NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044025

Metagenome / Metatranscriptome Family F044025

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044025
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 46 residues
Representative Sequence MTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Number of Associated Samples 131
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.52 %
% of genes near scaffold ends (potentially truncated) 29.68 %
% of genes from short scaffolds (< 2000 bps) 86.45 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.419 % of family members)
Environment Ontology (ENVO) Unclassified
(29.677 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.710 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 25.33%    β-sheet: 2.67%    Coil/Unstructured: 72.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF05922Inhibitor_I9 11.61
PF13528Glyco_trans_1_3 7.10
PF00082Peptidase_S8 3.87
PF00155Aminotran_1_2 3.23
PF04101Glyco_tran_28_C 2.58
PF00892EamA 1.94
PF13183Fer4_8 1.29
PF02402Lysis_col 0.65
PF00300His_Phos_1 0.65
PF13517FG-GAP_3 0.65
PF13522GATase_6 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG1404Serine protease, subtilisin familyPosttranslational modification, protein turnover, chaperones [O] 11.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.58 %
UnclassifiedrootN/A17.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459021|G14TP7Y02GLT28All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes566Open in IMG/M
2199352025|deepsgr__Contig_189603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Thermoflavifilum936Open in IMG/M
3300000789|JGI1027J11758_12952886Not Available801Open in IMG/M
3300000881|JGI10215J12807_1019516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4105Open in IMG/M
3300000891|JGI10214J12806_11177930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1410Open in IMG/M
3300000953|JGI11615J12901_10193446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes836Open in IMG/M
3300000956|JGI10216J12902_101705330Not Available512Open in IMG/M
3300000956|JGI10216J12902_104621385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella → Niabella soli1225Open in IMG/M
3300000956|JGI10216J12902_122473276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes916Open in IMG/M
3300002100|JGI24809J26612_1000703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea11611Open in IMG/M
3300002124|C687J26631_10038589All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300003267|soilL1_10137642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1034Open in IMG/M
3300003319|soilL2_10021669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3505Open in IMG/M
3300003890|Ga0063162_1016597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1278Open in IMG/M
3300004047|Ga0055499_10019870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae886Open in IMG/M
3300004157|Ga0062590_102681081All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes531Open in IMG/M
3300004463|Ga0063356_100861978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1273Open in IMG/M
3300004479|Ga0062595_102606161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes507Open in IMG/M
3300004779|Ga0062380_10214543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales783Open in IMG/M
3300005175|Ga0066673_10541957Not Available682Open in IMG/M
3300005183|Ga0068993_10355891Not Available536Open in IMG/M
3300005204|Ga0068997_10062655All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005289|Ga0065704_10285412Not Available914Open in IMG/M
3300005289|Ga0065704_10648120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300005290|Ga0065712_10013980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1786Open in IMG/M
3300005290|Ga0065712_10056038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes558Open in IMG/M
3300005290|Ga0065712_10069832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6617Open in IMG/M
3300005290|Ga0065712_10110755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1817Open in IMG/M
3300005293|Ga0065715_10574361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes725Open in IMG/M
3300005294|Ga0065705_10145576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2049Open in IMG/M
3300005332|Ga0066388_106620348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes584Open in IMG/M
3300005334|Ga0068869_100139559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1870Open in IMG/M
3300005337|Ga0070682_100105764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1866Open in IMG/M
3300005347|Ga0070668_100953620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes769Open in IMG/M
3300005353|Ga0070669_101391102Not Available609Open in IMG/M
3300005441|Ga0070700_100123561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1737Open in IMG/M
3300005441|Ga0070700_101195686Not Available634Open in IMG/M
3300005445|Ga0070708_100654252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae990Open in IMG/M
3300005456|Ga0070678_101633246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales606Open in IMG/M
3300005456|Ga0070678_101786351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes579Open in IMG/M
3300005466|Ga0070685_11486593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes522Open in IMG/M
3300005467|Ga0070706_101217436Not Available692Open in IMG/M
3300005544|Ga0070686_101603748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes551Open in IMG/M
3300005577|Ga0068857_101430861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes673Open in IMG/M
3300005617|Ga0068859_100633678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1161Open in IMG/M
3300005719|Ga0068861_100007830All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea7345Open in IMG/M
3300005829|Ga0074479_10307390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4580Open in IMG/M
3300005831|Ga0074471_11047640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2857Open in IMG/M
3300005833|Ga0074472_11371994Not Available742Open in IMG/M
3300005834|Ga0068851_10956051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes539Open in IMG/M
3300005841|Ga0068863_100056987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3698Open in IMG/M
3300005844|Ga0068862_100463505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1196Open in IMG/M
3300005844|Ga0068862_102166447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales567Open in IMG/M
3300005844|Ga0068862_102282613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes553Open in IMG/M
3300005955|Ga0073922_1006284Not Available1361Open in IMG/M
3300005955|Ga0073922_1046143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300005991|Ga0073923_1011152Not Available1013Open in IMG/M
3300006046|Ga0066652_102088890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes502Open in IMG/M
3300006194|Ga0075427_10069282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes627Open in IMG/M
3300006791|Ga0066653_10570626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes573Open in IMG/M
3300006845|Ga0075421_100033339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6522Open in IMG/M
3300006845|Ga0075421_100445190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1549Open in IMG/M
3300006847|Ga0075431_100254343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1784Open in IMG/M
3300006853|Ga0075420_100446208All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1117Open in IMG/M
3300009100|Ga0075418_12997709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes515Open in IMG/M
3300009156|Ga0111538_10238357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2304Open in IMG/M
3300009162|Ga0075423_11387057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes752Open in IMG/M
3300009455|Ga0114939_10034111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2264Open in IMG/M
3300009455|Ga0114939_10146822All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300009553|Ga0105249_10390863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1419Open in IMG/M
3300009553|Ga0105249_10860397Not Available972Open in IMG/M
3300009609|Ga0105347_1500298All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes528Open in IMG/M
3300009626|Ga0114943_1001033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. legu11578Open in IMG/M
3300009678|Ga0105252_10256928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes766Open in IMG/M
3300009691|Ga0114944_1000009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae51914Open in IMG/M
3300010037|Ga0126304_10953007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes584Open in IMG/M
3300010399|Ga0134127_11440679Not Available760Open in IMG/M
3300010403|Ga0134123_10328302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1370Open in IMG/M
3300012668|Ga0157216_10141844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1160Open in IMG/M
3300012882|Ga0157304_1057512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes615Open in IMG/M
3300012883|Ga0157281_1076073Not Available567Open in IMG/M
3300012885|Ga0157287_1041896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes692Open in IMG/M
3300012895|Ga0157309_10032017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1221Open in IMG/M
3300012895|Ga0157309_10260357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300012896|Ga0157303_10032431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes970Open in IMG/M
3300012901|Ga0157288_10129924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes726Open in IMG/M
3300012901|Ga0157288_10245128Not Available598Open in IMG/M
3300012901|Ga0157288_10411999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300012903|Ga0157289_10189105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes664Open in IMG/M
3300012903|Ga0157289_10306995Not Available563Open in IMG/M
3300012907|Ga0157283_10038904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1028Open in IMG/M
3300012908|Ga0157286_10136551Not Available766Open in IMG/M
3300012912|Ga0157306_10260790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes616Open in IMG/M
3300012916|Ga0157310_10077065Not Available1025Open in IMG/M
3300012984|Ga0164309_10854140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes738Open in IMG/M
3300013306|Ga0163162_12948629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes547Open in IMG/M
3300014326|Ga0157380_10657007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1047Open in IMG/M
3300014969|Ga0157376_11457364Not Available717Open in IMG/M
3300015077|Ga0173483_10846524Not Available533Open in IMG/M
3300015371|Ga0132258_12758782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1224Open in IMG/M
3300015374|Ga0132255_101916860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes901Open in IMG/M
3300018031|Ga0184634_10088121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1341Open in IMG/M
3300018051|Ga0184620_10128311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae805Open in IMG/M
3300018067|Ga0184611_1165151Not Available786Open in IMG/M
3300018072|Ga0184635_10190451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes818Open in IMG/M
3300018073|Ga0184624_10041481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1828Open in IMG/M
3300018082|Ga0184639_10209193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1034Open in IMG/M
3300018083|Ga0184628_10138589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1263Open in IMG/M
3300018083|Ga0184628_10367681All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes754Open in IMG/M
3300018084|Ga0184629_10451415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes673Open in IMG/M
3300018084|Ga0184629_10455455Not Available670Open in IMG/M
3300018466|Ga0190268_11086914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300018476|Ga0190274_10021501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4246Open in IMG/M
3300018476|Ga0190274_13676234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes518Open in IMG/M
3300019263|Ga0184647_1478281Not Available576Open in IMG/M
3300019356|Ga0173481_10394072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes675Open in IMG/M
3300019361|Ga0173482_10205227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium810Open in IMG/M
3300019362|Ga0173479_10009220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2504Open in IMG/M
3300019884|Ga0193741_1012334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2221Open in IMG/M
3300020020|Ga0193738_1001340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10088Open in IMG/M
3300022563|Ga0212128_10000604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae26089Open in IMG/M
3300022756|Ga0222622_10012674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter4059Open in IMG/M
3300022756|Ga0222622_10612737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes786Open in IMG/M
3300022896|Ga0247781_1093070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes566Open in IMG/M
3300022911|Ga0247783_1116109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes739Open in IMG/M
3300023057|Ga0247797_1028076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes752Open in IMG/M
3300023071|Ga0247752_1084262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes534Open in IMG/M
3300023260|Ga0247798_1049591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes579Open in IMG/M
3300025321|Ga0207656_10236673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes891Open in IMG/M
3300025580|Ga0210138_1018188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1462Open in IMG/M
3300025768|Ga0209497_1004134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes862Open in IMG/M
3300025905|Ga0207685_10034847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1832Open in IMG/M
3300025908|Ga0207643_10311782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes981Open in IMG/M
3300025922|Ga0207646_10894575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium788Open in IMG/M
3300025930|Ga0207701_10236193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1598Open in IMG/M
3300025940|Ga0207691_10745674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes825Open in IMG/M
3300025961|Ga0207712_10077872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2404Open in IMG/M
3300025961|Ga0207712_10296795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1324Open in IMG/M
3300026095|Ga0207676_10658242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1011Open in IMG/M
3300026118|Ga0207675_100463470All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1257Open in IMG/M
3300026931|Ga0209850_1002652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1596Open in IMG/M
3300027778|Ga0209464_10034094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1640Open in IMG/M
3300027880|Ga0209481_10020181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2943Open in IMG/M
3300027886|Ga0209486_10212654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1099Open in IMG/M
3300027907|Ga0207428_10239983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1354Open in IMG/M
3300028381|Ga0268264_10897949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter889Open in IMG/M
3300031455|Ga0307505_10540832Not Available563Open in IMG/M
3300031858|Ga0310892_10520536Not Available795Open in IMG/M
3300031943|Ga0310885_10068134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1534Open in IMG/M
3300031995|Ga0307409_102629454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes532Open in IMG/M
3300032122|Ga0310895_10417372Not Available660Open in IMG/M
3300032122|Ga0310895_10788229Not Available500Open in IMG/M
3300032205|Ga0307472_100984468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes789Open in IMG/M
3300033412|Ga0310810_10636913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1012Open in IMG/M
3300034673|Ga0314798_160559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes519Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.87%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.58%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs2.58%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand2.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.58%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.94%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.29%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.29%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.29%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.29%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.29%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.29%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.29%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.65%
Hot Spring SedimentsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments0.65%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.65%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459021Litter degradation NP4EngineeredOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003890Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cmEnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005204Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300005991Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_10-June-14EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009626Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP1EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022896Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025768Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP1 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026931Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4NP_015277302170459021Switchgrass, Maize And Mischanthus LitterMKRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
deepsgr_032677202199352025SoilMTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY
JGI1027J11758_1295288633300000789SoilRNSIMIRLNKIVFAVLLLVAVGAISCSKNVYTSKAKGNDCGCPNKKGMVGY*
JGI10215J12807_101951633300000881SoilMIRLSRIVFALFLIAFIGMGCQKNYYTSKAKNNDCGCPNKKGMAGY*
JGI10214J12806_1117793023300000891SoilMIRLNRILFALFLIAIIGMGCQKNYYTSKAKNTDCGCPNKKGMSGY*
JGI11615J12901_1019344633300000953SoilMTRLTKILLALFFIGVLATGCQKNYYTSKAKSNDCGCPNKKGMVGY*
JGI10216J12902_10170533023300000956SoilMTRLNKIVFAVLLIVAVGAAGCNKNYYTSKSKGNDCGCPNKKGMVGY*
JGI10216J12902_10462138523300000956SoilMKRLNKIVFAALLIVAVGAASCSKNYYTSKAKGSDCGCPNKKGMVGY*
JGI10216J12902_12247327613300000956SoilMIRLSRIVFALFLIAMIGVGCQKNYYTSKAKNNDCG
JGI24809J26612_100070353300002100SoilMVRLNKILLALFLIGIIAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
C687J26631_1003858923300002124SoilMLKKYKILFILFFVSMVAVSCQKNYYSGKAKSSDCGCPAKKGMVGY*
soilL1_1013764223300003267Sugarcane Root And Bulk SoilMTRLNKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
soilL2_1002166953300003319Sugarcane Root And Bulk SoilMTRFNKILLALFFVGVLAAGCNKNYYTNKAKGNDCGCPNKKG
Ga0063162_101659723300003890Hot Spring SedimentsMAKKWKSVWVFLLAAFILAGCQHNYYTSKAKNKDCGCPNKKGMVGY*
Ga0055499_1001987023300004047Natural And Restored WetlandsMTRLYKTVLTLILISFLAAGCQKNYYTSKAKNSDCGCPNKKGMVGY*
Ga0062590_10268108123300004157SoilMKRLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0063356_10086197823300004463Arabidopsis Thaliana RhizosphereMARVNKIVLALFFISIMAAGCQKNLYTSKAKNNDCGCPNKKGMVGY*
Ga0062595_10260616113300004479SoilMTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNK
Ga0062380_1021454323300004779Wetland SedimentMFKKYKIILVLIFAAVAATSCQKNYYSGKAKSTDCGCPNKKGMVGY*
Ga0066673_1054195723300005175SoilMKSLNKLVFAVLLMVAVGTVSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068993_1035589123300005183Natural And Restored WetlandsMTRLFKLITGIFLLAFLATGCQKNYYTSKAKNNDCGCPNKKGMVGY*
Ga0068997_1006265533300005204Natural And Restored WetlandsYTIMKRLNKIVLALTILAVVLMSCQKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0065704_1028541223300005289Switchgrass RhizosphereMTRLSKILLALFLIGFVATGCQKNYYTSKAKNNDCGCPNKKGMVGY*
Ga0065704_1064812023300005289Switchgrass RhizosphereMKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0065712_1001398033300005290Miscanthus RhizosphereFRTSFMTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0065712_1005603813300005290Miscanthus RhizosphereMKRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0065712_1006983223300005290Miscanthus RhizosphereMTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0065712_1011075513300005290Miscanthus RhizosphereMKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0065715_1057436123300005293Miscanthus RhizosphereMKRLNKIFFVALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0065705_1014557633300005294Switchgrass RhizosphereMIRLNRILFTLFLIAIIGMGCQKNYYTSKAKNTDCGCPNKKGMSGY*
Ga0066388_10662034813300005332Tropical Forest SoilMMTRFNKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068869_10013955933300005334Miscanthus RhizosphereMTRLNKIMFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0070682_10010576423300005337Corn RhizosphereMKRLNKIVFVALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070668_10095362013300005347Switchgrass RhizosphereKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0070669_10139110223300005353Switchgrass RhizosphereMKRLNKIFLAALLIVAVGAIGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070700_10012356123300005441Corn, Switchgrass And Miscanthus RhizosphereMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070700_10119568613300005441Corn, Switchgrass And Miscanthus RhizosphereMIRLNKIVFAVLLVVAVSAVSCSKNVYTSKAKGNDCGCPNKKGMVGY*
Ga0070708_10065425233300005445Corn, Switchgrass And Miscanthus RhizosphereMTRLNKIIFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070678_10163324623300005456Miscanthus RhizosphereMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070678_10178635113300005456Miscanthus RhizosphereMTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0070685_1148659313300005466Switchgrass RhizosphereMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVG
Ga0070706_10121743623300005467Corn, Switchgrass And Miscanthus RhizosphereMTRLNKIVFAVLLIVAVGAVSCIKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0070686_10160374813300005544Switchgrass RhizosphereMKRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068857_10143086113300005577Corn RhizosphereMTRLNKIVFGVLLIVAVGAMSCSKNVYTSKAKSNDCGCPNKKGMVGY*
Ga0068859_10063367823300005617Switchgrass RhizosphereMFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068861_10000783043300005719Switchgrass RhizosphereMTRISKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0074479_1030739053300005829Sediment (Intertidal)MKRLNKIVLALTILAVVLMSCQKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0074471_1104764033300005831Sediment (Intertidal)MMVKKYKILLVLFFAAITAMGCQKNFYTSKAKGNDCGCPNTKNMSGY*
Ga0074472_1137199433300005833Sediment (Intertidal)MIKKYKIVFVLFFVAIAAMSCQKNFYSGKAKSTDCGCPNKKAMVGY*
Ga0068851_1095605133300005834Corn RhizosphereSFMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068863_10005698713300005841Switchgrass RhizosphereMTRLNKIVFAVLLIVALGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068862_10046350533300005844Switchgrass RhizosphereMTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0068862_10216644723300005844Switchgrass RhizosphereMIRLNKILLALFFMGVLLAGCQKNYYTSKAKGSDCGCPNKKGMAGY*
Ga0068862_10228261313300005844Switchgrass RhizosphereMTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGC
Ga0073922_100628423300005955SandMNRLNKIVFVIVLLALLGTGCQKNYYSGKAKSTDCGCPNKKGMVGY*
Ga0073922_104614313300005955SandMNRLNKIVFVIVLMALVGAGCQKNYYSGKAKSSDCGCPNKKGMSGY*
Ga0073923_101115233300005991SandMIKKYKIVFVLFFVAMSAMSCQKNFYSGKAKSTDCGCPNKKGMVGY*
Ga0066652_10208889023300006046SoilMKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKK
Ga0075427_1006928223300006194Populus RhizosphereMVKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY*
Ga0066653_1057062623300006791SoilMKRLNKIVIAVLLIAAVGATSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0075421_10003333973300006845Populus RhizosphereMTRLNKILLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY*
Ga0075421_10044519033300006845Populus RhizosphereMTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0075431_10025434333300006847Populus RhizosphereMIKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY*
Ga0075420_10044620833300006853Populus RhizosphereKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY*
Ga0075418_1299770923300009100Populus RhizosphereMKRLNKIVFAALLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0111538_1023835743300009156Populus RhizosphereMTRLNKIVFAVLLIVAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY*
Ga0075423_1138705723300009162Populus RhizosphereMTRLNKIVFAVLLIIAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0114939_1003411123300009455GroundwaterMNKLNKILLIIVLLALVGAGCQKNYYSGKAKSSDCGCPNKKGMVGY*
Ga0114939_1014682223300009455GroundwaterMNRLNKIVFVIVLLALVGAGCQKNYYSGKAKSSDCGCPNKKGMVGY*
Ga0105249_1039086323300009553Switchgrass RhizosphereMTKLKKILLALFFIGVVLTGCQKNYYTSKAKSSDCGCPNKKGMAGY*
Ga0105249_1086039733300009553Switchgrass RhizosphereFRTSFMTRLKKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNKKGMAGY*
Ga0105347_150029823300009609SoilMTRLNKIVFAALLIVAVGAVSCSKNYYTSKSKGNDCGCPNKKGM
Ga0114943_100103313300009626Thermal SpringsVKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY*
Ga0105252_1025692823300009678SoilMKRLNKIVFAALLIVAVGAASCSKNYYTSKSKGNDCGCPNKKGMVGY*
Ga0114944_1000009283300009691Thermal SpringsMTRVKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY*
Ga0126304_1095300723300010037Serpentine SoilMTRLNKIVFAALLIVAVGALSCSKNYYTSKSKGNDCGCPNKKGMVGY*
Ga0134127_1144067923300010399Terrestrial SoilMTKLNKILLALFFIGVLLTGCQKNYYTSKAKSSDCGCPNKKGMAGY*
Ga0134123_1032830233300010403Terrestrial SoilMIRLSKILLALFFMGIIATGCQKNYYTNKAKSSDCGCPNKKGMVGY*
Ga0157216_1014184413300012668Glacier Forefield SoilMISLRRIVFALFLIAIVGMGCQKNYYTSSKAKNKDCGCP
Ga0157304_105751233300012882SoilSFMTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157281_107607323300012883SoilKRLNKIFLAALLIVAVGAIGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157287_104189623300012885SoilMTRLNKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNK
Ga0157309_1003201713300012895SoilRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157309_1026035723300012895SoilMKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKG
Ga0157303_1003243113300012896SoilRLNKIFFVALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157288_1012992423300012901SoilMKRLNKIVFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157288_1024512813300012901SoilTRLNKIVFAVLLIVAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY*
Ga0157288_1041199923300012901SoilMTRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY*
Ga0157289_1018910523300012903SoilMTRLNKIVFAALLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157289_1030699523300012903SoilIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157283_1003890423300012907SoilMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGC
Ga0157286_1013655133300012908SoilFAVLLIVAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY*
Ga0157306_1026079023300012912SoilKILFAVLLIVAVGATSCNKNYYTSKAKGNDCGCPSQRQ*
Ga0157310_1007706513300012916SoilMKRLNKIVFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0164309_1085414023300012984SoilMTRLNKIVFAVLLIVAVGASSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0163162_1294862923300013306Switchgrass RhizosphereMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNK
Ga0157380_1065700713300014326Switchgrass RhizosphereNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0157376_1145736423300014969Miscanthus RhizosphereMKRLNKIVFAALLIIAIGAASCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0173483_1084652413300015077SoilIIFAVLLLVAVGAISCSKNVYTSKAKGNDCGCPNKKGMVGY*
Ga0132258_1275878233300015371Arabidopsis RhizosphereMKRLNKIVFAALLIIAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0132255_10191686023300015374Arabidopsis RhizosphereMTRLNKIVFAVLLIVAVGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY*
Ga0184634_1008812123300018031Groundwater SedimentMKRLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184620_1012831123300018051Groundwater SedimentMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184611_116515123300018067Groundwater SedimentMTRLNKIIFAVLLLVAVGTASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184635_1019045123300018072Groundwater SedimentMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184624_1004148123300018073Groundwater SedimentMKRLNKIFFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184639_1020919313300018082Groundwater SedimentMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGND
Ga0184628_1013858923300018083Groundwater SedimentMKRLNKIVLAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0184628_1036768133300018083Groundwater SedimentMTRLNKIVFAALLIIAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY
Ga0184629_1045141523300018084Groundwater SedimentMTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY
Ga0184629_1045545523300018084Groundwater SedimentMIKKYKIILVLFFVAMAAAGCQKNYYSGKAKSSDCGCPNK
Ga0190268_1108691423300018466SoilMARLNKIVFALFLIGIIATGCQKNFYTNKAKNNDCGCPNKKGMVGY
Ga0190274_1002150143300018476SoilMKRLNKIVLAALLIVAVGAVSCSKNYYTSKSRGNDCGCPNKKGMVGY
Ga0190274_1367623413300018476SoilMTRLNKIVFAVLLIVAVGAMGCSKNVYTSKSKGNDCGCPNKKGMVGY
Ga0184647_147828113300019263Groundwater SedimentNKIVFAALLIIAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY
Ga0173481_1039407213300019356SoilMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGM
Ga0173482_1020522723300019361SoilMKRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0173479_1000922023300019362SoilMTRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMVGY
Ga0193741_101233433300019884SoilMARFNKIVFALFLIGVIATGCQKNYYTSKAKNNDCGCPNKKGMAGY
Ga0193738_100134023300020020SoilMTRLNKIVFAALLIVAVGAMSCSKNYYTSKSKGNDCGCPNKKGMVGY
Ga0212128_10000604133300022563Thermal SpringsMTRVKKMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY
Ga0222622_1001267433300022756Groundwater SedimentMTRLNKIIFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0222622_1061273733300022756Groundwater SedimentLFMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0247781_109307013300022896Plant LitterMKRLNKIFFAVILIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0247783_111610923300022911Plant LitterMKRLNKIVFAVLLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0247797_102807623300023057SoilMTRLNKIVFAVLLIVAVGATGCSKNYYTSKSKGNDCGCPNKKGMV
Ga0247752_108426233300023071SoilRLNKIFLAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0247798_104959123300023260SoilMKRLNKIFFAVIFIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0207656_1023667323300025321Corn RhizosphereMTRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0210138_101818813300025580Natural And Restored WetlandsNKIVFAVLLIVAVGATSCSKNVYTSKAKGNDCGCPNKKGMVGY
Ga0209497_100413433300025768Thermal SpringsMALALILTAAVLAAGCQRNYYTSKAKSNDCGCPAKKGMVGY
Ga0207685_1003484733300025905Corn, Switchgrass And Miscanthus RhizosphereMTRLNKIVFALLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0207643_1031178223300025908Miscanthus RhizosphereMTRLNKIMFAVLFIIAVGAVGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0207646_1089457523300025922Corn, Switchgrass And Miscanthus RhizosphereMIRLNKILLALFFMGVLLAGCQKNYYTSKAKGSDCGCPNKKGMAGY
Ga0207701_1023619313300025930Corn, Switchgrass And Miscanthus RhizosphereMTRLNKIVFAVLLVVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0207691_1074567413300025940Miscanthus RhizosphereMKRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMV
Ga0207712_1007787243300025961Switchgrass RhizosphereMTRLNKIVFAVLLIVAVGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0207712_1029679533300025961Switchgrass RhizosphereMTKLKKILLALFFIGVVLTGCQKNYYTSKAKSSDCGCPNKKGMAGY
Ga0207676_1065824213300026095Switchgrass RhizosphereMTRLNKIVFAVLLLVAVGAASCNKNYYTSKAKGNDCGCPNKKG
Ga0207675_10046347023300026118Switchgrass RhizosphereMKRLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMAGY
Ga0209850_100265223300026931SandMNRLNKIVFVIVLLALLGTGCQKNYYSGKAKSTDCGCPNKKGMVGY
Ga0209464_1003409423300027778Wetland SedimentMIRLNRIIFGLFIIAIIAVGCNKNVYTSKAKNNDCGCPNKKGMVGY
Ga0209481_1002018123300027880Populus RhizosphereMVKLNKIVLALFLIGIIATGCQKNYYTSKAKNNDCGCPNKKGMAGY
Ga0209486_1021265413300027886Agricultural SoilMIRLNRILFALFLIAIVGMGCQKNYYTSKAKNSDCGCPNKKG
Ga0207428_1023998333300027907Populus RhizosphereMTRLNKIVFAVLLIVAVGAMGCSKNYYTSKSKGNDCGCPNKKGMVGY
Ga0268264_1089794923300028381Switchgrass RhizosphereMTRISKILLALFFIGVLAAGCNKNYYTSKAKGNDCGCPNKKGMAGY
Ga0307505_1054083233300031455SoilTEFMLKKSNILFILLFVSLVALSCQKNYYSGKAKNSDCGCPAKKGMVGY
Ga0310892_1052053623300031858SoilMIRLNKIVFAVLLIIAVGAMSCSKNVYTSKAKGNDCGCPNKKGMAGY
Ga0310885_1006813433300031943SoilLNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0307409_10262945423300031995RhizosphereMKRLNKIVFAALLIVAVGAASCSKNYYTSKAKGSDCGCPNKKGMVGY
Ga0310895_1041737213300032122SoilNKIVFAVLLIVAVGAVSCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0310895_1078822913300032122SoilMRLNKIFFAALLIVAVGAAGCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0307472_10098446823300032205Hardwood Forest SoilMKRLNKIVFAALLIVAFGAASCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0310810_1063691323300033412SoilMTRLNKIVFAVLIIVAAGAMSCNKNYYTSKAKGNDCGCPNKKGMVGY
Ga0314798_160559_322_4653300034673SoilMKRLNKIFFAVLLIVAVGATSCNKNYYTSKAKGNDCGCPNKKGMVGY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.