NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044098

Metagenome / Metatranscriptome Family F044098

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044098
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 40 residues
Representative Sequence MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL
Number of Associated Samples 112
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.71 %
% of genes near scaffold ends (potentially truncated) 25.16 %
% of genes from short scaffolds (< 2000 bps) 81.29 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.903 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.742 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.323 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF13545HTH_Crp_2 17.42
PF00027cNMP_binding 17.42
PF00072Response_reg 1.94
PF00011HSP20 1.29
PF13478XdhC_C 0.65
PF04041Glyco_hydro_130 0.65
PF13502AsmA_2 0.65
PF07690MFS_1 0.65
PF04366Ysc84 0.65
PF00196GerE 0.65
PF02371Transposase_20 0.65
PF12779WXXGXW 0.65
PF14534DUF4440 0.65
PF00005ABC_tran 0.65
PF04542Sigma70_r2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.29
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.65
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.65
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.65
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.65
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.65
COG3547TransposaseMobilome: prophages, transposons [X] 0.65
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.90 %
UnclassifiedrootN/A7.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT02FI15MNot Available609Open in IMG/M
3300004114|Ga0062593_100213113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1553Open in IMG/M
3300004114|Ga0062593_100829576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300004479|Ga0062595_100341107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1037Open in IMG/M
3300004479|Ga0062595_100932890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300004479|Ga0062595_101647977All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300005166|Ga0066674_10064951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1665Open in IMG/M
3300005167|Ga0066672_10134074All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300005172|Ga0066683_10136265All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1503Open in IMG/M
3300005172|Ga0066683_10408013All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300005174|Ga0066680_10137855All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300005175|Ga0066673_10172523All Organisms → cellular organisms → Bacteria → Acidobacteria1218Open in IMG/M
3300005175|Ga0066673_10214380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1104Open in IMG/M
3300005176|Ga0066679_10034640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2810Open in IMG/M
3300005177|Ga0066690_10283041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300005178|Ga0066688_10784177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300005179|Ga0066684_10051619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2359Open in IMG/M
3300005179|Ga0066684_11009168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300005180|Ga0066685_10168613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1495Open in IMG/M
3300005187|Ga0066675_10860366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300005329|Ga0070683_100094698All Organisms → cellular organisms → Bacteria2807Open in IMG/M
3300005329|Ga0070683_102033325All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300005336|Ga0070680_100057614All Organisms → cellular organisms → Bacteria3176Open in IMG/M
3300005337|Ga0070682_101371227All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300005341|Ga0070691_10533436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300005365|Ga0070688_100602057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300005434|Ga0070709_10902944All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300005434|Ga0070709_11245514Not Available599Open in IMG/M
3300005435|Ga0070714_100144053All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300005435|Ga0070714_100541062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1114Open in IMG/M
3300005435|Ga0070714_100702146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium976Open in IMG/M
3300005436|Ga0070713_100027539All Organisms → cellular organisms → Bacteria4475Open in IMG/M
3300005436|Ga0070713_100285702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1515Open in IMG/M
3300005436|Ga0070713_100431030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1235Open in IMG/M
3300005436|Ga0070713_101315138All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300005436|Ga0070713_101752530All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005437|Ga0070710_10109428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1658Open in IMG/M
3300005439|Ga0070711_101370959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300005445|Ga0070708_100027716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4864Open in IMG/M
3300005456|Ga0070678_101685974Not Available596Open in IMG/M
3300005529|Ga0070741_10487177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300005542|Ga0070732_10000090All Organisms → cellular organisms → Bacteria84971Open in IMG/M
3300005542|Ga0070732_10012870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4622Open in IMG/M
3300005542|Ga0070732_10045757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2522Open in IMG/M
3300005542|Ga0070732_10239997All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300005542|Ga0070732_10784348Not Available581Open in IMG/M
3300005547|Ga0070693_101449797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300005552|Ga0066701_10136583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1466Open in IMG/M
3300005556|Ga0066707_10047306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2477Open in IMG/M
3300005559|Ga0066700_10704225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300005560|Ga0066670_10076129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1819Open in IMG/M
3300005560|Ga0066670_10481861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300005568|Ga0066703_10168086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1323Open in IMG/M
3300005569|Ga0066705_10862899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300005614|Ga0068856_101416021All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005834|Ga0068851_10291533All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300006028|Ga0070717_10001332All Organisms → cellular organisms → Bacteria16951Open in IMG/M
3300006028|Ga0070717_10223827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1654Open in IMG/M
3300006028|Ga0070717_11398132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300006028|Ga0070717_11994257All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300006173|Ga0070716_101109318Not Available631Open in IMG/M
3300006175|Ga0070712_100775991Not Available821Open in IMG/M
3300006175|Ga0070712_100790541All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300006755|Ga0079222_11667773Not Available609Open in IMG/M
3300006794|Ga0066658_10295767All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006796|Ga0066665_10211179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1513Open in IMG/M
3300006797|Ga0066659_10176417All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300006806|Ga0079220_10824891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300006854|Ga0075425_100037848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5375Open in IMG/M
3300006954|Ga0079219_10400123All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300009012|Ga0066710_103628799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300009093|Ga0105240_10056327All Organisms → cellular organisms → Bacteria4920Open in IMG/M
3300009162|Ga0075423_12581258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300009545|Ga0105237_12601383All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300010159|Ga0099796_10065966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1296Open in IMG/M
3300010371|Ga0134125_11114222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300010373|Ga0134128_11705158All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300010373|Ga0134128_13109064Not Available510Open in IMG/M
3300010375|Ga0105239_13499693All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300010396|Ga0134126_10104702All Organisms → cellular organisms → Bacteria3474Open in IMG/M
3300010396|Ga0134126_10414795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1562Open in IMG/M
3300010396|Ga0134126_10844200All Organisms → cellular organisms → Bacteria → Acidobacteria1033Open in IMG/M
3300010399|Ga0134127_13463886Not Available517Open in IMG/M
3300012198|Ga0137364_10224303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1383Open in IMG/M
3300012199|Ga0137383_10018391All Organisms → cellular organisms → Bacteria4814Open in IMG/M
3300012200|Ga0137382_10628960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300012201|Ga0137365_10208780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1458Open in IMG/M
3300012205|Ga0137362_11453174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300012208|Ga0137376_10578129All Organisms → cellular organisms → Bacteria → Acidobacteria973Open in IMG/M
3300012210|Ga0137378_10353676All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300012210|Ga0137378_11119644All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300012285|Ga0137370_10303194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300012350|Ga0137372_10081617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2750Open in IMG/M
3300012350|Ga0137372_10857332All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300012359|Ga0137385_11083862All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012363|Ga0137390_10308598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1564Open in IMG/M
3300012363|Ga0137390_11069380All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012371|Ga0134022_1037219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300012951|Ga0164300_10743132All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300012957|Ga0164303_10076302All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300013296|Ga0157374_10735359All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300013296|Ga0157374_12401369All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300013296|Ga0157374_12564633All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300013307|Ga0157372_10043550All Organisms → cellular organisms → Bacteria4970Open in IMG/M
3300013307|Ga0157372_10410246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1579Open in IMG/M
3300013307|Ga0157372_11575781All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300015261|Ga0182006_1179100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300017656|Ga0134112_10448067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300017994|Ga0187822_10036709All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300018431|Ga0066655_10096843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1645Open in IMG/M
3300018433|Ga0066667_10387871All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300018433|Ga0066667_10474869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300018433|Ga0066667_11573634All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300018468|Ga0066662_10012596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4474Open in IMG/M
3300018482|Ga0066669_10584665All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300019870|Ga0193746_1001243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1962Open in IMG/M
3300019877|Ga0193722_1038334All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300021445|Ga0182009_10007452All Organisms → cellular organisms → Bacteria3626Open in IMG/M
3300025905|Ga0207685_10129748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300025906|Ga0207699_11156911Not Available573Open in IMG/M
3300025911|Ga0207654_10083600All Organisms → cellular organisms → Bacteria → Acidobacteria1928Open in IMG/M
3300025913|Ga0207695_10056797All Organisms → cellular organisms → Bacteria4071Open in IMG/M
3300025915|Ga0207693_10322999All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300025915|Ga0207693_10723065All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300025916|Ga0207663_11209326All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300025917|Ga0207660_10821619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300025922|Ga0207646_10051071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3700Open in IMG/M
3300025922|Ga0207646_11739271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300025927|Ga0207687_11402845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300025928|Ga0207700_10025061All Organisms → cellular organisms → Bacteria4136Open in IMG/M
3300025928|Ga0207700_11581296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300025929|Ga0207664_10669075All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300025938|Ga0207704_10867300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300025939|Ga0207665_10780645Not Available754Open in IMG/M
3300025939|Ga0207665_11313249All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300025949|Ga0207667_10381616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1436Open in IMG/M
3300026078|Ga0207702_11036053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300026088|Ga0207641_10315319All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300026326|Ga0209801_1304078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300026327|Ga0209266_1056216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1905Open in IMG/M
3300026331|Ga0209267_1030767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2569Open in IMG/M
3300026332|Ga0209803_1191307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300026335|Ga0209804_1212532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300026538|Ga0209056_10008780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium10357Open in IMG/M
3300026540|Ga0209376_1336583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300026550|Ga0209474_10013166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6597Open in IMG/M
3300026550|Ga0209474_10567864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300026853|Ga0207443_1012668All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300027842|Ga0209580_10000007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae613108Open in IMG/M
3300027842|Ga0209580_10006746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4908Open in IMG/M
3300027842|Ga0209580_10030472All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2448Open in IMG/M
3300027842|Ga0209580_10383828All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300031057|Ga0170834_111244168All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300031231|Ga0170824_105404659All Organisms → cellular organisms → Bacteria → Acidobacteria1632Open in IMG/M
3300033475|Ga0310811_10601469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1105Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere19.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil6.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.29%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.29%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012371Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026853Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_040966302170459016Switchgrass, Maize And Mischanthus LitterMHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP
Ga0062593_10021311333300004114SoilMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0062593_10082957623300004114SoilMHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS*
Ga0062595_10034110723300004479SoilMHPEELMKPDLLSEIVLLTFSTLILAALLLFVTTSLARF*
Ga0062595_10093289023300004479SoilMHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0062595_10164797723300004479SoilMHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS*
Ga0066674_1006495123300005166SoilMHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARF*
Ga0066672_1013407423300005167SoilMHPEELMKPDLLSEVVLLTFGTLILASLVLFVTITLTRL*
Ga0066683_1013626513300005172SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066683_1040801323300005172SoilMHPQELLKPDLLSEFVLLTFGTLVLASLVLFVTTTLARF*
Ga0066680_1013785533300005174SoilMHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARL*
Ga0066673_1017252323300005175SoilMRSNELMKPDLLSEIVLLTFCALILASLVLFVMTTLAQS*
Ga0066673_1021438013300005175SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL*
Ga0066679_1003464013300005176SoilMHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL*
Ga0066690_1028304123300005177SoilMHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF*
Ga0066688_1078417723300005178SoilMHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLARF*
Ga0066684_1005161923300005179SoilMRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS*
Ga0066684_1100916823300005179SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLTQL*
Ga0066685_1016861323300005180SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF*
Ga0066675_1086036613300005187SoilANRGEQMHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP*
Ga0070683_10009469843300005329Corn RhizosphereMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS*
Ga0070683_10203332513300005329Corn RhizosphereMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0070680_10005761423300005336Corn RhizosphereMHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP*
Ga0070682_10137122723300005337Corn RhizosphereMHPEELMKPDLLSEVVLFAFGTMVLTSLVLFVMSTLARS*
Ga0070691_1053343613300005341Corn, Switchgrass And Miscanthus RhizosphereRRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS*
Ga0070688_10060205733300005365Switchgrass RhizosphereMHPKELMKPDLVSEMVLLTFGTLLSSSLVWFVVAALTRP*
Ga0070709_1090294423300005434Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEIVLLAFGTLVLTSLVLFAITTLARS*
Ga0070709_1124551413300005434Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEVVLLAFGALVLTSFVPCVIRTFART*
Ga0070714_10014405343300005435Agricultural SoilMHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTFARS*
Ga0070714_10054106213300005435Agricultural SoilMHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA*
Ga0070714_10070214623300005435Agricultural SoilMHPEELMKPDLLSEIVLMTLVTLVLSSLVWFAMAAFARP*
Ga0070713_10002753943300005436Corn, Switchgrass And Miscanthus RhizosphereMHQEEIMKPDLLSEIVLITFGTLMLSSLVWFAMAAFARP*
Ga0070713_10028570223300005436Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTLARS*
Ga0070713_10043103033300005436Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEIVLMTLGTLILSSLVWFAMAAFARP*
Ga0070713_10131513823300005436Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS*
Ga0070713_10175253023300005436Corn, Switchgrass And Miscanthus RhizosphereMHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARP*
Ga0070710_1010942843300005437Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEVVLLAFGTLVLTSLVLFAITTLARS*
Ga0070711_10137095913300005439Corn, Switchgrass And Miscanthus RhizosphereQFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP*
Ga0070708_10002771623300005445Corn, Switchgrass And Miscanthus RhizosphereMHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS*
Ga0070678_10168597413300005456Miscanthus RhizosphereVIRRINIHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS
Ga0070741_1048717713300005529Surface SoilMHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0070732_1000009063300005542Surface SoilMHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP*
Ga0070732_1001287023300005542Surface SoilMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS*
Ga0070732_1004575733300005542Surface SoilMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL*
Ga0070732_1023999723300005542Surface SoilMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALL*
Ga0070732_1078434813300005542Surface SoilMHPEELMKPDLLSEIVLLTFCTLILGSVILFFATTLVLS*
Ga0070693_10144979713300005547Corn, Switchgrass And Miscanthus RhizosphereKGTDMHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMSTFARS*
Ga0066701_1013658333300005552SoilELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL*
Ga0066707_1004730633300005556SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL*
Ga0066700_1070422513300005559SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066670_1007612933300005560SoilMHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF*
Ga0066670_1048186123300005560SoilMHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL*
Ga0066703_1016808623300005568SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLSQL*
Ga0066705_1086289913300005569SoilMHPEDLMKPDLLSEIVLVTLATLTFSSLLLFVAAAVARP*
Ga0068856_10141602113300005614Corn RhizosphereMHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALAR
Ga0068851_1029153323300005834Corn RhizosphereMHPNELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0070717_1000133223300006028Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS*
Ga0070717_1022382743300006028Corn, Switchgrass And Miscanthus RhizosphereMHRADLLSPDVLSEIVLLAFGTLILASLVLFLVTVFCRV*
Ga0070717_1139813213300006028Corn, Switchgrass And Miscanthus RhizosphereRRNAMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS*
Ga0070717_1199425723300006028Corn, Switchgrass And Miscanthus RhizosphereMHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0070716_10110931813300006173Corn, Switchgrass And Miscanthus RhizosphereMHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART*
Ga0070712_10077599123300006175Corn, Switchgrass And Miscanthus RhizosphereMHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP*
Ga0070712_10079054123300006175Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS*
Ga0079222_1166777313300006755Agricultural SoilMHPEELMKPDLLSEIVLLTFGTLVLSSLVWFVVAVLART*
Ga0066658_1029576723300006794SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLTRL*
Ga0066665_1021117913300006796SoilELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066659_1017641723300006797SoilMHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLAR
Ga0079220_1082489123300006806Agricultural SoilMHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARP*
Ga0075425_10003784833300006854Populus RhizosphereMHPEELMKPDLLSEIVLLTFGTLIISSLALFVVAILARS*
Ga0079219_1040012323300006954Agricultural SoilMHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALAR
Ga0066710_10362879923300009012Grasslands SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL
Ga0105240_1005632753300009093Corn RhizosphereLATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0075423_1258125813300009162Populus RhizosphereAAPVIRRINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0105237_1260138313300009545Corn RhizosphereMHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI*
Ga0099796_1006596623300010159Vadose Zone SoilMHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTMLARF*
Ga0134125_1111422223300010371Terrestrial SoilMHPEELMKPDLLSEIVLLTFGTLVLSSLLWFVVGALARS*
Ga0134128_1170515823300010373Terrestrial SoilMHPEELMKPDLLSEIVLLTFGAAVLSSLVLFVAAALARI*
Ga0134128_1310906423300010373Terrestrial SoilMHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARL*
Ga0105239_1349969323300010375Corn RhizosphereLMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS*
Ga0134126_1010470223300010396Terrestrial SoilMHPEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS*
Ga0134126_1041479533300010396Terrestrial SoilHPEELMKPDLLSEVVLWTFGTLVLSSLLWFVVGALARS*
Ga0134126_1084420023300010396Terrestrial SoilVAADRRNDMHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI*
Ga0134127_1346388613300010399Terrestrial SoilMHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAE
Ga0137364_1022430333300012198Vadose Zone SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFATTTLARF*
Ga0137383_1001839123300012199Vadose Zone SoilMHPEELMKPDLLSEIVLLGFATLILASLVLFVATMLARS*
Ga0137382_1062896023300012200Vadose Zone SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLDRF*
Ga0137365_1020878023300012201Vadose Zone SoilMHPEELMKPDLLSEVVLFTFGTLILASLVLFVTLARF*
Ga0137362_1145317413300012205Vadose Zone SoilRRNDMHPEELMKPDLLSEFVLLTFGTLIVASLVLFITTTLARL*
Ga0137376_1057812923300012208Vadose Zone SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFATTTLARF*
Ga0137378_1035367623300012210Vadose Zone SoilMHPEELMKPDLLSEVVLLTFATLMVASLVLFVATMLARP*
Ga0137378_1111964423300012210Vadose Zone SoilMHPEELMKPDLLSEVVLFTFGTLILASLVLFVTTMLARF*
Ga0137370_1030319413300012285Vadose Zone SoilMHPEELMNPYLRSEFVLLTFGTLTLASLVVFVTTALARF*
Ga0137372_1008161723300012350Vadose Zone SoilMADAAKRNHMHPEEIMKPDLLSEIVLTTFGTLTLSFLVLFAMAAFDRP*
Ga0137372_1085733223300012350Vadose Zone SoilMHPEDVMKSDLFSEIVLLTFGTLTLSSLLLLFVAAALARS*
Ga0137385_1108386213300012359Vadose Zone SoilMHPEDLMKADLLSEIVLLTFAALICVSMVLFVATMVAQS*
Ga0137390_1030859813300012363Vadose Zone SoilMHPEELMKPALLSEIVLLFGTLIIASLVVFVATTLARS*
Ga0137390_1106938013300012363Vadose Zone SoilMHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLA
Ga0134022_103721923300012371Grasslands SoilMHPQELLKPDLLSEFVLLTFATLILASLVLFVTTTLARF*
Ga0164300_1074313213300012951SoilMHPEEIMKPDLLSEIVLSTFGTLVLSSLVLFVAAALART*
Ga0164303_1007630233300012957SoilMHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART*
Ga0157374_1073535923300013296Miscanthus RhizosphereMHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS*
Ga0157374_1240136913300013296Miscanthus RhizosphereRLATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0157374_1256463313300013296Miscanthus RhizosphereMHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAA
Ga0157372_1004355053300013307Corn RhizosphereMRPDQLMKPDLLSEIVLLSLGAFVLSSMVLFVAAVLARM*
Ga0157372_1041024613300013307Corn RhizospherePEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS*
Ga0157372_1157578113300013307Corn RhizosphereMHLEELMKPDLLSEIVLLTFGTLLLSSLVWFVVAALARP*
Ga0182006_117910013300015261RhizosphereNNMHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0134112_1044806723300017656Grasslands SoilRNDMHPEELMKPDLLSEFVLLTFGTLVLASLVLFLTTTLTRL
Ga0187822_1003670923300017994Freshwater SedimentMHPEELMKPDLLSEIVLFTFGTLLLSSLVWFVVEALARP
Ga0066655_1009684313300018431Grasslands SoilMHPEELLKPDLLSEVVLFTFGTLILASLVLFVTTTLARF
Ga0066667_1038787113300018433Grasslands SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTL
Ga0066667_1047486923300018433Grasslands SoilMTDARRNDMHPEEIMKPDLLSEIVLTTFGTLTLSVLVLFAMAAFARR
Ga0066667_1157363423300018433Grasslands SoilMHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF
Ga0066662_1001259623300018468Grasslands SoilMHPEEIMKPDLLSEIVLTPFGTLTLSFLVLFAIAAFARS
Ga0066669_1058466523300018482Grasslands SoilMHPQELLKPDLLSEFVLLTFGALILASFVLFTTTMLARL
Ga0193746_100124323300019870SoilMRNYMHPEEIMKPDLLSEVVLLAFGTLILASLLLFLTLARF
Ga0193722_103833423300019877SoilMHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP
Ga0182009_1000745233300021445SoilMHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARA
Ga0207685_1012974823300025905Corn, Switchgrass And Miscanthus RhizospherePEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS
Ga0207699_1115691123300025906Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEVVLLAFGALVLTSLVLFVMTTFARS
Ga0207654_1008360053300025911Corn RhizosphereELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS
Ga0207695_1005679743300025913Corn RhizosphereMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA
Ga0207693_1032299913300025915Corn, Switchgrass And Miscanthus RhizosphereVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP
Ga0207693_1072306523300025915Corn, Switchgrass And Miscanthus RhizosphereMHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP
Ga0207663_1120932613300025916Corn, Switchgrass And Miscanthus RhizosphereMAELRLEPEHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS
Ga0207660_1082161923300025917Corn RhizosphereVIRRDNMHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS
Ga0207646_1005107123300025922Corn, Switchgrass And Miscanthus RhizosphereMHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS
Ga0207646_1173927113300025922Corn, Switchgrass And Miscanthus RhizosphereEELMKADLLSEIVLLTFGTLILASLVLFVATMLARS
Ga0207687_1140284523300025927Miscanthus RhizosphereRRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS
Ga0207700_1002506143300025928Corn, Switchgrass And Miscanthus RhizosphereMHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS
Ga0207700_1158129623300025928Corn, Switchgrass And Miscanthus RhizospherePAFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP
Ga0207664_1066907523300025929Agricultural SoilMHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA
Ga0207704_1086730033300025938Miscanthus RhizosphereRINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS
Ga0207665_1078064513300025939Corn, Switchgrass And Miscanthus RhizosphereMHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART
Ga0207665_1131324923300025939Corn, Switchgrass And Miscanthus RhizosphereMHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART
Ga0207667_1038161613300025949Corn RhizosphereTGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA
Ga0207702_1103605313300026078Corn RhizosphereAWRSNMHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS
Ga0207641_1031531933300026088Switchgrass RhizosphereMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARSSRA
Ga0209801_130407823300026326SoilAVAARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209266_105621633300026327SoilMHPQELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL
Ga0209267_103076743300026331SoilMHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL
Ga0209803_119130713300026332SoilARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209804_121253223300026335SoilMHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF
Ga0209056_1000878053300026538SoilMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209376_133658323300026540SoilMHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF
Ga0209474_1001316623300026550SoilMRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS
Ga0209474_1056786423300026550SoilMHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL
Ga0207443_101266823300026853SoilGLAPVTRRNNMHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS
Ga0209580_100000074613300027842Surface SoilMHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP
Ga0209580_1000674623300027842Surface SoilMHPEELMKPDLLSEIVLLTFATIILASVLLFFATTLVL
Ga0209580_1003047233300027842Surface SoilMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL
Ga0209580_1038382823300027842Surface SoilMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS
Ga0170834_11124416813300031057Forest SoilMHPEELMKPDLLSEVVLLAFGTLVLTSLVLCAMTMLARS
Ga0170824_10540465923300031231Forest SoilMHPEELMKPDLLSEVVLFAFGTLVLTSLVLFVITTLARS
Ga0310811_1060146923300033475SoilHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.