Basic Information | |
---|---|
Family ID | F044174 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 155 |
Average Sequence Length | 44 residues |
Representative Sequence | TTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPRTKKAP |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 155 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.06 % |
% of genes from short scaffolds (< 2000 bps) | 91.61 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.065 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.839 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.258 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.968 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 155 Family Scaffolds |
---|---|---|
PF01904 | DUF72 | 60.65 |
PF10706 | Aminoglyc_resit | 7.74 |
PF14559 | TPR_19 | 5.16 |
PF05973 | Gp49 | 3.87 |
PF13545 | HTH_Crp_2 | 1.29 |
PF15937 | PrlF_antitoxin | 1.29 |
PF01590 | GAF | 1.29 |
PF01878 | EVE | 1.29 |
PF03683 | UPF0175 | 1.29 |
PF17186 | Lipocalin_9 | 0.65 |
PF13432 | TPR_16 | 0.65 |
PF02744 | GalP_UDP_tr_C | 0.65 |
PF00578 | AhpC-TSA | 0.65 |
PF16576 | HlyD_D23 | 0.65 |
PF09907 | HigB_toxin | 0.65 |
PF01850 | PIN | 0.65 |
PF02321 | OEP | 0.65 |
PF04679 | DNA_ligase_A_C | 0.65 |
PF02401 | LYTB | 0.65 |
PF07669 | Eco57I | 0.65 |
COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
---|---|---|---|
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 60.65 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 3.87 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 3.87 |
COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.29 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.29 |
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 1.29 |
COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.29 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 1.29 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.06 % |
Unclassified | root | N/A | 1.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100710640 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300002562|JGI25382J37095_10164190 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300002908|JGI25382J43887_10052972 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
3300002914|JGI25617J43924_10227621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300002914|JGI25617J43924_10304452 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005167|Ga0066672_10247674 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005180|Ga0066685_10412351 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300005537|Ga0070730_10064446 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300005537|Ga0070730_10447430 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300005540|Ga0066697_10827473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300005554|Ga0066661_10280169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300005556|Ga0066707_10471783 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005568|Ga0066703_10488498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300005576|Ga0066708_10401998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300005587|Ga0066654_10153063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
3300006032|Ga0066696_10939219 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006052|Ga0075029_100331528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300006163|Ga0070715_10236887 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300006174|Ga0075014_100195176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300006797|Ga0066659_10659051 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300007255|Ga0099791_10196854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300007265|Ga0099794_10548655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300009012|Ga0066710_100464736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1900 | Open in IMG/M |
3300009088|Ga0099830_10811471 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300009089|Ga0099828_10017803 | All Organisms → cellular organisms → Bacteria | 5474 | Open in IMG/M |
3300009137|Ga0066709_102031682 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300010043|Ga0126380_11003560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300010046|Ga0126384_10353136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
3300010321|Ga0134067_10018228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2085 | Open in IMG/M |
3300010326|Ga0134065_10049525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1290 | Open in IMG/M |
3300010362|Ga0126377_13008341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300010366|Ga0126379_10321598 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300010880|Ga0126350_11186789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2612 | Open in IMG/M |
3300011120|Ga0150983_13705761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300011269|Ga0137392_10216163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
3300011269|Ga0137392_10258712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
3300011269|Ga0137392_10899465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300011270|Ga0137391_10578826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 943 | Open in IMG/M |
3300011271|Ga0137393_11261158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300012096|Ga0137389_11011398 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012096|Ga0137389_11340926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300012189|Ga0137388_11913471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300012199|Ga0137383_10189134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1509 | Open in IMG/M |
3300012203|Ga0137399_11083287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300012205|Ga0137362_10452659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
3300012205|Ga0137362_11448638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300012349|Ga0137387_10433831 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300012350|Ga0137372_11100018 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300012351|Ga0137386_10324062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
3300012361|Ga0137360_10223642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
3300012361|Ga0137360_11129701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300012361|Ga0137360_11499875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300012363|Ga0137390_11296580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300012683|Ga0137398_10187036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1361 | Open in IMG/M |
3300012685|Ga0137397_10194689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
3300012685|Ga0137397_10286065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
3300012917|Ga0137395_10121724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1758 | Open in IMG/M |
3300012918|Ga0137396_10397995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300012918|Ga0137396_10632026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300012918|Ga0137396_11079181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300012925|Ga0137419_10180086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
3300012927|Ga0137416_10240272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
3300012927|Ga0137416_10354291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300012929|Ga0137404_11562184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300012944|Ga0137410_10178691 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300015051|Ga0137414_1113119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300015052|Ga0137411_1235054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300015054|Ga0137420_1113963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1932 | Open in IMG/M |
3300015054|Ga0137420_1159042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1944 | Open in IMG/M |
3300015054|Ga0137420_1277619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
3300015241|Ga0137418_10112101 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
3300015241|Ga0137418_10646864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
3300015241|Ga0137418_10844280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300015357|Ga0134072_10415954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300015358|Ga0134089_10317948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300016294|Ga0182041_10018221 | All Organisms → cellular organisms → Bacteria | 4223 | Open in IMG/M |
3300016357|Ga0182032_10205872 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300016357|Ga0182032_11766340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300016371|Ga0182034_10168352 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300016387|Ga0182040_11239441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300016387|Ga0182040_11263603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300016422|Ga0182039_10153332 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300017961|Ga0187778_10513329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300017999|Ga0187767_10130615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300018001|Ga0187815_10513903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300018088|Ga0187771_10196601 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300018090|Ga0187770_10295359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
3300018433|Ga0066667_11387660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300018482|Ga0066669_10589442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
3300020199|Ga0179592_10458416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300020579|Ga0210407_11036225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300020580|Ga0210403_10082654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2590 | Open in IMG/M |
3300020580|Ga0210403_11449898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300020581|Ga0210399_11297024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300020583|Ga0210401_10826725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300021170|Ga0210400_10193242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1652 | Open in IMG/M |
3300021171|Ga0210405_10999323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300021178|Ga0210408_10088007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2438 | Open in IMG/M |
3300021178|Ga0210408_10821470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300021178|Ga0210408_10958819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300021407|Ga0210383_11680017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300021432|Ga0210384_10267022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1540 | Open in IMG/M |
3300021432|Ga0210384_10341173 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300021477|Ga0210398_10790807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300021478|Ga0210402_11935972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300021559|Ga0210409_10483733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
3300021560|Ga0126371_11853286 | Not Available | 723 | Open in IMG/M |
3300022531|Ga0242660_1210637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300024330|Ga0137417_1001625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
3300024330|Ga0137417_1490986 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
3300025915|Ga0207693_10951457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300025922|Ga0207646_11487166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300026277|Ga0209350_1086934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300026296|Ga0209235_1191498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300026306|Ga0209468_1196760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300026334|Ga0209377_1195297 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300026475|Ga0257147_1001974 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
3300026514|Ga0257168_1034581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
3300026528|Ga0209378_1120454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
3300026532|Ga0209160_1198189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300026551|Ga0209648_10677547 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026551|Ga0209648_10823103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300026552|Ga0209577_10443701 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300026557|Ga0179587_10955747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300027460|Ga0207506_1015233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300027643|Ga0209076_1126484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300027671|Ga0209588_1246742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300027825|Ga0209039_10127981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
3300027846|Ga0209180_10517373 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300027846|Ga0209180_10537746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300027857|Ga0209166_10199425 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300027875|Ga0209283_10776627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300028536|Ga0137415_10338296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
3300028536|Ga0137415_10895335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300030945|Ga0075373_11019096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300030991|Ga0073994_11358417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300031543|Ga0318516_10431034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300031718|Ga0307474_11538621 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031754|Ga0307475_10651187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300031770|Ga0318521_10287790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300031797|Ga0318550_10132309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300031819|Ga0318568_10181037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
3300031823|Ga0307478_11294831 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031897|Ga0318520_10678346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300031954|Ga0306926_12032991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300031962|Ga0307479_10140991 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
3300031962|Ga0307479_10237086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1800 | Open in IMG/M |
3300032025|Ga0318507_10147019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300032039|Ga0318559_10067912 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300032051|Ga0318532_10152378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
3300032076|Ga0306924_12193066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300032180|Ga0307471_104233668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300032261|Ga0306920_104071110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.29% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1007106402 | 3300002245 | Forest Soil | IKTVFARLKEKGDLWADFWKRRQRLEDAIELLSRRMPSAAKKK* |
JGI25382J37095_101641902 | 3300002562 | Grasslands Soil | ETLNIETVFARLKDKGDLWGDFWKRRQRLEQAIELLSNRMPSRTKKAP* |
JGI25382J43887_100529721 | 3300002908 | Grasslands Soil | ARLKEKGDLWADFWKKRQRLEQAIELLSERMPVKTKKAP* |
JGI25617J43924_102276212 | 3300002914 | Grasslands Soil | LFARLKEKGDLWGDFWKRRQRLEQAIELLSARMPPRTKPSGTK* |
JGI25617J43924_103044522 | 3300002914 | Grasslands Soil | SLQTANLNIKTIFARLKEKGDLWSDFWKQRQRLDGAVEALSNRIPPRAKKTS* |
Ga0066672_102476743 | 3300005167 | Soil | NIKTVFARLKEKGDLWSDFWKRRQRLEKAIELLSDRMPPRTKKAP* |
Ga0066685_104123513 | 3300005180 | Soil | NIKTVFARLKEKGDLWADFWKRRQRLEQAIELLSTRMPPRTKKAL* |
Ga0070730_100644464 | 3300005537 | Surface Soil | NIKTVFARMKEKGDLWKDFWKSQQRIEGAIEALSKGMSSKSKKA* |
Ga0070730_104474302 | 3300005537 | Surface Soil | NIKTVFARMKEKGDLWKDFWKSQQRIEGAIEALSKGMSSKTKKA* |
Ga0066697_108274732 | 3300005540 | Soil | ENLNIKTVFARLKERGDLWEDFWKSRQRIEGAIEALSSSMAHK* |
Ga0066661_102801691 | 3300005554 | Soil | KEKGDLWADFWKCRQRLEQAIELLSERMPPRTRKAP* |
Ga0066707_104717831 | 3300005556 | Soil | LRPETLNIKTVFARLKDKGDLWADFWKRRQRLEQAIELLSNHMPPRTKKAP* |
Ga0066703_104884981 | 3300005568 | Soil | TIFARVKEKGDLWADFWKKRQRLEQAIELLSERMPPKTRK* |
Ga0066708_104019981 | 3300005576 | Soil | TVFARLKEKGDLWADFWKKRQRLEQAIELLSDRMPTRTKRAP* |
Ga0066654_101530631 | 3300005587 | Soil | EKGDLWADFWKKRQRLEQAIELLSDRMPTRTKRAP* |
Ga0066696_109392192 | 3300006032 | Soil | PENLNIKTIFARLKEKGDLWKDFWKSPQNIEGAIEKLSSHLPANSKK* |
Ga0075029_1003315282 | 3300006052 | Watersheds | IETVFARLKEKGDLWADFWKRRQRLEQAIELLSQHMSPRTKN* |
Ga0070715_102368872 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKPESLNIKSIRARLKEKGDLWAKFWDSRQRLEPAIELLSAQMSAPAGKKS* |
Ga0075014_1001951761 | 3300006174 | Watersheds | KTVFARLKEKDDLWGDFWKRQQRLEEAIELLSQRMPARTTKRS* |
Ga0066659_106590513 | 3300006797 | Soil | TIFARLKEKGDLWTDFWKRRQRLEEAIEALSNRIPARTKKHS* |
Ga0099791_101968541 | 3300007255 | Vadose Zone Soil | KTVFARLKEKGDLWGDFWKRRQRLEQAIELLSKWLPPRAKKAP* |
Ga0099794_105486551 | 3300007265 | Vadose Zone Soil | PETLNIKTVFARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP* |
Ga0066710_1004647361 | 3300009012 | Grasslands Soil | TLNIKTILARLKEKGDLWTDFWTKRQRLEQAIELLSERMTPKARKSP |
Ga0099830_108114712 | 3300009088 | Vadose Zone Soil | KEKGDLWADFWKRRQRLEHAIELLSNRMPSRTKKAP* |
Ga0099828_100178031 | 3300009089 | Vadose Zone Soil | KEKGDLWADFWKRRQRLEQAIELLSKRMPPRTKKAP* |
Ga0066709_1020316822 | 3300009137 | Grasslands Soil | NIKTVFARLKERGDLWRDFWKKRQRLEGTIELLSEGMSSSTKKAP* |
Ga0116217_107506332 | 3300009700 | Peatlands Soil | ERLKERGDLWGDFWKRRQRLELAISQLSSRISAKSNSQK* |
Ga0126380_110035601 | 3300010043 | Tropical Forest Soil | SLRPESLNMKTIFARLKDKGDLWADFWKRRQRLEDAIELLSSRMPSRTGKTP* |
Ga0126384_103531361 | 3300010046 | Tropical Forest Soil | NPETHNIKTIFARLKEKGDLWADFWRQRQRLEEAIELLSARMPSRTTKTP* |
Ga0134067_100182283 | 3300010321 | Grasslands Soil | RPETLNIKTVFARLKEKGDLWGDFWERRQRLENAIELLSRRVSPSAKKKH* |
Ga0134065_100495251 | 3300010326 | Grasslands Soil | RLKEKGDLWGDFWERRQRLENAIELLSRRVSPSAKKKH* |
Ga0126378_132380222 | 3300010361 | Tropical Forest Soil | RPSLRPDTLNIKTILTRLKEKGDLWADFWKKRKQLEPAIELLSARMPQKTKKAP* |
Ga0126377_130083412 | 3300010362 | Tropical Forest Soil | ENLNIKTVFERLKEKGDLWKGFWKSQQRIEGAIEALSSRMAHK* |
Ga0126379_103215981 | 3300010366 | Tropical Forest Soil | PSLHPENLNMKTIFARLKEKGDLWKDFWKSRQRIEGAIEALSSRINK* |
Ga0126350_111867891 | 3300010880 | Boreal Forest Soil | LNIKTISARLKEKGDLWADFWKTRQRLEDAVELLSKRMTSKTKKTP* |
Ga0150983_137057611 | 3300011120 | Forest Soil | LNIKTISARLKEQGDLWADFWKKRQRLEDAVELLSERMSSRPKKP* |
Ga0137392_102161631 | 3300011269 | Vadose Zone Soil | IKTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPKTRKAP* |
Ga0137392_102587123 | 3300011269 | Vadose Zone Soil | LNIKTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPRTKKVP* |
Ga0137392_108994651 | 3300011269 | Vadose Zone Soil | IKTIFARLKEKGDLWGDFWKRRQRLERAIELLSERMPPMGPSRTRKNP* |
Ga0137391_105788263 | 3300011270 | Vadose Zone Soil | ETLNITTVFARLKEKGDLWADFWKRRQRLEQAIELLSKRMPPRTKKAP* |
Ga0137393_112611581 | 3300011271 | Vadose Zone Soil | RLKEKGDLWADFWKKRQRLEQAVELLSDRMPPRTKKAP* |
Ga0137389_110113982 | 3300012096 | Vadose Zone Soil | FARLKEKGDLWADFWKRRQRLEQAMELLSERMPPKTKKAP* |
Ga0137389_113409262 | 3300012096 | Vadose Zone Soil | RPETLNIKTIFARLKEKGDLWGDFWKRRQKLEQAIELLSNRMPAKTKKAP* |
Ga0137388_119134712 | 3300012189 | Vadose Zone Soil | RPETLNIKTVFECLKEKGDLWADFWTRRQRLEQAIQLLSERMPPKTKPSGTK* |
Ga0137383_101891341 | 3300012199 | Vadose Zone Soil | EKGDLWADFWKRRQRLEQAIELLSERMPPRTKKAP* |
Ga0137399_110832871 | 3300012203 | Vadose Zone Soil | EALNIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARSNR* |
Ga0137362_104526591 | 3300012205 | Vadose Zone Soil | KGDLWGDFWKQRQRLEGAIEALSNRIPPRTKKML* |
Ga0137362_114486382 | 3300012205 | Vadose Zone Soil | EKGDLWGDFWKRRQKLEQAIELLSDRMPAKTKKAP* |
Ga0137387_104338313 | 3300012349 | Vadose Zone Soil | VFARLKEKGDLWADFWKRRQRLEHAIELLSDRMPPRTKKAP* |
Ga0137372_111000181 | 3300012350 | Vadose Zone Soil | IKTVFARLREKGDLWADFWKQRQRLEHAIELLSERMPPRTKKAP* |
Ga0137386_103240621 | 3300012351 | Vadose Zone Soil | EKGDLWADFWKRRQRLEQAIERLSERMPPRTKKAP* |
Ga0137360_102236421 | 3300012361 | Vadose Zone Soil | LNIKTVFARLKEKGDLWADFWKRRQRLEGAIESLSRRMPPRTKKAP* |
Ga0137360_111297012 | 3300012361 | Vadose Zone Soil | IKTIFARLKEKGDLWSDFWKQRQRLEGAVEALSNRIPPRAKKTS* |
Ga0137360_114998751 | 3300012361 | Vadose Zone Soil | RLKEKGDLWGDFWKRRQKLEQAIELLSDRMPAKTKKAP* |
Ga0137390_112965801 | 3300012363 | Vadose Zone Soil | TTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPRTKKAP* |
Ga0137398_101870361 | 3300012683 | Vadose Zone Soil | TLNIKTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPRAKKAP* |
Ga0137397_101946894 | 3300012685 | Vadose Zone Soil | EKGDLWADFWKRRQRLEDAIESLSRRMPSRTKAP* |
Ga0137397_102860651 | 3300012685 | Vadose Zone Soil | EKGDLWADFWKRRQRLEQAIELLSDRMPPRTKKTP* |
Ga0137395_101217241 | 3300012917 | Vadose Zone Soil | IKTVFARLKEKGDLWADFWKRRQRLEQAIELLSERMPPRSRKSP* |
Ga0137396_103979951 | 3300012918 | Vadose Zone Soil | VFARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP* |
Ga0137396_106320261 | 3300012918 | Vadose Zone Soil | IKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAAKRNR* |
Ga0137396_110791811 | 3300012918 | Vadose Zone Soil | NIKTILARLKEKGDLWSDFWKQRQRLEGAVEALSNRIPPRAKKTS* |
Ga0137419_101800861 | 3300012925 | Vadose Zone Soil | LKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARRNR* |
Ga0137416_102402722 | 3300012927 | Vadose Zone Soil | RLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAAKRNR* |
Ga0137416_103542911 | 3300012927 | Vadose Zone Soil | LKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP* |
Ga0137404_115621841 | 3300012929 | Vadose Zone Soil | IKTIAGRLKEKGDLWAEFWKKRQRLENAVELLSERVPSRTKKS* |
Ga0137410_101786911 | 3300012944 | Vadose Zone Soil | KGDLWGAFWKQRQRLEGAIEALSNRIPPRTKKMP* |
Ga0137414_11131191 | 3300015051 | Vadose Zone Soil | ANLNILNIKTILARLKEKGDLWSDFWKQRQRLEGAVEALSNRIPPRAKKTS* |
Ga0137411_12350541 | 3300015052 | Vadose Zone Soil | KDKGDLWGDFWKRRQRLEDAIESLSRRMPSRTTKAP* |
Ga0137420_11139631 | 3300015054 | Vadose Zone Soil | DGLSVFARLKEKGDLWADFWKRRQRLEQAIELLSDRMPPRTKKTP* |
Ga0137420_11590423 | 3300015054 | Vadose Zone Soil | PEALNIKTVFARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP* |
Ga0137420_12776191 | 3300015054 | Vadose Zone Soil | RPASLNIKTVFARLKEKGDLWGDFWERRQRLENAIESLSRRVSPSAKKNH* |
Ga0137418_101121011 | 3300015241 | Vadose Zone Soil | RPEALNIKTVFARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP* |
Ga0137418_106468641 | 3300015241 | Vadose Zone Soil | RPEALNIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARSNR* |
Ga0137418_108442802 | 3300015241 | Vadose Zone Soil | LNIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRMPPTARKK* |
Ga0134072_104159541 | 3300015357 | Grasslands Soil | NLRPENLNIKTVFARLKERGDLWEDFWKSRQRIEGAIEALSSSMAHK* |
Ga0134089_103179481 | 3300015358 | Grasslands Soil | KTVFARLTEKGNLWADFWKRRQRLEQAIELLSTRMPPRTKKVP* |
Ga0182041_100182214 | 3300016294 | Soil | FARLKEKGDLWADFWKQRQRLEEAIERLSERMPPRTKQTP |
Ga0182032_102058721 | 3300016357 | Soil | TIFARLKEKGDLWADFWKQRQRLEEAIERLSERMPPRTKQTP |
Ga0182032_117663401 | 3300016357 | Soil | TVFARLREKGDLWSDFWKQRQRLEEAIEALSSRMSSPERKT |
Ga0182034_101683521 | 3300016371 | Soil | NPETHNIKTIFARLKEKGDLWADFWKQRQRLEEAIELLSERMPSRTAKTP |
Ga0182040_112394411 | 3300016387 | Soil | ETLNIKTVFARLKEKGDLWGDFWKRQQRLEEAIELLSQRMPARTTKGR |
Ga0182040_112636031 | 3300016387 | Soil | RLKEKGDLWGDFWKRPQRLEEAIELLGQLMPARTTKRS |
Ga0182039_101533321 | 3300016422 | Soil | NMKTIFARLKEKGDLWGDFWKRRQRLEDAIEALSNRMAATRKKTP |
Ga0187778_105133291 | 3300017961 | Tropical Peatland | NIKTIFERLKEKGDLWADFWKKSQRLEEAIELLSSRIPEKRGSR |
Ga0187767_101306151 | 3300017999 | Tropical Peatland | ALNIKTIFTRLKEKGDLWADFWKRRQRLEKAIELLSERMPPRSKKPA |
Ga0187815_105139032 | 3300018001 | Freshwater Sediment | ETLNIRSIFDRLKEKGDLWGDFWKNRQRLEDAIELLGTQISSSPKKTR |
Ga0187771_101966011 | 3300018088 | Tropical Peatland | QKGDLWGDFWKHRQRLEQAIELLSERMPSRTKKAP |
Ga0187770_102953593 | 3300018090 | Tropical Peatland | EALNIKTIFTRLKEKGDLWADFWKSRQRLEKAIELLSDRMPTRSKKPT |
Ga0066667_113876601 | 3300018433 | Grasslands Soil | EKGDLWAGFWKRQQRLEQAIELLSTRMPPRTKKVP |
Ga0066669_105894421 | 3300018482 | Grasslands Soil | SLNIKSIRARLKEKGDLWANFWDSRQRLEPAIELLSSQMSAPAKKH |
Ga0179592_104584162 | 3300020199 | Vadose Zone Soil | LKEKSDLWGDFWKRRQRLEQAIELLSKWLPPRAKKAP |
Ga0210407_110362251 | 3300020579 | Soil | IKTVFVRLKEKGDLWGDFWKQRQRLEGAIEALSNRIPPRTKKAP |
Ga0210403_100826544 | 3300020580 | Soil | PANLNVKTIFARLKEKGDLWGDFWNRRQRLEGAVEALSNRIPPRTGKKS |
Ga0210403_114498982 | 3300020580 | Soil | FARLKEKGDLWGDFWKQRQRLEGAIEALSNGIPPRTKKMP |
Ga0210399_112970241 | 3300020581 | Soil | KPEALNIKSILARLKEKGDLWGDFWKRRQRLEQAIEILSSRVPPRTKKGP |
Ga0210401_108267252 | 3300020583 | Soil | LKPESLNIKTISARLKEKGDLWADFWKKRQRLERAVQLLSERMTSKTKKTS |
Ga0210400_101932422 | 3300021170 | Soil | VFARLKEKGDLWGDFWKRRQRLEDAIELLSRRLPPAARRNR |
Ga0210405_109993231 | 3300021171 | Soil | TVFARLKEKGDLWADFWKRRQRLENAIELLSRRMPPAPKQKR |
Ga0210408_100880071 | 3300021178 | Soil | AVPARLKEKGDLWADFWKKRQRLEGAIELLSQHMSATTKKTP |
Ga0210408_108214703 | 3300021178 | Soil | ETLNIKTVFARLKEKGDLWADFWKRRQRLEQAIELLSDRMPPRSKKSP |
Ga0210408_109588192 | 3300021178 | Soil | LKEKGDLWGDFWKRRQRLEQAIELLSKWLPPRAKKAP |
Ga0210383_116800171 | 3300021407 | Soil | QPAVLNIKTISARLKEKGDLWGDFWKRRQRLEQAIEALSSRIPPRAKKTS |
Ga0210384_102670224 | 3300021432 | Soil | VFARLREKGDLWGDFWKRRQRLEGAIEALSNRIPPRTKKMP |
Ga0210384_103411731 | 3300021432 | Soil | VFARLKEKGDLWADFWKRRQRLENAIELLSRRMPPAPKQKR |
Ga0210398_107908072 | 3300021477 | Soil | KTIFARMKEKGDLWADFWKRRQGLEQAIEALSNRIPPRTKRTP |
Ga0210402_119359722 | 3300021478 | Soil | ISARLKEQGDLWADFWKKRQRLEDAVELLSERMSSRPKKP |
Ga0210409_104837333 | 3300021559 | Soil | LNIKTVFARLKDKGDLWADFWKRRQRLEQAIELLSERMPPRSVK |
Ga0126371_118532862 | 3300021560 | Tropical Forest Soil | RPDRFTIKSMSERLKEHGDLWADFWKYRQELEPAVEKLQRRSSRR |
Ga0242660_12106371 | 3300022531 | Soil | VFARLKEKGDLWGDFWKRRQRLEQAIELLSARMPPRTKPSGTKEKAT |
Ga0137417_10016252 | 3300024330 | Vadose Zone Soil | PGLRPEALNMKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARRNR |
Ga0137417_14909863 | 3300024330 | Vadose Zone Soil | RINVPALRPEALNIKTVFARLKRRAISGRFLKRRQRLEDAIESLSRRLPPAARSNR |
Ga0207693_109514572 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ARMKEKGDLWGNFWKRQQRLEEAIELLGQLMPARTSKRS |
Ga0207646_114871661 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FARLQEKGDLWADFWKKRQRLEEAVELLSERMAAKTKKAP |
Ga0209350_10869342 | 3300026277 | Grasslands Soil | KDKGDLWGDFWKRRQRLEQAIELLSNRMPSRTKKAP |
Ga0209235_11914981 | 3300026296 | Grasslands Soil | NIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRMPSRTKAP |
Ga0209468_11967602 | 3300026306 | Soil | LRPETLNIKTVFARLKEKGDLWADFWKKRQRLEQAIELLSDRMPPRTKRAP |
Ga0209377_11952972 | 3300026334 | Soil | LKEKGDFWADFWKHRQRLEQAIELLSERMPPRTKKAP |
Ga0257147_10019741 | 3300026475 | Soil | KTVFDRLEEKGDLWAEFWNKRQRIETAIELLSSHIPAKPKKAH |
Ga0257168_10345812 | 3300026514 | Soil | LRPEALNIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARRNR |
Ga0209378_11204541 | 3300026528 | Soil | ETLNIKTILARLKEKGDLWTDFWTKRQRLEQAIELLSERMTPKARKSP |
Ga0209160_11981891 | 3300026532 | Soil | IFARLKDKGDLWADFWRKRQRLEQAIELLSERMPPKTRK |
Ga0209648_106775471 | 3300026551 | Grasslands Soil | TVFARLKEKGDLWADFWKRRQRLEHAIELLSNRMPSRTKKAP |
Ga0209648_108231031 | 3300026551 | Grasslands Soil | LNIKTVFARLKEKGDLWGDFWKRQQRLEEAIELFSQRMPARTTKGR |
Ga0209577_104437013 | 3300026552 | Soil | TMFARLKEKGDLWADFWKRRQRLEQAIELLSTRMPPRTKKAL |
Ga0179587_109557471 | 3300026557 | Vadose Zone Soil | LKEKGDLWGDFWKRRQRLEDAIESLSSLLPPAARRNR |
Ga0207506_10152331 | 3300027460 | Soil | IKTIFARLKEKGDLWGDFWKQRQRLEGAIEALSNRIPPRTKKMP |
Ga0209076_11264842 | 3300027643 | Vadose Zone Soil | NIKTVFARLKEKGDLWDDFWKRRQRLEDAIESLSRRMPSRTKAP |
Ga0209588_12467421 | 3300027671 | Vadose Zone Soil | FARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP |
Ga0209039_101279813 | 3300027825 | Bog Forest Soil | LNIETIFARLKEKGDLWGDFWKQRQRLEGAIEALSSRIPPRAKKTS |
Ga0209180_105173731 | 3300027846 | Vadose Zone Soil | TLNIKTVFARLKEKGDLWADFWKRRQRLEHAIELLSNHMPSRTKKAP |
Ga0209180_105377461 | 3300027846 | Vadose Zone Soil | FARLIKEKGDLWSDFWKRRQRLEYAIELLSDRLPPKTKKAP |
Ga0209166_101994251 | 3300027857 | Surface Soil | NLNIKTVFARMKEKGDLWKDFWKSQQRIEGAIEALSKGMSSKSKKA |
Ga0209283_107766271 | 3300027875 | Vadose Zone Soil | KEKGDLWADFWKRRQRLEQAIELLSKRMPPRTKKAP |
Ga0137415_103382961 | 3300028536 | Vadose Zone Soil | RPEALNIKTVFARLKEKGDLWGDFWKRRQRLEQAIELLSNRLPARTKKAP |
Ga0137415_108953351 | 3300028536 | Vadose Zone Soil | RPEALNIKTVFARLKEKGDLWGDFWKRRQRLEDAIESLSRRLPPAARRNR |
Ga0075373_110190962 | 3300030945 | Soil | KTVFARLKEKGDLWGDFWKRQQRLEEAIELLGQLMPARTSKRS |
Ga0073994_113584171 | 3300030991 | Soil | LRPETLNIKTIFARLESKGDLWNDFWKRRQRLEQAIEILSSRVPPRTKKEP |
Ga0318516_104310342 | 3300031543 | Soil | HNIKTIFARLKEKGDLWADFWKQRQRLEEAIELLSARMPSRTTKTP |
Ga0307474_115386212 | 3300031718 | Hardwood Forest Soil | PETLNIKTVFARLKDKGDLWADFWKRRQRLEEAIELLSERMPPRTKNAP |
Ga0307475_106511873 | 3300031754 | Hardwood Forest Soil | KATLRPANLNMKTVFARLEQKGDLWKEFWNRRQRLEHAIELLGSRVAPP |
Ga0318521_102877901 | 3300031770 | Soil | NIKTIFARLKEKGDLWADFWKQRQRLEEAIELLSARMPSRTTKTP |
Ga0318550_101323091 | 3300031797 | Soil | LKEKGDLWADFWKQRQRLEEAIELLSARMPSRTTKTP |
Ga0318568_101810372 | 3300031819 | Soil | LRPESLNIKTIFARLKEKGDFWKNFWRARQRIEGAIEALSSRINSH |
Ga0307478_112948312 | 3300031823 | Hardwood Forest Soil | FGRLKDKGDLWADFWKRRQRLEQAIELLSQRMPPRAKKAP |
Ga0318520_106783462 | 3300031897 | Soil | ETLNIKTIFARLKEKGDLWADFWKQRQRLEEAIERLSERMPPRTKQTP |
Ga0306926_120329912 | 3300031954 | Soil | KEKGDLWGDFWKRQQRLEEAIELLSQRMPARTTKGR |
Ga0307479_101409911 | 3300031962 | Hardwood Forest Soil | TLNINTVFARLKEKGDLWGDFWKRRQRLEKAIELLSERMPPRAKPS |
Ga0307479_102370861 | 3300031962 | Hardwood Forest Soil | MTTVFPRLKEKGDLWADFWNDRQRLEQAIEILSQRMPPRTKKA |
Ga0318507_101470191 | 3300032025 | Soil | NLNPETHNIKTIFARLKEKGDLWADFWKQRQRLEEAIDLLSARMPSRTTKTP |
Ga0318559_100679121 | 3300032039 | Soil | LKEKGDLWADFWKQRQRLEEAIDLLSARMPSRTTKTP |
Ga0318532_101523781 | 3300032051 | Soil | IFARLKEKGDLWADFWKQRQRLEEAIDLLSARMPSRTTKTP |
Ga0306924_121930662 | 3300032076 | Soil | IFARLKEKGDLWADFWKQRQRLEEAIELLSERMPSRTAKTP |
Ga0307471_1042336682 | 3300032180 | Hardwood Forest Soil | RPETLNIKTVFARLKEKGDLWADFWKRRQRLEDAIESLSRRIPATARKK |
Ga0306920_1040711102 | 3300032261 | Soil | IFARLKEKGDLWADFWKQRQRLEEAIELLSERMPPRTKQTP |
⦗Top⦘ |