NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044139

Metagenome / Metatranscriptome Family F044139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044139
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 40 residues
Representative Sequence MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS
Number of Associated Samples 107
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.19 %
% of genes near scaffold ends (potentially truncated) 19.35 %
% of genes from short scaffolds (< 2000 bps) 78.06 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.484 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.839 % of family members)
Environment Ontology (ENVO) Unclassified
(24.516 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.065 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF10611DUF2469 25.81
PF03816LytR_cpsA_psr 19.35
PF13399LytR_C 12.90
PF01351RNase_HII 12.90
PF02021UPF0102 3.87
PF13530SCP2_2 2.58
PF10502Peptidase_S26 1.94
PF01245Ribosomal_L19 1.94
PF12840HTH_20 1.29
PF03572Peptidase_S41 0.65
PF01557FAA_hydrolase 0.65
PF05239PRC 0.65
PF14622Ribonucleas_3_3 0.65
PF00583Acetyltransf_1 0.65
PF13738Pyr_redox_3 0.65
PF07478Dala_Dala_lig_C 0.65
PF01746tRNA_m1G_MT 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG1316Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase)Cell wall/membrane/envelope biogenesis [M] 19.35
COG0164Ribonuclease HIIReplication, recombination and repair [L] 12.90
COG1039Ribonuclease HIIIReplication, recombination and repair [L] 12.90
COG0792Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 familyReplication, recombination and repair [L] 3.87
COG0335Ribosomal protein L19Translation, ribosomal structure and biogenesis [J] 1.94
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.48 %
UnclassifiedrootN/A24.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100590653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300002899|JGIcombinedJ43975_10054004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300003203|JGI25406J46586_10042147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1600Open in IMG/M
3300003203|JGI25406J46586_10104266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300003373|JGI25407J50210_10006448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2922Open in IMG/M
3300003373|JGI25407J50210_10050267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300003373|JGI25407J50210_10108169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300003373|JGI25407J50210_10120766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300003373|JGI25407J50210_10143966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300003373|JGI25407J50210_10185605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300004016|Ga0058689_10039827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300004157|Ga0062590_102531146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300004463|Ga0063356_103026936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300004479|Ga0062595_102411698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300005436|Ga0070713_100223958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1707Open in IMG/M
3300005562|Ga0058697_10245752Not Available831Open in IMG/M
3300005562|Ga0058697_10302345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300005562|Ga0058697_10789653Not Available512Open in IMG/M
3300005937|Ga0081455_10039058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4198Open in IMG/M
3300005981|Ga0081538_10006598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10186Open in IMG/M
3300005981|Ga0081538_10013000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6623Open in IMG/M
3300005981|Ga0081538_10045989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2699Open in IMG/M
3300005981|Ga0081538_10076140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1816Open in IMG/M
3300005981|Ga0081538_10209231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300005981|Ga0081538_10306655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300005985|Ga0081539_10041512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2688Open in IMG/M
3300005985|Ga0081539_10099913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300005985|Ga0081539_10145781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1145Open in IMG/M
3300005985|Ga0081539_10222773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300006046|Ga0066652_100251174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1549Open in IMG/M
3300006169|Ga0082029_1176679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1806Open in IMG/M
3300006791|Ga0066653_10613806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300006844|Ga0075428_100932174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300006845|Ga0075421_100156685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2844Open in IMG/M
3300006845|Ga0075421_101238363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300006846|Ga0075430_100531795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300009094|Ga0111539_11463775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300009100|Ga0075418_10529565All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300009157|Ga0105092_10546591Not Available666Open in IMG/M
3300009789|Ga0126307_10056752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3066Open in IMG/M
3300009789|Ga0126307_10245339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300009789|Ga0126307_10594830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300009801|Ga0105056_1012352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300009803|Ga0105065_1007690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens1072Open in IMG/M
3300009806|Ga0105081_1066429Not Available557Open in IMG/M
3300009817|Ga0105062_1051898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300009837|Ga0105058_1017305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300009840|Ga0126313_10027591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3860Open in IMG/M
3300009840|Ga0126313_10854617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300010037|Ga0126304_10412679Not Available902Open in IMG/M
3300010038|Ga0126315_10058607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2112Open in IMG/M
3300010038|Ga0126315_10535847Not Available750Open in IMG/M
3300010041|Ga0126312_10141299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1667Open in IMG/M
3300010145|Ga0126321_1058099Not Available552Open in IMG/M
3300010145|Ga0126321_1299673All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300010166|Ga0126306_10004882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8030Open in IMG/M
3300010329|Ga0134111_10155087Not Available908Open in IMG/M
3300010362|Ga0126377_10000148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia38254Open in IMG/M
3300010999|Ga0138505_100072127Not Available512Open in IMG/M
3300011000|Ga0138513_100026755Not Available822Open in IMG/M
3300012021|Ga0120192_10033346All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300012201|Ga0137365_10125516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1929Open in IMG/M
3300012204|Ga0137374_10001117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia29829Open in IMG/M
3300012204|Ga0137374_10012272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9992Open in IMG/M
3300012204|Ga0137374_10014529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9110Open in IMG/M
3300012204|Ga0137374_10043964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4690Open in IMG/M
3300012204|Ga0137374_10054203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4095Open in IMG/M
3300012204|Ga0137374_10074916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3311Open in IMG/M
3300012204|Ga0137374_10157785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2016Open in IMG/M
3300012204|Ga0137374_10178833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1855Open in IMG/M
3300012204|Ga0137374_10477975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300012206|Ga0137380_10427304Not Available1174Open in IMG/M
3300012350|Ga0137372_10129023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2086Open in IMG/M
3300012350|Ga0137372_10515879Not Available887Open in IMG/M
3300012353|Ga0137367_11154535Not Available520Open in IMG/M
3300012354|Ga0137366_10083845All Organisms → cellular organisms → Bacteria2424Open in IMG/M
3300012354|Ga0137366_10102407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2169Open in IMG/M
3300012354|Ga0137366_10379803All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300012354|Ga0137366_11228535Not Available508Open in IMG/M
3300012355|Ga0137369_10134725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1979Open in IMG/M
3300012356|Ga0137371_10045414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3393Open in IMG/M
3300012360|Ga0137375_10692891All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300012529|Ga0136630_1349460Not Available527Open in IMG/M
3300013772|Ga0120158_10294663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae788Open in IMG/M
3300014488|Ga0182001_10135537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300014965|Ga0120193_10006837Not Available976Open in IMG/M
3300017654|Ga0134069_1221127Not Available651Open in IMG/M
3300017965|Ga0190266_10254873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
3300017997|Ga0184610_1003845Not Available3486Open in IMG/M
3300017997|Ga0184610_1326108Not Available503Open in IMG/M
3300018027|Ga0184605_10114566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens1197Open in IMG/M
3300018028|Ga0184608_10173930Not Available937Open in IMG/M
3300018028|Ga0184608_10494434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300018052|Ga0184638_1155552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300018052|Ga0184638_1281090Not Available566Open in IMG/M
3300018056|Ga0184623_10199483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300018063|Ga0184637_10000020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria100137Open in IMG/M
3300018071|Ga0184618_10227957All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300018074|Ga0184640_10150910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1036Open in IMG/M
3300018075|Ga0184632_10158633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300018076|Ga0184609_10119585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens1196Open in IMG/M
3300018078|Ga0184612_10076595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300018422|Ga0190265_10357701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1548Open in IMG/M
3300018422|Ga0190265_10847616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens1037Open in IMG/M
3300018432|Ga0190275_10355093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens1459Open in IMG/M
3300018465|Ga0190269_11957373Not Available508Open in IMG/M
3300019254|Ga0184641_1097850Not Available970Open in IMG/M
3300019377|Ga0190264_10079209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300019767|Ga0190267_10179380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium965Open in IMG/M
3300019767|Ga0190267_11143031Not Available564Open in IMG/M
3300019867|Ga0193704_1020593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1340Open in IMG/M
3300021073|Ga0210378_10013768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3342Open in IMG/M
3300021080|Ga0210382_10266056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300021510|Ga0222621_1011597All Organisms → cellular organisms → Bacteria1682Open in IMG/M
3300025928|Ga0207700_10308706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora sagamiensis1368Open in IMG/M
3300026673|Ga0208847_102321Not Available547Open in IMG/M
3300027056|Ga0209879_1016679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300027163|Ga0209878_1025617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300027379|Ga0209842_1015573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1490Open in IMG/M
3300027523|Ga0208890_1087372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300027750|Ga0209461_10047061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300027750|Ga0209461_10125010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK606Open in IMG/M
3300027909|Ga0209382_10401055All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300027909|Ga0209382_11882812Not Available579Open in IMG/M
3300027952|Ga0209889_1004319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3909Open in IMG/M
3300028704|Ga0307321_1131714Not Available523Open in IMG/M
3300028711|Ga0307293_10024081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1812Open in IMG/M
3300028711|Ga0307293_10102162Not Available909Open in IMG/M
3300028719|Ga0307301_10282345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300028744|Ga0307318_10039829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1544Open in IMG/M
3300028771|Ga0307320_10305923Not Available631Open in IMG/M
3300028799|Ga0307284_10333995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300028824|Ga0307310_10157099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300028828|Ga0307312_10129394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1588Open in IMG/M
3300028878|Ga0307278_10000454All Organisms → cellular organisms → Bacteria20642Open in IMG/M
3300028878|Ga0307278_10001998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10039Open in IMG/M
3300028881|Ga0307277_10498045Not Available546Open in IMG/M
3300030336|Ga0247826_10244408All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300030496|Ga0268240_10169944Not Available546Open in IMG/M
3300030499|Ga0268259_10005472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2155Open in IMG/M
3300030499|Ga0268259_10183223Not Available512Open in IMG/M
3300030830|Ga0308205_1045101Not Available575Open in IMG/M
3300031229|Ga0299913_10584605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1100Open in IMG/M
3300031421|Ga0308194_10053828Not Available1038Open in IMG/M
3300031731|Ga0307405_10039536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2851Open in IMG/M
3300031731|Ga0307405_10064331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2331Open in IMG/M
3300031824|Ga0307413_10872478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300031901|Ga0307406_11632494Not Available570Open in IMG/M
3300032002|Ga0307416_100974429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens950Open in IMG/M
3300032002|Ga0307416_102881900Not Available575Open in IMG/M
3300032002|Ga0307416_103388291Not Available533Open in IMG/M
3300032159|Ga0268251_10008392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2816Open in IMG/M
3300032159|Ga0268251_10135571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300034026|Ga0334946_026142Not Available964Open in IMG/M
3300034172|Ga0334913_008690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.03%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere7.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.45%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.16%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere4.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.52%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave3.23%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.58%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.29%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.29%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.29%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.65%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.65%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026673Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1116 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300034026Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMSEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10059065323300000956SoilVGFNATRRYRDKKTIDIAILLAAVVIILGLVGWVLAAGGS*
JGIcombinedJ43975_1005400423300002899SoilMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGS*
JGI25406J46586_1004214713300003203Tabebuia Heterophylla RhizosphereSIMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT*
JGI25406J46586_1010426633300003203Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTIDLAILIAAIVIIAGLLGWVFAAGGR*
JGI25407J50210_1000644853300003373Tabebuia Heterophylla RhizosphereMGFNATRRYRDRKTVDIALLIAAVLIVLALLAWVFAAGGS*
JGI25407J50210_1005026723300003373Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGA*
JGI25407J50210_1010816923300003373Tabebuia Heterophylla RhizosphereMGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGN*
JGI25407J50210_1012076623300003373Tabebuia Heterophylla RhizosphereVGFNATRRYRDRKTVDIALLVAAVAIVIGLLAWVFSAGGS*
JGI25407J50210_1014396623300003373Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS*
JGI25407J50210_1018560523300003373Tabebuia Heterophylla RhizosphereMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS*
Ga0058689_1003982713300004016AgaveVGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR*
Ga0062590_10253114623300004157SoilMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT*
Ga0063356_10302693633300004463Arabidopsis Thaliana RhizosphereMGFNATRRYRDKKTVDIAILVAALVIIGGLLAWVLAAGGN*
Ga0062595_10241169813300004479SoilGFNATRRYRDKKTVDIALLAAAILIVIGLLAWVFAAGGS*
Ga0070713_10022395833300005436Corn, Switchgrass And Miscanthus RhizosphereVGFNATRRYRGKKTVDLAILIAAIVIVAVLVGWVLAAGGR*
Ga0058697_1024575223300005562AgaveGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR*
Ga0058697_1030234523300005562AgaveMGFNATRRYRDKKTVDIALLVAAIVIIIALLAWVFAAGGS*
Ga0058697_1078965323300005562AgaveMGFNATRRYRDKKTVDIALLVAAIVIVIALLGWVFAAGGS*
Ga0081455_1003905823300005937Tabebuia Heterophylla RhizosphereVLIEGGPVGFNATRRYRDKKTIDLAILVAAIVIVGLLVGWVLAAGGR*
Ga0081538_10006598153300005981Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS*
Ga0081538_1001300073300005981Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS*
Ga0081538_1004598943300005981Tabebuia Heterophylla RhizosphereMGFNATRRYRDKKTVDIALLVAAILIVLALLGWVFAAGGS*
Ga0081538_1007614023300005981Tabebuia Heterophylla RhizosphereVGFNATRRYRDRKTVDIALLVTAILIIVGLLAWVFAAGGS*
Ga0081538_1020923123300005981Tabebuia Heterophylla RhizosphereMGFNATRRYRDKKTVDIALLVAAVLIVLGLLAWVFAAGGN*
Ga0081538_1030665523300005981Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS*
Ga0081539_1004151243300005985Tabebuia Heterophylla RhizosphereIMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGS*
Ga0081539_1009991323300005985Tabebuia Heterophylla RhizosphereMGFNATRRYRDTKWVDIGLLIAAVVIIAALLAWVLLG*
Ga0081539_1014578113300005985Tabebuia Heterophylla RhizosphereMGFNATRRYRDKKTVDIALLVAAIVIVVALLGWVVAAGGS*
Ga0081539_1022277313300005985Tabebuia Heterophylla RhizosphereVGFNATRRYRDKKTVDLAILIAAIVIVALLVGWVLAAGGR*
Ga0066652_10025117423300006046SoilLGYNVTRRYRGKKSVDVAILVAALLIIGGLLAWVLAAGGH*
Ga0082029_117667923300006169Termite NestVSVGFNATRRYRDKKTVDIALLIAAVLIVLALLGWVFAAGGS*
Ga0066653_1061380613300006791SoilLGYNVTRRYRGKKSVDVAILVAALVIIGGLLAWVLAAGGH*
Ga0075428_10093217423300006844Populus RhizosphereMGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS*
Ga0075421_10015668533300006845Populus RhizosphereVGFNATRRYRDKKTIDLAILVSAIVIIAVLVGWVLAAGGR*
Ga0075421_10123836323300006845Populus RhizosphereVGFNATRRYRGKKTVDLAILISAIVIVTLLVGWVFAAGGR*
Ga0075430_10053179523300006846Populus RhizosphereGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS*
Ga0111539_1146377523300009094Populus RhizosphereGFNATRRYRDKKTVDIALLVAAIVIVIGLLAGVFSAGGS*
Ga0075418_1052956533300009100Populus RhizosphereMGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLAAGGN*
Ga0105092_1054659123300009157Freshwater SedimentGFNATRRYRDRKTVDIALLIAAVLIVLALLAWVFAAGGS*
Ga0126307_1005675253300009789Serpentine SoilFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT*
Ga0126307_1024533923300009789Serpentine SoilVGFNATRRYRDKKTVDIALLVAAILIVAALLAWVFAAGGT*
Ga0126307_1059483023300009789Serpentine SoilMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVLAAGGN*
Ga0105056_101235223300009801Groundwater SandVGFNATRRYRDKKTVDIVLLVVAIAIVIGLLAWVFSAGGS*
Ga0105065_100769013300009803Groundwater SandRRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS*
Ga0105081_106642913300009806Groundwater SandVGFNATRRYRDKKTVDIALLVAAVIIVAGLLAWVFAAGGR*
Ga0105062_105189823300009817Groundwater SandVGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVAAGGS*
Ga0105058_101730523300009837Groundwater SandFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS*
Ga0126313_1002759163300009840Serpentine SoilMGFNATRRYRDKKTVDIALLVAAVLIILALLAWVFAAGGS*
Ga0126313_1085461723300009840Serpentine SoilMGFNATRRYRDKKTVDIALLIAAILIVIALLAWVFAAGGT*
Ga0126304_1041267923300010037Serpentine SoilMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN*
Ga0126315_1005860723300010038Serpentine SoilMGFNATRRYRDKKTVDIALLVAAIIIVIALLAWVFAAGGS*
Ga0126315_1053584713300010038Serpentine SoilVGFNATRRYRDKKTVDIALLVAAVAIVIGLLAWVFSAGGS*
Ga0126312_1014129913300010041Serpentine SoilNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN*
Ga0126321_105809923300010145SoilVGFNATRRYRDKKTVDIALLVAAIVIVIALLAWVFSAGGS*
Ga0126321_129967323300010145SoilMGFNATRRYRDRKTVDVAILTAAVVIILCLLAWVFAAGGR*
Ga0126306_10004882103300010166Serpentine SoilMGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS*
Ga0134111_1015508723300010329Grasslands SoilVGFNATRRYRDKKTVDIALLVAAILIIIGLLAWVFSAGGS*
Ga0126377_1000014873300010362Tropical Forest SoilMGFNATRRYRDRKWVDIGLLIAAVLIVAALLSWVLTGW*
Ga0138505_10007212713300010999SoilMGFNATRRYRDKKTVDIALLVAAIVIVIALLAWVFDAGGS*
Ga0138513_10002675523300011000SoilMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN*
Ga0120192_1003334613300012021TerrestrialMVGFNATRRYRDRKTVDIALLVAAVAIVIGLLAWVFSAGGS*
Ga0137365_1012551623300012201Vadose Zone SoilMGFNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGGR*
Ga0137374_10001117233300012204Vadose Zone SoilVGFNATRRYRDKKTIDIAILLAAIVIIVGLLGWVFAAGGR*
Ga0137374_1001227283300012204Vadose Zone SoilMGFNATRRYRDKKTVDIAILVAALLIIGGLLAWVLAAGGN*
Ga0137374_1001452923300012204Vadose Zone SoilVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS*
Ga0137374_1004396453300012204Vadose Zone SoilVGFNATRRYRDKKTIDVAILLAAVVIIIGLLAWVFAAGGR*
Ga0137374_1005420333300012204Vadose Zone SoilVGFNATRRYRDKKTIDIAILLAAIVIIIGLLAWVFAAGGR*
Ga0137374_1007491623300012204Vadose Zone SoilVGFNATRRYRDKKTIDLAILIAAIVIVALLVGWVLAAGGR*
Ga0137374_1015778533300012204Vadose Zone SoilMGFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH*
Ga0137374_1017883313300012204Vadose Zone SoilVGFNATRRYRDKKTVDILILVAAIVIVSGLLVWVFAAGGR*
Ga0137374_1047797523300012204Vadose Zone SoilMGFNATRRYRDKKTVDIAILVAAAVIIGGLLAWVLAAGGR*
Ga0137380_1042730433300012206Vadose Zone SoilMGFNATRRYRDKKTVDIAILVAALVIVGGLLAWVLAAGGR*
Ga0137372_1012902323300012350Vadose Zone SoilVGFNATRRYRDKKTVDIAILLAAVVIIALLVGWVLAAGGR*
Ga0137372_1051587923300012350Vadose Zone SoilVGFNATRRYRDKKTVDLAILIAAIVIVAVLVGWVLAAGGR*
Ga0137367_1115453523300012353Vadose Zone SoilVGFNATRRYRDKKTTDLVILISAIVIVAVLVGWVL
Ga0137366_1008384543300012354Vadose Zone SoilFNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGGR*
Ga0137366_1010240713300012354Vadose Zone SoilMGFNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGG
Ga0137366_1037980323300012354Vadose Zone SoilMRFNATRRYRDKKTTDIAILVAALVIVAGLLLWVVAAGGH*
Ga0137366_1122853523300012354Vadose Zone SoilVGFNATRRYRDKKTTDLVILISAIVIVAVLVGWVLAAGGR*
Ga0137369_1013472523300012355Vadose Zone SoilVGFNATRRYRDRKTVDIALLVAAVIIVAGLLAWVFAAGGR*
Ga0137371_1004541443300012356Vadose Zone SoilMGFNATRRYRDKKTTDVAILVAALVIVAGLLGWVLAAGGH*
Ga0137375_1069289123300012360Vadose Zone SoilGFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH*
Ga0136630_134946023300012529Polar Desert SandMGFNATRRYRDSNVLDIVLLFVAEVTIGLLLAWASGVIL*
Ga0120158_1029466333300013772PermafrostVGFNATRRYRGPKTGDIALLIAGIIIIGGLLAWALTA*
Ga0182001_1013553723300014488SoilMGFNATRRYRDKKTVDIALLVAAILIILGLLAWVFAAGGN*
Ga0120193_1000683723300014965TerrestrialVGFNATRRYRDRKTVDIALLVVAVLIVAGLLAWVFAAGGQ*
Ga0134069_122112713300017654Grasslands SoilLGYNVTRRYRGKKSVDVAILVAALLIIGGLLAWVLAAGGH
Ga0190266_1025487323300017965SoilMGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS
Ga0184610_100384553300017997Groundwater SedimentMGFNATRRYRDKKTVDIAILVAAIVIIGGLLAWVLAAGGS
Ga0184610_132610823300017997Groundwater SedimentMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS
Ga0184605_1011456613300018027Groundwater SedimentTRRYRDKKTVDIALLVAALLIVLGLLAWVFAAGGN
Ga0184608_1017393033300018028Groundwater SedimentMGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGK
Ga0184608_1049443423300018028Groundwater SedimentMGFNATRRYRDKKAVDIALLVAAILIVLALLAWVFAAGGS
Ga0184638_115555223300018052Groundwater SedimentVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS
Ga0184638_128109023300018052Groundwater SedimentVGFNATRRYRDKKIVDLALLVAAIAIVIGLLAWVFAAGGS
Ga0184623_1019948313300018056Groundwater SedimentVGFNATRRYRDKKVVDIALLVAAILIILGLLTWVFAAGGS
Ga0184637_10000020403300018063Groundwater SedimentMGFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH
Ga0184618_1022795713300018071Groundwater SedimentLGFNATRRYRGKKTVDLAILISAIVIVAVLVGWVLAAGGR
Ga0184640_1015091023300018074Groundwater SedimentMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN
Ga0184632_1015863323300018075Groundwater SedimentMGFNATRRYRDKKVVDIALLVAAILIILGLLAWVFAAGGS
Ga0184609_1011958513300018076Groundwater SedimentVGFNATRRYRDRKTVDIALLVAAIAIVIGLLAWVVSAGGS
Ga0184612_1007659523300018078Groundwater SedimentMGFNATRRYRDKKTVDISLLVAAILIVLGLLAWVFAAGGS
Ga0190265_1035770123300018422SoilMGFNATRRYRDKKVVDIALLVAAVLIVLGLLAWVFAAGGS
Ga0190265_1084761623300018422SoilNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS
Ga0190275_1035509323300018432SoilMGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS
Ga0190269_1195737323300018465SoilASMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN
Ga0184641_109785033300019254Groundwater SedimentMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN
Ga0190264_1007920923300019377SoilVGFNATRRYRDKKVVDIALLVAAILIIVGLLTWVFAAGGS
Ga0190267_1017938033300019767SoilMGFNATRRYRDRKAVDIALLVAAILIVLALLAWVFAAGGS
Ga0190267_1114303123300019767SoilMGFNATRRYRDKKTVDIALLVAAVLIVLGLLAWVFAAGGS
Ga0193704_102059323300019867SoilMGFNATRRYRDKKVVDIALLVAAILIVLALLAWVFAAGGS
Ga0210378_1001376843300021073Groundwater SedimentVGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVSAGGS
Ga0210382_1026605623300021080Groundwater SedimentMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGS
Ga0222621_101159743300021510Groundwater SedimentMGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGN
Ga0207700_1030870633300025928Corn, Switchgrass And Miscanthus RhizosphereVGFNATRRYRGKKTVDLAILIAAIVIVAVLVGWVLAAGGR
Ga0208847_10232123300026673SoilVGFNATRRYRDKKTVDIALLVAAIVIVLALLAWVFAAGGN
Ga0209879_101667923300027056Groundwater SandVGFNATRRYRDRKTVDIALLVAAVIIVAGLLAWVFAAGGR
Ga0209878_102561723300027163Groundwater SandVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVVSAGGS
Ga0209842_101557323300027379Groundwater SandVGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVAAGGS
Ga0208890_108737223300027523SoilMGFNATRRYRDAKWVDIGILIAALVIIAGLLGWVLFG
Ga0209461_1004706113300027750AgaveVGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR
Ga0209461_1012501023300027750AgaveGTSMGFNATRRYRDKKTVDIALLAAAILIVLALLAWVFAAGGN
Ga0209382_1040105543300027909Populus RhizosphereVGFNATRRYRDKKTIDLAILVSAIVIIAVLVGWVLAAGGR
Ga0209382_1188281233300027909Populus RhizosphereMGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLA
Ga0209889_100431923300027952Groundwater SandVGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS
Ga0307321_113171423300028704SoilATRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGS
Ga0307293_1002408123300028711SoilATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS
Ga0307293_1010216223300028711SoilMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFA
Ga0307301_1028234523300028719SoilMGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLAAGGN
Ga0307318_1003982913300028744SoilRNGACMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN
Ga0307320_1030592313300028771SoilGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS
Ga0307284_1033399523300028799SoilMGYNVTRRYRDKKSVDVAILIAALLIIGGLLAWVLAAGGH
Ga0307310_1015709913300028824SoilGELTPMGFNATRRYRDKKTVDIAILLAAVVIIGALLTWVLAAGGR
Ga0307312_1012939443300028828SoilMGFNATRRYRGTKWVDIGLLVAALVIIAALLAWVLLG
Ga0307278_10000454213300028878SoilMGFNATRRYRDKKTVDIAILVAALVIIGGLLAWVLAAGGN
Ga0307278_10001998133300028878SoilMGFNATRRYRDKKPVDIAILVAAIVIIGGLVAWVLAAGGN
Ga0307277_1049804523300028881SoilMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT
Ga0247826_1024440833300030336SoilMGFNATRRYRDTKWVDIGILVAALVIIAGLLAWVLFG
Ga0268240_1016994413300030496SoilNATRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGS
Ga0268259_1000547213300030499AgaveMGFNATRRYRDKKTVDIALLAAAIVIIVALLAWVFAAGGS
Ga0268259_1018322323300030499AgaveMGFNATRRYRDKKTVDIALLVAAIVIIIALLAWVFAAGGS
Ga0308205_104510113300030830SoilMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAG
Ga0299913_1058460513300031229SoilVGFNATRRYRGPRTVDIAILVAGIVIIGGLLAWAFAG
Ga0308194_1005382813300031421SoilVGFNATRRYRGKKTVDLAILISAIVIVTVLVGWVFAAGGR
Ga0307405_1003953653300031731RhizosphereMGFNATRRYRDKKTVDIALLVAAVLIILALLAWVFAAGGS
Ga0307405_1006433133300031731RhizosphereVGFNATRRYRDKKTVDIALLVAAVAIVIGLLAWVFSAGGS
Ga0307413_1087247823300031824RhizosphereVGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS
Ga0307406_1163249423300031901RhizosphereMGFNATRRYRDKKTVDIALLIAAILIVIALLAWVFAAGGT
Ga0307416_10097442923300032002RhizosphereNATRRYRDKKTVDIALLVAAILIVVALLAWVFAAGGT
Ga0307416_10288190023300032002RhizosphereTRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGT
Ga0307416_10338829123300032002RhizosphereMGFNATRRYRDKKTVDIALLVAAILIVIALLTWVFAAGGN
Ga0268251_1000839243300032159AgaveMGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR
Ga0268251_1013557123300032159AgaveMGFNATRRYRDKKTVDIALLVAAIVIVIALLGWVFAAGGS
Ga0334946_026142_277_3993300034026Sub-Biocrust SoilMGFNATRRYRDKKTADIALLVAAILIVLALLGWVFAAGGS
Ga0334913_008690_2028_21503300034172Sub-Biocrust SoilVGFNATRRYRDKKTVDIALLVAAIVIVLGLLAWVFAAGGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.