536 | Open in IMG/M |
3300005204|Ga0068997_10062655 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005289|Ga0065704_10285412 | Not Available | 914 | Open in IMG/M |
3300005289|Ga0065704_10648120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 578 | Open in IMG/M |
3300005290|Ga0065712_10013980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1786 | Open in IMG/M |
3300005290|Ga0065712_10056038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 558 | Open in IMG/M |
3300005290|Ga0065712_10069832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6617 | Open in IMG/M |
3300005290|Ga0065712_10110755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1817 | Open in IMG/M |
3300005293|Ga0065715_10574361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 725 | Open in IMG/M |
3300005294|Ga0065705_10145576 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2049 | Open in IMG/M |
3300005332|Ga0066388_106620348 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 584 | Open in IMG/M |
3300005334|Ga0068869_100139559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1870 | Open in IMG/M |
3300005337|Ga0070682_100105764 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1866 | Open in IMG/M |
3300005347|Ga0070668_100953620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 769 | Open in IMG/M |
3300005353|Ga0070669_101391102 | Not Available | 609 | Open in IMG/M |
3300005441|Ga0070700_100123561 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1737 | Open in IMG/M |
3300005441|Ga0070700_101195686 | Not Available | 634 | Open in IMG/M |
3300005445|Ga0070708_100654252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 990 | Open in IMG/M |
3300005456|Ga0070678_101633246 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 606 | Open in IMG/M |
3300005456|Ga0070678_101786351 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 579 | Open in IMG/M |
3300005466|Ga0070685_11486593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 522 | Open in IMG/M |
3300005467|Ga0070706_101217436 | Not Available | 692 | Open in IMG/M |
3300005544|Ga0070686_101603748 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 551 | Open in IMG/M |
3300005577|Ga0068857_101430861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 673 | Open in IMG/M |
3300005617|Ga0068859_100633678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1161 | Open in IMG/M |
3300005719|Ga0068861_100007830 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 7345 | Open in IMG/M |
3300005829|Ga0074479_10307390 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4580 | Open in IMG/M |
3300005831|Ga0074471_11047640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2857 | Open in IMG/M |
3300005833|Ga0074472_11371994 | Not Available | 742 | Open in IMG/M |
3300005834|Ga0068851_10956051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 539 | Open in IMG/M |
3300005841|Ga0068863_100056987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3698 | Open in IMG/M |
3300005844|Ga0068862_100463505 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1196 | Open in IMG/M |
3300005844|Ga0068862_102166447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 567 | Open in IMG/M |
3300005844|Ga0068862_102282613 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 553 | Open in IMG/M |
3300005955|Ga0073922_1006284 | Not Available | 1361 | Open in IMG/M |
3300005955|Ga0073922_1046143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 552 | Open in IMG/M |
3300005991|Ga0073923_1011152 | Not Available | 1013 | Open in IMG/M |
3300006046|Ga0066652_102088890 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 502 | Open in IMG/M |
3300006194|Ga0075427_10069282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 627 | Open in IMG/M |
3300006791|Ga0066653_10570626 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 573 | Open in IMG/M |
3300006845|Ga0075421_100033339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6522 | Open in IMG/M |
3300006845|Ga0075421_100445190 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1549 | Open in IMG/M |
3300006847|Ga0075431_100254343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1784 | Open in IMG/M |
3300006853|Ga0075420_100446208 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1117 | Open in IMG/M |
3300009100|Ga0075418_12997709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 515 | Open in IMG/M |
3300009156|Ga0111538_10238357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2304 | Open in IMG/M |
3300009162|Ga0075423_11387057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 752 | Open in IMG/M |
3300009455|Ga0114939_10034111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2264 | Open in IMG/M |
3300009455|Ga0114939_10146822 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300009553|Ga0105249_10390863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1419 | Open in IMG/M |
3300009553|Ga0105249_10860397 | Not Available | 972 | Open in IMG/M |
3300009609|Ga0105347_1500298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
3300009626|Ga0114943_1001033 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. legu1 | 1578 | Open in IMG/M |
3300009678|Ga0105252_10256928 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 766 | Open in IMG/M |
3300009691|Ga0114944_1000009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 51914 | Open in IMG/M |
3300010037|Ga0126304_10953007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 584 | Open in IMG/M |
3300010399|Ga0134127_11440679 | Not Available | 760 | Open in IMG/M |
3300010403|Ga0134123_10328302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1370 | Open in IMG/M |
3300012668|Ga0157216_10141844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1160 | Open in IMG/M |
3300012882|Ga0157304_1057512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 615 | Open in IMG/M |
3300012883|Ga0157281_1076073 | Not Available | 567 | Open in IMG/M |
3300012885|Ga0157287_1041896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 692 | Open in IMG/M |
3300012895|Ga0157309_10032017 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1221 | Open in IMG/M |
3300012895|Ga0157309_10260357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 570 | Open in IMG/M |
3300012896|Ga0157303_10032431 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 970 | Open in IMG/M |
3300012901|Ga0157288_10129924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 726 | Open in IMG/M |
3300012901|Ga0157288_10245128 | Not Available | 598 | Open in IMG/M |
3300012901|Ga0157288_10411999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 509 | Open in IMG/M |
3300012903|Ga0157289_10189105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 664 | Open in IMG/M |
3300012903|Ga0157289_10306995 | Not Available | 563 | Open in IMG/M |
3300012907|Ga0157283_10038904 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1028 | Open in IMG/M |
3300012908|Ga0157286_10136551 | Not Available | 766 | Open in IMG/M |
3300012912|Ga0157306_10260790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 616 | Open in IMG/M |
3300012916|Ga0157310_10077065 | Not Available | 1025 | Open in IMG/M |
3300012984|Ga0164309_10854140 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 738 | Open in IMG/M |
3300013306|Ga0163162_12948629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 547 | Open in IMG/M |
3300014326|Ga0157380_10657007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1047 | Open in IMG/M |
3300014969|Ga0157376_11457364 | Not Available | 717 | Open in IMG/M |
3300015077|Ga0173483_10846524 | Not Available | 533 | Open in IMG/M |
3300015371|Ga0132258_12758782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1224 | Open in IMG/M |
3300015374|Ga0132255_101916860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 901 | Open in IMG/M |
3300018031|Ga0184634_10088121 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1341 | Open in IMG/M |
3300018051|Ga0184620_10128311 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 805 | Open in IMG/M |
3300018067|Ga0184611_1165151 | Not Available | 786 | Open in IMG/M |
3300018072|Ga0184635_10190451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 818 | Open in IMG/M |
3300018073|Ga0184624_10041481 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1828 | Open in IMG/M |
3300018082|Ga0184639_10209193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1034 | Open in IMG/M |
3300018083|Ga0184628_10138589 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1263 | Open in IMG/M |
3300018083|Ga0184628_10367681 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 754 | Open in IMG/M |
3300018084|Ga0184629_10451415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 673 | Open in IMG/M |
3300018084|Ga0184629_10455455 | Not Available | 670 | Open in IMG/M |
3300018466|Ga0190268_11086914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 649 | Open in IMG/M |
3300018476|Ga0190274_10021501 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4246 | Open in IMG/M |
3300018476|Ga0190274_13676234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 518 | Open in IMG/M |
3300019263|Ga0184647_1478281 | Not Available | 576 | Open in IMG/M |
3300019356|Ga0173481_10394072 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 675 | Open in IMG/M |
3300019361|Ga0173482_10205227 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 810 | Open in IMG/M |
3300019362|Ga0173479_10009220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2504 | Open in IMG/M |
3300019884|Ga0193741_1012334 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2221 | Open in IMG/M |
3300020020|Ga0193738_1001340 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10088 | Open in IMG/M |
3300022563|Ga0212128_10000604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 26089 | Open in IMG/M |
3300022756|Ga0222622_10012674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter | 4059 | Open in IMG/M |
3300022756|Ga0222622_10612737 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 786 | Open in IMG/M |
3300022896|Ga0247781_1093070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 566 | Open in IMG/M |
3300022911|Ga0247783_1116109 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 739 | Open in IMG/M |
3300023057|Ga0247797_1028076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 752 | Open in IMG/M |
3300023071|Ga0247752_1084262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 534 | Open in IMG/M |
3300023260|Ga0247798_1049591 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 579 | Open in IMG/M |
3300025321|Ga0207656_10236673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 891 | Open in IMG/M |
3300025580|Ga0210138_1018188 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1462 | Open in IMG/M |
3300025768|Ga0209497_1004134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 862 | Open in IMG/M |
3300025905|Ga0207685_10034847 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1832 | Open in IMG/M |
3300025908|Ga0207643_10311782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 981 | Open in IMG/M |
3300025922|Ga0207646_10894575 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 788 | Open in IMG/M |
3300025930|Ga0207701_10236193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1598 | Open in IMG/M |
3300025940|Ga0207691_10745674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 825 | Open in IMG/M |
3300025961|Ga0207712_10077872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2404 | Open in IMG/M |
3300025961|Ga0207712_10296795 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1324 | Open in IMG/M |
3300026095|Ga0207676_10658242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1011 | Open in IMG/M |
3300026118|Ga0207675_100463470 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1257 | Open in IMG/M |
3300026931|Ga0209850_1002652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1596 | Open in IMG/M |
3300027778|Ga0209464_10034094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1640 | Open in IMG/M |
3300027880|Ga0209481_10020181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2943 | Open in IMG/M |
3300027886|Ga0209486_10212654 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1099 | Open in IMG/M |
3300027907|Ga0207428_10239983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1354 | Open in IMG/M |
3300028381|Ga0268264_10897949 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter | 889 | Open in IMG/M |
3300031455|Ga0307505_10540832 | Not Available | 563 | Open in IMG/M |
3300031858|Ga0310892_10520536 | Not Available | 795 | Open in IMG/M |
3300031943|Ga0310885_10068134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1534 | Open in IMG/M |
3300031995|Ga0307409_102629454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 532 | Open in IMG/M |
3300032122|Ga0310895_10417372 | Not Available | 660 | Open in IMG/M |
3300032122|Ga0310895_10788229 | Not Available | 500 | Open in IMG/M |
3300032205|Ga0307472_100984468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 789 | Open in IMG/M |
3300033412|Ga0310810_10636913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1012 | Open in IMG/M |
3300034673|Ga0314798_160559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 519 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.87% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.58% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.58% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.58% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.29% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.29% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.29% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.29% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.29% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.29% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.29% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.65% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300005991 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_10-June-14 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009626 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP1 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022896 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5 | Environmental | Open in IMG/M |
3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025768 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP1 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4NP_01527730 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MKRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
deepsgr_03267720 | 2199352025 | Soil | MTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY |
JGI1027J11758_129528863 | 3300000789 | Soil | RNSIMIRLNKIVFAVLLLVAVGAISCSKNVYTSKAKGNDCGCPNKKGMVGY* |
JGI10215J12807_10195163 | 3300000881 | Soil | MIRLSRIVFALFLIAFIGMGCQKNYYTSKAKNNDCGCPNKKGMAGY* |
JGI10214J12806_111779302 | 3300000891 | Soil | MIRLNRILFALFLIAIIGMGCQKNYYTSKAKNTDCGCPNKKGMSGY* |
JGI11615J12901_101934463 | 3300000953 | Soil | MTRLTKILLALFFIGVLATGCQKNYYTSKAKSNDCGCPNKKGMVGY* |
JGI10216J12902_1017053302 | 3300000956 | Soil | MTRLNKIVFAVLLIVAVGAAGCNKNYYTSKSKGNDCGCPNKKGMVGY* |
JGI10216J12902_1046213852 | 3300000956 | Soil | MKRLNKIVFAALLIVAVGAASCSKNYYTSKAKGSDCGCPNKKGMVGY* |
JGI10216J12902_1224732761 | 3300000956 | Soil | MIRLSRIVFALFLIAMIGVGCQKNYYTSKAKNNDCG |
JGI24809J26612_10007035 | 3300002100 | Soil | MVRLNKILLALFLIGIIAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
C687J26631_100385892 | 3300002124 | Soil | MLKKYKILFILFFVSMVAVSCQKNYYSGKAKSSDCGCPAKKGMVGY* |
soilL1_101376422 | 3300003267 | Sugarcane Root And Bulk Soil | MTRLNKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
soilL2_100216695 | 3300003319 | Sugarcane Root And Bulk Soil | MTRFNKILLALFFVGVLAAGCNKNYYTNKAKGNDCGCPNKKG |
Ga0063162_10165972 | 3300003890 | Hot Spring Sediments | MAKKWKSVWVFLLAAFILAGCQHNYYTSKAKNKDCGCPNKKGMVGY* |
Ga0055499_100198702 | 3300004047 | Natural And Restored Wetlands | MTRLYKTVLTLILISFLAAGCQKNYYTSKAKNSDCGCPNKKGMVGY* |
Ga0062590_1026810812 | 3300004157 | Soil | MKRLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0063356_1008619782 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MARVNKIVLALFFISIMAAGCQKNLYTSKAKNNDCGCPNKKGMVGY* |
Ga0062595_1026061611 | 3300004479 | Soil | MTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNK |
Ga0062380_102145432 | 3300004779 | Wetland Sediment | MFKKYKIILVLIFAAVAATSCQKNYYSGKAKSTDCGCPNKKGMVGY* |
Ga0066673_105419572 | 3300005175 | Soil | MKSLNKLVFAVLLMVAVGTVSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068993_103558912 | 3300005183 | Natural And Restored Wetlands | MTRLFKLITGIFLLAFLATGCQKNYYTSKAKNNDCGCPNKKGMVGY* |
Ga0068997_100626553 | 3300005204 | Natural And Restored Wetlands | YTIMKRLNKIVLALTILAVVLMSCQKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0065704_102854122 | 3300005289 | Switchgrass Rhizosphere | MTRLSKILLALFLIGFVATGCQKNYYTSKAKNNDCGCPNKKGMVGY* |
Ga0065704_106481202 | 3300005289 | Switchgrass Rhizosphere | MKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0065712_100139803 | 3300005290 | Miscanthus Rhizosphere | FRTSFMTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0065712_100560381 | 3300005290 | Miscanthus Rhizosphere | MKRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0065712_100698322 | 3300005290 | Miscanthus Rhizosphere | MTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0065712_101107551 | 3300005290 | Miscanthus Rhizosphere | MKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0065715_105743612 | 3300005293 | Miscanthus Rhizosphere | MKRLNKIFFVALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0065705_101455763 | 3300005294 | Switchgrass Rhizosphere | MIRLNRILFTLFLIAIIGMGCQKNYYTSKAKNTDCGCPNKKGMSGY* |
Ga0066388_1066203481 | 3300005332 | Tropical Forest Soil | MMTRFNKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068869_1001395593 | 3300005334 | Miscanthus Rhizosphere | MTRLNKIMFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0070682_1001057642 | 3300005337 | Corn Rhizosphere | MKRLNKIVFVALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070668_1009536201 | 3300005347 | Switchgrass Rhizosphere | KILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0070669_1013911022 | 3300005353 | Switchgrass Rhizosphere | MKRLNKIFLAALLIVAVGAIGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070700_1001235612 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070700_1011956861 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRLNKIVFAVLLVVAVSAVSCSKNVYTSKAKGNDCGCPNKKGMVGY* |
Ga0070708_1006542523 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLNKIIFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070678_1016332462 | 3300005456 | Miscanthus Rhizosphere | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070678_1017863511 | 3300005456 | Miscanthus Rhizosphere | MTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0070685_114865931 | 3300005466 | Switchgrass Rhizosphere | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVG |
Ga0070706_1012174362 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLNKIVFAVLLIVAVGAVSCIKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0070686_1016037481 | 3300005544 | Switchgrass Rhizosphere | MKRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068857_1014308611 | 3300005577 | Corn Rhizosphere | MTRLNKIVFGVLLIVAVGAMSCSKNVYTSKAKSNDCGCPNKKGMVGY* |
Ga0068859_1006336782 | 3300005617 | Switchgrass Rhizosphere | MFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068861_1000078304 | 3300005719 | Switchgrass Rhizosphere | MTRISKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0074479_103073905 | 3300005829 | Sediment (Intertidal) | MKRLNKIVLALTILAVVLMSCQKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0074471_110476403 | 3300005831 | Sediment (Intertidal) | MMVKKYKILLVLFFAAITAMGCQKNFYTSKAKGNDCGCPNTKNMSGY* |
Ga0074472_113719943 | 3300005833 | Sediment (Intertidal) | MIKKYKIVFVLFFVAIAAMSCQKNFYSGKAKSTDCGCPNKKAMVGY* |
Ga0068851_109560513 | 3300005834 | Corn Rhizosphere | SFMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068863_1000569871 | 3300005841 | Switchgrass Rhizosphere | MTRLNKIVFAVLLIVALGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068862_1004635053 | 3300005844 | Switchgrass Rhizosphere | MTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0068862_1021664472 | 3300005844 | Switchgrass Rhizosphere | MIRLNKILLALFFMGVLLAGCQKNYYTSKAKGSDCGCPNKKGMAGY* |
Ga0068862_1022826131 | 3300005844 | Switchgrass Rhizosphere | MTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGC |
Ga0073922_10062842 | 3300005955 | Sand | MNRLNKIVFVIVLLALLGTGCQKNYYSGKAKSTDCGCPNKKGMVGY* |
Ga0073922_10461431 | 3300005955 | Sand | MNRLNKIVFVIVLMALVGAGCQKNYYSGKAKSSDCGCPNKKGMSGY* |
Ga0073923_10111523 | 3300005991 | Sand | MIKKYKIVFVLFFVAMSAMSCQKNFYSGKAKSTDCGCPNKKGMVGY* |
Ga0066652_1020888902 | 3300006046 | Soil | MKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKK |
Ga0075427_100692822 | 3300006194 | Populus Rhizosphere | MVKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY* |
Ga0066653_105706262 | 3300006791 | Soil | MKRLNKIVIAVLLIAAVGATSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0075421_1000333397 | 3300006845 | Populus Rhizosphere | MTRLNKILLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY* |
Ga0075421_1004451903 | 3300006845 | Populus Rhizosphere | MTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0075431_1002543433 | 3300006847 | Populus Rhizosphere | MIKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY* |
Ga0075420_1004462083 | 3300006853 | Populus Rhizosphere | KLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY* |
Ga0075418_129977092 | 3300009100 | Populus Rhizosphere | MKRLNKIVFAALLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0111538_102383574 | 3300009156 | Populus Rhizosphere | MTRLNKIVFAVLLIVAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY* |
Ga0075423_113870572 | 3300009162 | Populus Rhizosphere | MTRLNKIVFAVLLIIAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0114939_100341112 | 3300009455 | Groundwater | MNKLNKILLIIVLLALVGAGCQKNYYSGKAKSSDCGCPNKKGMVGY* |
Ga0114939_101468222 | 3300009455 | Groundwater | MNRLNKIVFVIVLLALVGAGCQKNYYSGKAKSSDCGCPNKKGMVGY* |
Ga0105249_103908632 | 3300009553 | Switchgrass Rhizosphere | MTKLKKILLALFFIGVVLTGCQKNYYTSKAKSSDCGCPNKKGMAGY* |
Ga0105249_108603973 | 3300009553 | Switchgrass Rhizosphere | FRTSFMTRLKKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNKKGMAGY* |
Ga0105347_15002982 | 3300009609 | Soil | MTRLNKIVFAALLIVAVGAVSCSKNYYTSKSKGNDCGCPNKKGM |
Ga0114943_10010331 | 3300009626 | Thermal Springs | VKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY* |
Ga0105252_102569282 | 3300009678 | Soil | MKRLNKIVFAALLIVAVGAASCSKNYYTSKSKGNDCGCPNKKGMVGY* |
Ga0114944_100000928 | 3300009691 | Thermal Springs | MTRVKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY* |
Ga0126304_109530072 | 3300010037 | Serpentine Soil | MTRLNKIVFAALLIVAVGALSCSKNYYTSKSKGNDCGCPNKKGMVGY* |
Ga0134127_114406792 | 3300010399 | Terrestrial Soil | MTKLNKILLALFFIGVLLTGCQKNYYTSKAKSSDCGCPNKKGMAGY* |
Ga0134123_103283023 | 3300010403 | Terrestrial Soil | MIRLSKILLALFFMGIIATGCQKNYYTNKAKSSDCGCPNKKGMVGY* |
Ga0157216_101418441 | 3300012668 | Glacier Forefield Soil | MISLRRIVFALFLIAIVGMGCQKNYYTSSKAKNKDCGCP |
Ga0157304_10575123 | 3300012882 | Soil | SFMTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157281_10760732 | 3300012883 | Soil | KRLNKIFLAALLIVAVGAIGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157287_10418962 | 3300012885 | Soil | MTRLNKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNK |
Ga0157309_100320171 | 3300012895 | Soil | RLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157309_102603572 | 3300012895 | Soil | MKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKG |
Ga0157303_100324311 | 3300012896 | Soil | RLNKIFFVALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157288_101299242 | 3300012901 | Soil | MKRLNKIVFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157288_102451281 | 3300012901 | Soil | TRLNKIVFAVLLIVAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY* |
Ga0157288_104119992 | 3300012901 | Soil | MTRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY* |
Ga0157289_101891052 | 3300012903 | Soil | MTRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157289_103069952 | 3300012903 | Soil | IFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157283_100389042 | 3300012907 | Soil | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGC |
Ga0157286_101365513 | 3300012908 | Soil | FAVLLIVAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY* |
Ga0157306_102607902 | 3300012912 | Soil | KILFAVLLIVAVGATSCNKNYYTSKAKGNDCGCPSQRQ* |
Ga0157310_100770651 | 3300012916 | Soil | MKRLNKIVFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0164309_108541402 | 3300012984 | Soil | MTRLNKIVFAVLLIVAVGASSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0163162_129486292 | 3300013306 | Switchgrass Rhizosphere | MTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNK |
Ga0157380_106570071 | 3300014326 | Switchgrass Rhizosphere | NKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0157376_114573642 | 3300014969 | Miscanthus Rhizosphere | MKRLNKIVFAALLIIAIGAASCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0173483_108465241 | 3300015077 | Soil | IIFAVLLLVAVGAISCSKNVYTSKAKGNDCGCPNKKGMVGY* |
Ga0132258_127587823 | 3300015371 | Arabidopsis Rhizosphere | MKRLNKIVFAALLIIAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0132255_1019168602 | 3300015374 | Arabidopsis Rhizosphere | MTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY* |
Ga0184634_100881212 | 3300018031 | Groundwater Sediment | MKRLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184620_101283112 | 3300018051 | Groundwater Sediment | MTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184611_11651512 | 3300018067 | Groundwater Sediment | MTRLNKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184635_101904512 | 3300018072 | Groundwater Sediment | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184624_100414812 | 3300018073 | Groundwater Sediment | MKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184639_102091931 | 3300018082 | Groundwater Sediment | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGND |
Ga0184628_101385892 | 3300018083 | Groundwater Sediment | MKRLNKIVLAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0184628_103676813 | 3300018083 | Groundwater Sediment | MTRLNKIVFAALLIIAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY |
Ga0184629_104514152 | 3300018084 | Groundwater Sediment | MTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY |
Ga0184629_104554552 | 3300018084 | Groundwater Sediment | MIKKYKIILVLFFVAMAAAGCQKNYYSGKAKSSDCGCPNK |
Ga0190268_110869142 | 3300018466 | Soil | MARLNKIVFALFLIGIIATGCQKNFYTNKAKNNDCGCPNKKGMVGY |
Ga0190274_100215014 | 3300018476 | Soil | MKRLNKIVLAALLIVAVGAVSCSKNYYTSKSRGNDCGCPNKKGMVGY |
Ga0190274_136762341 | 3300018476 | Soil | MTRLNKIVFAVLLIVAVGAMGCSKNVYTSKSKGNDCGCPNKKGMVGY |
Ga0184647_14782811 | 3300019263 | Groundwater Sediment | NKIVFAALLIIAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY |
Ga0173481_103940721 | 3300019356 | Soil | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGM |
Ga0173482_102052272 | 3300019361 | Soil | MKRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0173479_100092202 | 3300019362 | Soil | MTRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY |
Ga0193741_10123343 | 3300019884 | Soil | MARFNKIVFALFLIGVIATGCQKNYYTSKAKNNDCGCPNKKGMAGY |
Ga0193738_10013402 | 3300020020 | Soil | MTRLNKIVFAALLIVAVGAMSCSKNYYTSKSKGNDCGCPNKKGMVGY |
Ga0212128_1000060413 | 3300022563 | Thermal Springs | MTRVKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY |
Ga0222622_100126743 | 3300022756 | Groundwater Sediment | MTRLNKIIFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0222622_106127373 | 3300022756 | Groundwater Sediment | LFMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0247781_10930701 | 3300022896 | Plant Litter | MKRLNKIFFAVILIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0247783_11161092 | 3300022911 | Plant Litter | MKRLNKIVFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0247797_10280762 | 3300023057 | Soil | MTRLNKIVFAVLLIVAVGATGCSKNYYTSKSKGNDCGCPNKKGMV |
Ga0247752_10842623 | 3300023071 | Soil | RLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0247798_10495912 | 3300023260 | Soil | MKRLNKIFFAVIFIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0207656_102366732 | 3300025321 | Corn Rhizosphere | MTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0210138_10181881 | 3300025580 | Natural And Restored Wetlands | NKIVFAVLLIVAVGATSCSKNVYTSKAKGNDCGCPNKKGMVGY |
Ga0209497_10041343 | 3300025768 | Thermal Springs | MALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY |
Ga0207685_100348473 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLNKIVFALLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0207643_103117822 | 3300025908 | Miscanthus Rhizosphere | MTRLNKIMFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0207646_108945752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRLNKILLALFFMGVLLAGCQKNYYTSKAKGSDCGCPNKKGMAGY |
Ga0207701_102361931 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0207691_107456741 | 3300025940 | Miscanthus Rhizosphere | MKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMV |
Ga0207712_100778724 | 3300025961 | Switchgrass Rhizosphere | MTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0207712_102967953 | 3300025961 | Switchgrass Rhizosphere | MTKLKKILLALFFIGVVLTGCQKNYYTSKAKSSDCGCPNKKGMAGY |
Ga0207676_106582421 | 3300026095 | Switchgrass Rhizosphere | MTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKG |
Ga0207675_1004634702 | 3300026118 | Switchgrass Rhizosphere | MKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY |
Ga0209850_10026522 | 3300026931 | Sand | MNRLNKIVFVIVLLALLGTGCQKNYYSGKAKSTDCGCPNKKGMVGY |
Ga0209464_100340942 | 3300027778 | Wetland Sediment | MIRLNRIIFGLFIIAIIAVGCNKNVYTSKAKNNDCGCPNKKGMVGY |
Ga0209481_100201812 | 3300027880 | Populus Rhizosphere | MVKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY |
Ga0209486_102126541 | 3300027886 | Agricultural Soil | MIRLNRILFALFLIAIVGMGCQKNYYTSKAKNSDCGCPNKKG |
Ga0207428_102399833 | 3300027907 | Populus Rhizosphere | MTRLNKIVFAVLLIVAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY |
Ga0268264_108979492 | 3300028381 | Switchgrass Rhizosphere | MTRISKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY |
Ga0307505_105408323 | 3300031455 | Soil | TEFMLKKSNILFILLFVSLVALSCQKNYYSGKAKNSDCGCPAKKGMVGY |
Ga0310892_105205362 | 3300031858 | Soil | MIRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMAGY |
Ga0310885_100681343 | 3300031943 | Soil | LNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0307409_1026294542 | 3300031995 | Rhizosphere | MKRLNKIVFAALLIVAVGAASCSKNYYTSKAKGSDCGCPNKKGMVGY |
Ga0310895_104173721 | 3300032122 | Soil | NKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0310895_107882291 | 3300032122 | Soil | MRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0307472_1009844682 | 3300032205 | Hardwood Forest Soil | MKRLNKIVFAALLIVAFGAASCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0310810_106369132 | 3300033412 | Soil | MTRLNKIVFAVLIIVAAGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY |
Ga0314798_160559_322_465 | 3300034673 | Soil | MKRLNKIFFAVLLIVAVGATSCNKNYYTSKAKGNDCGCPNKKGMVGY |
⦗Top⦘ |