NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044532

Metagenome / Metatranscriptome Family F044532

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044532
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 79 residues
Representative Sequence INFYSSNFPEYYWQKPHYNWGNTVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY
Number of Associated Samples 134
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.65 %
% of genes near scaffold ends (potentially truncated) 74.03 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.403 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.026 % of family members)
Environment Ontology (ENVO) Unclassified
(58.442 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(58.442 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.58%    β-sheet: 0.00%    Coil/Unstructured: 76.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004463|Ga0063356_100868119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1269Open in IMG/M
3300004769|Ga0007748_11417846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella896Open in IMG/M
3300004788|Ga0007742_10793795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella904Open in IMG/M
3300004793|Ga0007760_11327794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea854Open in IMG/M
3300004794|Ga0007751_11255952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella931Open in IMG/M
3300004802|Ga0007801_10066327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1061Open in IMG/M
3300005415|Ga0007743_1296192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300005584|Ga0049082_10098488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1025Open in IMG/M
3300005590|Ga0070727_10251214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea987Open in IMG/M
3300005662|Ga0078894_10577890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1003Open in IMG/M
3300006037|Ga0075465_10032352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1070Open in IMG/M
3300006357|Ga0075502_1508404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea852Open in IMG/M
3300006357|Ga0075502_1622582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300006374|Ga0075512_1187448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300006379|Ga0075513_1277760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea859Open in IMG/M
3300006383|Ga0075504_1324750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea930Open in IMG/M
3300006392|Ga0075507_1531037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea768Open in IMG/M
3300006394|Ga0075492_1018923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea966Open in IMG/M
3300006400|Ga0075503_1548528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea896Open in IMG/M
3300006404|Ga0075515_10830256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea944Open in IMG/M
3300006415|Ga0099654_10284844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea923Open in IMG/M
3300006419|Ga0075496_1303870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300006803|Ga0075467_10286942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea880Open in IMG/M
3300007561|Ga0102914_1124333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea801Open in IMG/M
3300007667|Ga0102910_1044250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1016Open in IMG/M
3300007861|Ga0105736_1030648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1024Open in IMG/M
3300008928|Ga0103711_10018760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300008958|Ga0104259_1019302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella674Open in IMG/M
3300009161|Ga0114966_10239911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1125Open in IMG/M
3300009265|Ga0103873_1031021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella953Open in IMG/M
3300009432|Ga0115005_10399589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300009433|Ga0115545_1096069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1077Open in IMG/M
3300009433|Ga0115545_1099910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1051Open in IMG/M
3300009436|Ga0115008_10539756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella835Open in IMG/M
3300009543|Ga0115099_10308017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300009599|Ga0115103_1264912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea783Open in IMG/M
3300009608|Ga0115100_10405293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300009677|Ga0115104_10671304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1021Open in IMG/M
3300009677|Ga0115104_11011589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella887Open in IMG/M
3300009785|Ga0115001_10418503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300010305|Ga0129320_131355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300010307|Ga0129319_1066890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella795Open in IMG/M
3300010885|Ga0133913_13555318All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300011009|Ga0129318_10376173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella503Open in IMG/M
3300012408|Ga0138265_1213105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1004Open in IMG/M
3300012414|Ga0138264_1388388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea981Open in IMG/M
3300012415|Ga0138263_1258326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300012523|Ga0129350_1369113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea848Open in IMG/M
3300012528|Ga0129352_10851040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300012709|Ga0157608_1177607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300012716|Ga0157605_1132213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea908Open in IMG/M
3300012721|Ga0157612_1236206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea902Open in IMG/M
3300012725|Ga0157610_1214628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea914Open in IMG/M
3300012782|Ga0138268_1285523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella885Open in IMG/M
3300013004|Ga0164293_10811229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
(restricted) 3300013126|Ga0172367_10225376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1158Open in IMG/M
3300013295|Ga0170791_11174812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella800Open in IMG/M
3300013295|Ga0170791_12528564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella964Open in IMG/M
3300013295|Ga0170791_14415097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea915Open in IMG/M
3300016758|Ga0182070_1364995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300016776|Ga0182046_1104968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300017166|Ga0186523_107984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1127Open in IMG/M
3300017262|Ga0186220_111569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea961Open in IMG/M
3300017949|Ga0181584_10301273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1025Open in IMG/M
3300018410|Ga0181561_10469851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300018599|Ga0188834_1010908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300018622|Ga0188862_1009241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300018684|Ga0192983_1014202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1009Open in IMG/M
3300018706|Ga0193539_1023242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1069Open in IMG/M
3300018710|Ga0192984_1042608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea912Open in IMG/M
3300018739|Ga0192974_1026994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella992Open in IMG/M
3300018762|Ga0192963_1029818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300018848|Ga0192970_1025250All Organisms → Viruses → Predicted Viral1098Open in IMG/M
3300018848|Ga0192970_1030314All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300018848|Ga0192970_1032729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella974Open in IMG/M
3300018871|Ga0192978_1034938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea943Open in IMG/M
3300018882|Ga0193471_1039532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea908Open in IMG/M
3300018961|Ga0193531_10104717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1112Open in IMG/M
3300018996|Ga0192916_10068031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1038Open in IMG/M
3300019017|Ga0193569_10150625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1053Open in IMG/M
3300019048|Ga0192981_10122495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1026Open in IMG/M
3300019048|Ga0192981_10124505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1017Open in IMG/M
3300019095|Ga0188866_1010077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea933Open in IMG/M
3300019108|Ga0192972_1034496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella991Open in IMG/M
3300019201|Ga0180032_1039244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea880Open in IMG/M
3300019274|Ga0182073_1423270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea922Open in IMG/M
3300019277|Ga0182081_1349294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300019280|Ga0182068_1420310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea819Open in IMG/M
3300019280|Ga0182068_1563900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea709Open in IMG/M
3300020161|Ga0211726_10219903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300020169|Ga0206127_1119735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300020382|Ga0211686_10086942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1274Open in IMG/M
3300021091|Ga0194133_10635543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300021169|Ga0206687_1438718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300021169|Ga0206687_1765840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300021345|Ga0206688_10362358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300021350|Ga0206692_1483471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea945Open in IMG/M
3300021359|Ga0206689_11039720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella942Open in IMG/M
3300021365|Ga0206123_10149825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1069Open in IMG/M
3300021872|Ga0063132_129744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella881Open in IMG/M
3300021887|Ga0063105_1031216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea975Open in IMG/M
3300021890|Ga0063090_1043028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea889Open in IMG/M
3300021898|Ga0063097_1010707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella833Open in IMG/M
3300021913|Ga0063104_1035732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300021925|Ga0063096_1041776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella915Open in IMG/M
3300021936|Ga0063092_1030877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea965Open in IMG/M
3300021957|Ga0222717_10441243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea712Open in IMG/M
3300024343|Ga0244777_10269980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1079Open in IMG/M
3300024343|Ga0244777_10658852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300025138|Ga0209634_1116380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1149Open in IMG/M
3300025890|Ga0209631_10372565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300027736|Ga0209190_1137395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1075Open in IMG/M
3300027770|Ga0209086_10383673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300027782|Ga0209500_10168452All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300027810|Ga0209302_10172224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1049Open in IMG/M
3300027885|Ga0209450_10358459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1060Open in IMG/M
3300028282|Ga0256413_1268091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300028329|Ga0210315_1020059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300030551|Ga0247638_1162648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300030670|Ga0307401_10194496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea914Open in IMG/M
3300030671|Ga0307403_10249119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300030699|Ga0307398_10251418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea950Open in IMG/M
3300030699|Ga0307398_10283904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella896Open in IMG/M
3300030699|Ga0307398_10289783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella887Open in IMG/M
3300030778|Ga0075398_11459444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300030788|Ga0073964_11454718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea927Open in IMG/M
3300030788|Ga0073964_11516973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300030788|Ga0073964_11590710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300030859|Ga0073963_11233858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea937Open in IMG/M
3300030865|Ga0073972_11139915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea946Open in IMG/M
3300030961|Ga0151491_1074269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea888Open in IMG/M
3300031007|Ga0073975_1541031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea875Open in IMG/M
3300031231|Ga0170824_120222050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1126Open in IMG/M
3300031696|Ga0307995_1211385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300031710|Ga0307386_10204971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea953Open in IMG/M
3300031710|Ga0307386_10268967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea847Open in IMG/M
3300031717|Ga0307396_10185900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella982Open in IMG/M
3300031729|Ga0307391_10240134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea967Open in IMG/M
3300031729|Ga0307391_10243843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea960Open in IMG/M
3300031735|Ga0307394_10128606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea973Open in IMG/M
3300031735|Ga0307394_10147739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea911Open in IMG/M
3300031737|Ga0307387_10334618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea910Open in IMG/M
3300031738|Ga0307384_10154573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella987Open in IMG/M
3300031738|Ga0307384_10157150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella980Open in IMG/M
3300031738|Ga0307384_10538358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300031739|Ga0307383_10210024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea920Open in IMG/M
3300032520|Ga0314667_10255066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea946Open in IMG/M
3300032521|Ga0314680_10249370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1053Open in IMG/M
3300032651|Ga0314685_10176644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1140Open in IMG/M
3300032708|Ga0314669_10416865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300032713|Ga0314690_10188626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea993Open in IMG/M
3300032739|Ga0315741_10452597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1022Open in IMG/M
3300032748|Ga0314713_10138215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea993Open in IMG/M
3300033572|Ga0307390_10309616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea945Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.03%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.29%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.84%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.19%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.90%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.90%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.25%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.60%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.60%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.30%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.30%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.30%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.30%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.65%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.65%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.65%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.65%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005415Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016758Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030961Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031007Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0063356_10086811923300004463Arabidopsis Thaliana RhizosphereMTAVNFYSSNFPEYFWQKPHYNLGNKLVHSNLYKTLNPIRARYDYSPNDYSQMPYFLGHVPQFTWVYGSLDYSFKKYHRHY*
Ga0007748_1141784613300004769Freshwater LakeTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHY*
Ga0007742_1079379523300004788Freshwater LakeFYSSNFPEYFWQKPHYNLGNKLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY*
Ga0007760_1132779413300004793Freshwater LakeSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0007751_1125595223300004794Freshwater LakeAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHY*
Ga0007801_1006632723300004802FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHY*
Ga0007743_129619223300005415Freshwater LakeYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0049082_1009848833300005584Freshwater LenticMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY*
Ga0070727_1025121423300005590Marine SedimentMPVTNFYSSITPEYYQQKWHYNLGNQVVHSDIYKKLNPLRANYDFKPNQYTQMPYYLGLVPQFTWVWGNLDYSYRKYHRHF*
Ga0078894_1057789013300005662Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFFLGHVPQTSWVYGNLDYSFNKYHRHY*
Ga0075465_1003235223300006037AqueousMSAINFYSSNFPEYFWQKPHYNLGNKLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY*
Ga0075502_150840413300006357AqueousWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0075502_162258213300006357AqueousINFYSSNFPEYYWQKPHYNLGNQLMHSDLYKKLNPIRARYDYTPNDYSQMPIFLGVVPQFFWLYGNLDYSFKKYHRHY*
Ga0075512_118744823300006374AqueousAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0075513_127776013300006379AqueousNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0075504_132475023300006383AqueousMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0075507_153103723300006392AqueousSAINFYSSNFPEYYWQKPHYNLGNQLMHSDLYKKLNPIRARYDYTPNDYSQMPIFLGVVPQFFWLYGNLDYSFKKYHRHY*
Ga0075492_101892313300006394AqueousEYLWQKPHYNLGNKIIHSDLYKKLNPIRARFDYQPNSYAQMPFMLGLVPQVSWIYGNLDYSFNKYHRHY*
Ga0075503_154852813300006400AqueousTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0075515_1083025623300006404AqueousIMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY*
Ga0099654_1028484433300006415LakeNFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0075496_130387023300006419AqueousMGDFYTSNAPEYLWQKPHYNLGNKIIHSDLYKKLNPIRARFDYQPNSYAQMPFMLGLVPQVSWIYGNLDYSFNKYHRHY*
Ga0075467_1028694233300006803AqueousMAYINFSSSNIPEYYWQKPHYDLGNRIVHSDLYKKLNPIRARYDHQPNEYTQMPFFLGVVPQFQWVYGNLDYSFNKYHRHY*
Ga0102914_112433313300007561EstuarineMTAINFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0102910_104425023300007667EstuarineMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPLRQRYEYVPGEYTQMPFYFGHIPQLSWVYGNLDYSFNKYHRHY*
Ga0105736_103064813300007861Estuary WaterINFYSSNFPEYFWQKPHYNLGNKLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY*
Ga0103711_1001876013300008928Ocean WaterVVNFYSSNIPEYYWQKPHYNLGNNIIHSDMYKMLNPVRARYDFKANEYTQMPSFFGVVPQMYWLYGNLDYSLKKWHRHY*
Ga0104259_101930223300008958Ocean WaterSNFPEYFTQKTHYNWGNAIVHSDAYKRLNPIRQRYEYQPNEYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0114966_1023991133300009161Freshwater LakeMTAINFYSSNFPEYFWQKGHYNLGNQVVHSDLYKKVNILRSRFDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHY*
Ga0103873_103102133300009265Surface Ocean WaterSNIPEYYWQKPHYDLGNKIIHNDTYRMLNPVRQRYEYTPNEYAQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY*
Ga0115005_1039958923300009432MarineMSCINFYSSNFPEYFWQKPHYNFGNKVIHSDAYKSINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0115545_109606933300009433Pelagic MarineMSCINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0115545_109991033300009433Pelagic MarineMSAINFYSSNFPEYYWQKPHYNLGNQLMHSDLYKKLNPIRARYDYTPNDYSQMPIFLGVVPQFFWLYGNLDYSFKKYHRHY*
Ga0115008_1053975613300009436MarineMTAINFYSSNMPEYMWQKSHYNLGNQIVHSDIYKKLNPIRARYDYEPNSYAQMPFFLGVVPQFYWTYGNLDYSFNKYHRHY*
Ga0115099_1030801713300009543MarineINFYSSNFPEYYWQKPHYNLGNSIIHSDLYKKLNPIRARYDYAPNQYTQMPFYFGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0115103_126491233300009599MarineGNFYSSNIPEYYWQKPHYDLGNRIIHNDTYRMLNPVRQRYEYTPNEYAQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY*
Ga0115100_1040529323300009608MarineYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0115104_1067130413300009677MarineTVNFYSSNFPEYMWQKPHYNWGNAIIHSDLYKKINPIRARYDYTPNDYSQMPFYLGVVPQAYWLYGNLDYSFKKHHRLI*
Ga0115104_1101158923300009677MarineFYSSNFPEYFTQKTHYNWGNAIVHSDAYKKLNPIRQRYEYQPNEYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0115001_1041850313300009785MarinePKTPKPLDLENLIYYYLLNMSCINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0129320_13135523300010305AqueousINFYSSNFPEYYWQKPHYNWGNTVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY*
Ga0129319_106689023300010307AqueousSNFPEYYWQKPHYNWGNTVIHSDLYKKLNTIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY*
Ga0133913_1355531813300010885Freshwater LakeTTINFYSSNFPEYYWQKPHYNWGNTVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY*
Ga0129318_1037617313300011009Freshwater To Marine Saline GradientPKPQNPSNIYSVLIIINMSAINFYSSNFPEYFWQKPHYNLGNKLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY*
Ga0138265_121310513300012408Polar MarineYLLNMSCINFYSSNFPEYFWQKPHYNWGNQMIHSDVYKKINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0138264_138838813300012414Polar MarineMSCINFYSSNFPEYFWQKPHYNWGNQMIHSDVYKKINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0138263_125832623300012415Polar MarineWVPGGVIYYYLLNMSCINFYSSNFPEYFWQKPHYNWGNQMIHSDVYKKINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0129350_136911313300012523AqueousGNFYSSNIPEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY*
Ga0129352_1085104013300012528AqueousMWQKPHYNWGNAIIHSDLYKKINPIRARYDYTPNDYSQMPFYLGVVPQAYWLYGNLDYSFKKHHRLI*
Ga0157608_117760723300012709FreshwaterWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0157605_113221333300012716FreshwaterAINFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0157612_123620633300012721FreshwaterFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0157610_121462833300012725FreshwaterFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0138268_128552313300012782Polar MarineCINFYSSNFPEYFWQKPHYNWGNQMIHSDVYKKINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY*
Ga0164293_1081122923300013004FreshwaterMTAINFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIHARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
(restricted) Ga0172367_1022537613300013126FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIIHSDLYKQLNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHY*
Ga0170791_1117481223300013295FreshwaterLNMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHY*
Ga0170791_1252856423300013295FreshwaterFYSSNFPEYFWQKGHYNLGNEVVHSDLYKKVNILRSRFDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHY*
Ga0170791_1441509733300013295FreshwaterSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY*
Ga0182070_136499513300016758Salt MarshTGNFYSSNIPEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0182046_110496813300016776Salt MarshQKPHYNLGNQLMHSDLYKKLNPIRARYDYTPNDYSQMPIFLGVVPQFFWLYGNLDYSFKKYHRHY
Ga0186523_10798423300017166Host-AssociatedMSAINFYSSIFPEYYWQKPQHDLGNRVVHSSLYKTMNPIRSRYDYAPNEYSQMPFYLGSVPQLNWLYGSLDYSFQKYHK
Ga0186220_11156923300017262Host-AssociatedNNFYSSNFPEYMWQKPHYDLGNKMIHSDLYKKLNPIRGRYDYKPNDYSQMPYFLGHVPQFTWIYGNLDYSFNKYHRHY
Ga0181584_1030127323300017949Salt MarshMTTGNFYSSNIPEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0181561_1046985123300018410Salt MarshMTAINFYSSNFPEYFWQKPHYNLGNKIVTSDLYKKLNPIRARYDFNGNDYTQMPIFLGVVPQFFWLYGNLDYSFNKYHRHY
Ga0188834_101090813300018599Freshwater LakeAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0188862_100924113300018622Freshwater LakeFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0192983_101420213300018684MarineMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0193539_102324213300018706MarineKMSAINFYSSNFPEYFWQKPHYDWGNKVVHSDLYKKFNPIRARYDYNPNDYSQMPFYLGSVPQLNWLYGSIDYSF
Ga0192984_104260823300018710MarineAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0192974_102699423300018739MarineSMSAINFYSSNFPEYYWQKPHYNWGNAVVHSPLYKKINPIRARYDYAPNEYSQMPFYLGSVPQFNWLYGSLDYSFQKYHKHY
Ga0192963_102981813300018762MarineVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0192970_102525023300018848MarineAMSAINFYSSNFPEYYWQKPHYNWGNAVVHSPLYKKINPIRARYDYAPNEYSQMPFYLGSVPQFNWLYGSLDYSFQKYHKHY
Ga0192970_103031423300018848MarineKHYRSSMSAINFYSSNFPEYYWQKPHYNWGNAVVHSPLYKKINPIRARYDYAPNEYSQMPFYLGSVPQFNWLYGSLDYSFQKYHKHY
Ga0192970_103272923300018848MarineFYSSNFPEYYYQKPHYDLGNAIIHSDVYKKLNPIRARYDYKANDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHKHYQAHDDWHVDGKNKTLGAK
Ga0192978_103493823300018871MarineTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0193471_103953223300018882MarineVNFYSSNIPEYYWQKPHWNLGNQIVHSDVYKKLNPVRQRYDFKANEYTQMPMFFGVVPQIYWLYGNLDYSLKKWHRHY
Ga0193531_1010471713300018961MarineMSAINFYSSNFPEYFWQKPHYDWGNKVVHSDLYKKFNPIRARYDYNPNDYSQMPFYLGSVPQLNWLYGSIDYSF
Ga0192916_1006803123300018996MarineMNNFYSSITPEYYWQKPHYNFGNKIITSDLYKSLNPLRARYDYSPGDYTQMPFFLGVVPQFWWLYGNLDYNMDKYHK
Ga0193569_1015062523300019017MarineNFPEYYWQKPHYNWGNAVVHSDLYKKINPIRARYDYTPNDYSQMPFYLGSVPQLNWLYGSLDYSFQKYHKHYQAHDDWVPDRKARTLGTK
Ga0192981_1012249523300019048MarineTWGINIYNMSAVNFYSSNYPEYMWQKPHYNWGNKIIASDIYKKINPLRARYTYEPNDYSQMPFFMGVVPQSYWLYGNLDYSFNKHHRHY
Ga0192981_1012450513300019048MarineMTAINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAVNPIRARYDYTPNDYTQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0188866_101007723300019095Freshwater LakeTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0192972_103449623300019108MarineSAINFYSSNFPEYYWQKPHYNWGNAVVHSPLYKKINPIRARYDYAPNEYSQMPFYLGSVPQFNWLYGSLDYSFQKYHKHY
Ga0180032_103924413300019201EstuarineEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY
Ga0182073_142327013300019274Salt MarshNFYSSNIPEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0182081_134929413300019277Salt MarshEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0182068_142031033300019280Salt MarshGNFYSSNIPEYYWQKPHYNLGNQIIHSDMYKKLNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0182068_156390023300019280Salt MarshGNFYSSNIPEYYWQKPHYDLGNKIIHNDTYRMLNPVRQRYEYTPNEYAQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0211726_1021990323300020161FreshwaterMSAINFYSSNFPEYYWQKPHYDLGNSIIHSNVYKKMNPIRARYDYAPNQYTQMPFYLGSIPQFNWLYGSLDYSFQKYHKHY
Ga0206127_111973513300020169SeawaterMSCINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0211686_1008694213300020382MarineMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFNKYHRHI
Ga0194133_1063554323300021091Freshwater LakeKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHY
Ga0206687_143871823300021169SeawaterMSAINFYSSNFPEYYWQKPHYNLGNQLMHSDLYKKLNPIRARYDYTPNDYSQMPIFLGVVPQFFWLYGNLDYSFKKYHRHY
Ga0206687_176584013300021169SeawaterAINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAVNPIRARYDYTPNDYTQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0206688_1036235813300021345SeawaterKMTTVNFYSSNFPEYMWQKPHYNWGNAIIHSDLYKKINPIRARYDYTPNDYSQMPFYLGVVPQAYWLYGNLDYSFKKHHRLI
Ga0206692_148347123300021350SeawaterTGNFYSSNIPEYYWQKPHYDYGNMIIHSDLYKKMNPVRQRYEYQPNEYTQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0206689_1103972033300021359SeawaterSNFPEYFTQKTHYNWGNAIVHSDAYKKLNPIRQRYEYQPNEYSQMPFHLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0206123_1014982513300021365SeawaterMSCINFYSSNFPEYFWQKPHYNWGIKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0063132_12974413300021872MarinePEYLWQKPHYDFGNKLIHSDLYKKINPIRARYDYKPNDYSQMPFFLGVVPQAYWLYGNLDYSFRKYHRHY
Ga0063105_103121613300021887MarineINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0063090_104302813300021890MarineWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0063097_101070713300021898MarineAINFYSSNFPEYFTQKTHYNWGNAIVHSDAYKRLNPIRQRYEYQPNEYSTMPSYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0063104_103573213300021913MarineCINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0063096_104177613300021925MarineYFTQKTHYNWGNAIVHSDAYKRLNPIRQRYEYQPNEYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0063092_103087713300021936MarineNMSCINFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0222717_1044124323300021957Estuarine WaterMTTGNFYSSNIPEYYWQKPHYDLGNRIIHNDTYRMLNPVRQRYEYTPNEYAQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0244777_1026998013300024343EstuarineMSAINFYSSNFPEYFWQKPHYNLGNRLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY
Ga0244777_1065885223300024343EstuarineMTAINFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY
Ga0209634_111638023300025138MarineMTAVNFYSSNFPEYLWQKPHYDFGNKLIHSDLYKKINPIRARYDYKPNDYSQMPFFLGVVPQAYWLYGNLDYSFRKYHRHY
Ga0209631_1037256513300025890Pelagic MarineMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0209190_113739523300027736Freshwater LakeMSAINFYSSNFPEYFWQKPHYNLGNKLIHNDLYKTLNPIRARYDYKPNDYTQMPFFFGVVPQFYWVYGNLDYSLNKVHRLY
Ga0209086_1038367313300027770Freshwater LakeMTAINFYSSNFPEYFWQKGHYNLGNQVVHSDLYKKVNILRSRFDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHY
Ga0209500_1016845223300027782Freshwater LakeTTINFYSSNFPEYYWQKPHYNWGNTVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY
Ga0209302_1017222413300027810MarineMSMINFYSSNIPGYMWQKPHYDLGNRMIHSDIYKALNPLRSRYDYNPGSYTQMPFFLGVVPQFYWTYGNLDYSFNKHHRHY
Ga0209450_1035845923300027885Freshwater Lake SedimentMTTINFYSSNFPEYYWQKPHYNWGNTVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHY
Ga0256413_126809123300028282SeawaterGNFYSSNIPEYYWQKPHYDLGNRIIHNDTYRMLNPVRQRYEYTPNEYAQMPFYLHVVPQFYWLYGNLDYSFKKWHRHY
Ga0210315_102005913300028329EstuarineNFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHY
Ga0247638_116264823300030551SoilSSNLPEYFWQKRHYNIGNKIVHSDVYKTLNPIRARYDYTPNDYSQMPYFLGHVPQFNWVYGNLDYSFNKYHRHY
Ga0307401_1019449613300030670MarineAVNFYSSNLPEYYWQKPHYNLGNKIVHSDLYKSLNPIRQRYDYKPNEYSQMPFFLGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307403_1024911933300030671MarineFYSSNYPEYMWQKPHYNWGNKIIASDIYKKINPIRARYTYTPNDYAQMPFFMGVVPQSYWLYGNLDYSFNKHHRHY
Ga0307398_1025141833300030699MarineTAVNFYSSNLPEYYWQKPHYNLGNKIVHSDLYKSLNPIRQRYDYKPNEYSQMPFFLGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307398_1028390413300030699MarineRSSMSAINFYSSNFPEYYWQKPHYNWGNAVVHSPLYKKINPIRARYDYAPNEYSQMPFYLGSVPQFNWLYGSLDYSF
Ga0307398_1028978313300030699MarineNMSAVNFYSSNYPEYMWQKPHYNWGNKIIASDIYKKINPIRARYTYTPNDYAQMPFFMGVVPQSYWLYGNLDYSFNKHHRHY
Ga0075398_1145944413300030778SoilPFELNNLRNMNINFYSSNFPEYYWQKPHYNLGNKIIHSDLYKKLNPIRARYDFKPNEYSQMPYFLGLIPQFTWVYGSLDYSFHKYHRHY
Ga0073964_1145471813300030788MarineWQKPHYNWGNSVITSSAYKKLNPIRARYDYTPNDYSQMPFFLGVVPQAYWLYGNLDYSFKHHHRHI
Ga0073964_1151697313300030788MarineWQKPHYNWGNSIIHSDLYKKINPIRARYDYTPNDYSQMPFYLGVVPQAYWLYGNLDYSFKKHHRLI
Ga0073964_1159071023300030788MarineSVVNFYSSNIPEYYWQKPHYNLGNNIIHSDMYKMLNPVRARYDFKANEYTQMPSFFGVVPQMYWLYGNLDYSLKKWHRHY
Ga0073963_1123385823300030859MarineTFNFYSSNFPEYIWQKPHYNWGNSVITSSAYKKLNPIRARYDYTPNDYSQMPFFLGVVPQAYWLYGNLDYSFKHHHRHI
Ga0073972_1113991513300030865MarineFNFYSSNFPEYIWQKPHYNWGNSVITSSAYKKLNPIRARYDYTPNDYSQMPFFLGVVPQAYWLYGNLDYSFKHHHRHI
Ga0151491_107426913300030961MarineFYSSNIPEYYWQKPHYNLGNNIIHSDMYKMLNPVRARYDFKANEYTQMPSFFGVVPQMYWLYGNLDYSLKKWHRHY
Ga0073975_154103113300031007MarineKPHWNLGNQIVHSDAYKMMNPVRARYDFKANEYTQMPMFFGVVPQMYWLYGNLDYSLKKWHRHY
Ga0170824_12022205043300031231Forest SoilREPFELNNLRNMNINFYSSNFPEYYWQKPHYNLGNKIIHSDLYKKLNPIRARYDFKPNEYSQMPYFLGLIPQFTWVYGSLDYSFHKYHRHY
Ga0307995_121138523300031696MarineMSCINFYSSNFPEYFWQKPHYNFGNKVIHSDAYKSINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0307386_1020497113300031710MarineMTAVNFYSSNLPEYYWQKPHYNLGNKIVHSDLYKSLNPIRQRYDYKPNEYSQMPFFLGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307386_1026896723300031710MarineFYSSNFPEYFWQKPHYNWGNKVIHSDAYKAINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0307396_1018590023300031717MarineMSAVNFYSSNYPEYMWQKPHYNWGNKIIASDIYKKINPIRARYTYTPNDYAQMPFFMGVVPQSYWLYGNLDYSFNKHHRHY
Ga0307391_1024013413300031729MarineYRSSMSAINFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307391_1024384323300031729MarineAVNFYSSNFPEYMWQKPHYNLGNQLIHSDLYKKINPIRARYDYKTNDYSQMPFYLGVVPQAYWLYGNLDYSFHKYHRHY
Ga0307394_1012860633300031735MarineSCINFYSSNFPEYFWQKPHYNWGNQMIHSDVYKKINPIRARYDYTPNDYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0307394_1014773913300031735MarineVNFYSSNLPEYYWQKPHYNLGNKIVHSDLYKSLNPIRQRYDYKPNEYSQMPFFLGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307387_1033461833300031737MarineEYFWQKPHYNWGNKVIHSDAYKAVNPIRARYDYTPNDYTQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0307384_1015457313300031738MarineNFYSSQFPEYMNQKPHYNWGNKVIHSDIYKKLNPIRARYEYTPNDYSQMPFFLGVVPQHYWLYGNLDYSFNKYHRHY
Ga0307384_1015715013300031738MarineNFYSSNYPEYMWQKPHYNWGNKIIASDIYKKINPLRARYTYEPNDYSQMPFFMGVVPQSYWLYGNLDYSFNKHHRHY
Ga0307384_1053835813300031738MarineSSNFPEYFTQKTHYNWGNAIVHSDAYKKLNPIRQRYEYQPNEYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0307383_1021002413300031739MarineAINFYSSNFPEYFTQKTHYNWGNAIVHSDAYKKLNPIRQRYEYQPNEYSQMPFYLGVVPQFYWLYGNLDYSFKKYHRHY
Ga0314667_1025506613300032520SeawaterIMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0314680_1024937013300032521SeawaterVPRSEFKFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0314685_1017664423300032651SeawaterLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0314669_1041686523300032708SeawaterAINFYSSNFPEYYWQKPHYNLGNSIIHSDLYKKLNPIRARYDYAPNQYTQMPFYFGVVPQFYWLYGNLDYSFKKYHRHY
Ga0314690_1018862613300032713SeawaterMMRPTRVAPPSSSSAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0315741_1045259723300032739Forest SoilNVPEYYWQKRHYNIGNAIIHSDAYKTLNIIRARYDYIPNDYTQMPYFLGHVPQFNWVYGNLDYSFNKYHRHY
Ga0314713_1013821513300032748SeawaterAYRSRHHILPSPAVPSFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYQPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY
Ga0307390_1030961623300033572MarineKKKAMSAINFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.