Basic Information | |
---|---|
Family ID | F044622 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 43 residues |
Representative Sequence | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFASSRR |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.70 % |
% of genes near scaffold ends (potentially truncated) | 99.35 % |
% of genes from short scaffolds (< 2000 bps) | 88.96 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.740 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (27.273 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.948 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.195 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF00156 | Pribosyltran | 83.77 |
PF11734 | TilS_C | 12.99 |
PF01434 | Peptidase_M41 | 0.65 |
PF01979 | Amidohydro_1 | 0.65 |
PF13540 | RCC1_2 | 0.65 |
PF01613 | Flavin_Reduct | 0.65 |
PF13517 | FG-GAP_3 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.74 % |
Unclassified | root | N/A | 40.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002562|JGI25382J37095_10030933 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
3300002908|JGI25382J43887_10055086 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300005171|Ga0066677_10773966 | Not Available | 532 | Open in IMG/M |
3300005175|Ga0066673_10902391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
3300005176|Ga0066679_10129164 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300005180|Ga0066685_10499437 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300005187|Ga0066675_10043342 | All Organisms → cellular organisms → Bacteria | 2726 | Open in IMG/M |
3300005187|Ga0066675_10953473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 646 | Open in IMG/M |
3300005445|Ga0070708_100187708 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
3300005446|Ga0066686_10806001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 624 | Open in IMG/M |
3300005446|Ga0066686_11064942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
3300005446|Ga0066686_11137771 | Not Available | 500 | Open in IMG/M |
3300005451|Ga0066681_10605098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 674 | Open in IMG/M |
3300005471|Ga0070698_101978295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 536 | Open in IMG/M |
3300005574|Ga0066694_10229066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 881 | Open in IMG/M |
3300005576|Ga0066708_10496054 | Not Available | 786 | Open in IMG/M |
3300006034|Ga0066656_10152999 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300006175|Ga0070712_101620993 | Not Available | 566 | Open in IMG/M |
3300006794|Ga0066658_10926363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 504 | Open in IMG/M |
3300006800|Ga0066660_10728077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 811 | Open in IMG/M |
3300006846|Ga0075430_101351475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 586 | Open in IMG/M |
3300006852|Ga0075433_10278353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1482 | Open in IMG/M |
3300006904|Ga0075424_102589366 | Not Available | 530 | Open in IMG/M |
3300009012|Ga0066710_100042005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5531 | Open in IMG/M |
3300009012|Ga0066710_100908061 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300009012|Ga0066710_101497054 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300009090|Ga0099827_11789521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 535 | Open in IMG/M |
3300009090|Ga0099827_11823787 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
3300009137|Ga0066709_102432281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 710 | Open in IMG/M |
3300009137|Ga0066709_102956035 | Not Available | 625 | Open in IMG/M |
3300009162|Ga0075423_12764974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
3300009678|Ga0105252_10245028 | Not Available | 783 | Open in IMG/M |
3300010081|Ga0127457_1020904 | Not Available | 613 | Open in IMG/M |
3300010087|Ga0127492_1019463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
3300010091|Ga0127485_1017776 | Not Available | 545 | Open in IMG/M |
3300010091|Ga0127485_1074494 | Not Available | 646 | Open in IMG/M |
3300010091|Ga0127485_1074724 | Not Available | 600 | Open in IMG/M |
3300010099|Ga0127450_1081004 | Not Available | 810 | Open in IMG/M |
3300010107|Ga0127494_1136791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 682 | Open in IMG/M |
3300010114|Ga0127460_1056350 | Not Available | 583 | Open in IMG/M |
3300010116|Ga0127466_1134605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 514 | Open in IMG/M |
3300010122|Ga0127488_1066560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 679 | Open in IMG/M |
3300010126|Ga0127482_1176043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
3300010132|Ga0127455_1019511 | Not Available | 636 | Open in IMG/M |
3300010133|Ga0127459_1027699 | Not Available | 560 | Open in IMG/M |
3300010134|Ga0127484_1173577 | Not Available | 506 | Open in IMG/M |
3300010141|Ga0127499_1203666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1131 | Open in IMG/M |
3300010141|Ga0127499_1209455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 603 | Open in IMG/M |
3300010142|Ga0127483_1203512 | Not Available | 656 | Open in IMG/M |
3300010304|Ga0134088_10348321 | Not Available | 719 | Open in IMG/M |
3300010326|Ga0134065_10207595 | Not Available | 712 | Open in IMG/M |
3300010336|Ga0134071_10043228 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300010336|Ga0134071_10636519 | Not Available | 560 | Open in IMG/M |
3300010905|Ga0138112_1030053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
3300012199|Ga0137383_10781569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 697 | Open in IMG/M |
3300012203|Ga0137399_11750738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
3300012206|Ga0137380_10742110 | Not Available | 850 | Open in IMG/M |
3300012207|Ga0137381_11185941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
3300012211|Ga0137377_10523658 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300012211|Ga0137377_11749024 | Not Available | 542 | Open in IMG/M |
3300012212|Ga0150985_114477974 | Not Available | 841 | Open in IMG/M |
3300012224|Ga0134028_1125675 | Not Available | 658 | Open in IMG/M |
3300012353|Ga0137367_10213862 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300012357|Ga0137384_10960219 | Not Available | 688 | Open in IMG/M |
3300012373|Ga0134042_1150688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
3300012373|Ga0134042_1167729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 722 | Open in IMG/M |
3300012377|Ga0134029_1090430 | Not Available | 645 | Open in IMG/M |
3300012381|Ga0134026_1030455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 799 | Open in IMG/M |
3300012383|Ga0134033_1062761 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300012387|Ga0134030_1050720 | Not Available | 668 | Open in IMG/M |
3300012387|Ga0134030_1133166 | Not Available | 551 | Open in IMG/M |
3300012389|Ga0134040_1043801 | Not Available | 656 | Open in IMG/M |
3300012392|Ga0134043_1118919 | Not Available | 681 | Open in IMG/M |
3300012399|Ga0134061_1098358 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300012401|Ga0134055_1212278 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300012403|Ga0134049_1403609 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300012410|Ga0134060_1332814 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300012917|Ga0137395_10337599 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300012918|Ga0137396_10622249 | Not Available | 798 | Open in IMG/M |
3300012918|Ga0137396_10766844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 710 | Open in IMG/M |
3300012918|Ga0137396_11077798 | Not Available | 576 | Open in IMG/M |
3300012922|Ga0137394_10078651 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
3300012922|Ga0137394_11497872 | Not Available | 534 | Open in IMG/M |
3300012930|Ga0137407_10355513 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300012977|Ga0134087_10032110 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
3300014150|Ga0134081_10337357 | Not Available | 550 | Open in IMG/M |
3300014154|Ga0134075_10464882 | Not Available | 564 | Open in IMG/M |
3300015359|Ga0134085_10566132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
3300017659|Ga0134083_10003051 | All Organisms → cellular organisms → Bacteria | 5132 | Open in IMG/M |
3300017659|Ga0134083_10143070 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300017927|Ga0187824_10275129 | Not Available | 590 | Open in IMG/M |
3300018054|Ga0184621_10322692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
3300018056|Ga0184623_10468411 | Not Available | 542 | Open in IMG/M |
3300018431|Ga0066655_10002701 | All Organisms → cellular organisms → Bacteria | 6790 | Open in IMG/M |
3300018468|Ga0066662_11806711 | Not Available | 640 | Open in IMG/M |
3300019259|Ga0184646_1466984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 741 | Open in IMG/M |
3300019259|Ga0184646_1602680 | Not Available | 751 | Open in IMG/M |
3300019279|Ga0184642_1040149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 681 | Open in IMG/M |
3300019877|Ga0193722_1009925 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300021081|Ga0210379_10105887 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300022195|Ga0222625_1709593 | Not Available | 524 | Open in IMG/M |
3300022204|Ga0224496_10294211 | Not Available | 664 | Open in IMG/M |
3300022226|Ga0224512_10178995 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300022724|Ga0242665_10121969 | Not Available | 796 | Open in IMG/M |
3300025324|Ga0209640_10894356 | Not Available | 692 | Open in IMG/M |
3300025324|Ga0209640_11289207 | Not Available | 542 | Open in IMG/M |
3300025535|Ga0207423_1106581 | Not Available | 509 | Open in IMG/M |
3300025885|Ga0207653_10021479 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300025922|Ga0207646_10049909 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
3300026277|Ga0209350_1088509 | Not Available | 804 | Open in IMG/M |
3300026297|Ga0209237_1222256 | Not Available | 588 | Open in IMG/M |
3300026301|Ga0209238_1230379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
3300026313|Ga0209761_1328211 | Not Available | 521 | Open in IMG/M |
3300026314|Ga0209268_1164697 | Not Available | 545 | Open in IMG/M |
3300026324|Ga0209470_1006343 | All Organisms → cellular organisms → Bacteria | 7566 | Open in IMG/M |
3300026324|Ga0209470_1196052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 859 | Open in IMG/M |
3300026328|Ga0209802_1222061 | Not Available | 697 | Open in IMG/M |
3300026332|Ga0209803_1274005 | Not Available | 579 | Open in IMG/M |
3300026524|Ga0209690_1086347 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300026524|Ga0209690_1138805 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300026537|Ga0209157_1282559 | Not Available | 618 | Open in IMG/M |
3300026538|Ga0209056_10529428 | Not Available | 605 | Open in IMG/M |
3300026542|Ga0209805_1147815 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300026547|Ga0209156_10137151 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300027643|Ga0209076_1187867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
3300027663|Ga0208990_1168308 | Not Available | 571 | Open in IMG/M |
3300027671|Ga0209588_1123169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 829 | Open in IMG/M |
3300027748|Ga0209689_1055878 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
3300027787|Ga0209074_10484614 | Not Available | 534 | Open in IMG/M |
3300027846|Ga0209180_10331055 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300027846|Ga0209180_10577330 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 623 | Open in IMG/M |
3300027875|Ga0209283_10068782 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300027880|Ga0209481_10430734 | Not Available | 678 | Open in IMG/M |
3300027903|Ga0209488_10417175 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300027903|Ga0209488_10672168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
3300027909|Ga0209382_11749886 | Not Available | 608 | Open in IMG/M |
3300028380|Ga0268265_10678428 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300028536|Ga0137415_10600348 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300028536|Ga0137415_10690061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 833 | Open in IMG/M |
3300031226|Ga0307497_10011019 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
3300031562|Ga0310886_10781849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 600 | Open in IMG/M |
3300031576|Ga0247727_10192719 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
3300031949|Ga0214473_10058377 | All Organisms → cellular organisms → Bacteria | 4516 | Open in IMG/M |
3300032180|Ga0307471_100874858 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300032180|Ga0307471_103596043 | Not Available | 548 | Open in IMG/M |
3300032805|Ga0335078_11493343 | Not Available | 756 | Open in IMG/M |
3300032892|Ga0335081_10896892 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300032954|Ga0335083_11232382 | Not Available | 579 | Open in IMG/M |
3300033407|Ga0214472_10699218 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300033433|Ga0326726_10094381 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
3300033500|Ga0326730_1048726 | Not Available | 820 | Open in IMG/M |
3300033815|Ga0364946_090180 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 673 | Open in IMG/M |
3300034165|Ga0364942_0320374 | Not Available | 508 | Open in IMG/M |
3300034178|Ga0364934_0407338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 27.27% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.90% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.95% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.95% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.30% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.30% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J37095_100309331 | 3300002562 | Grasslands Soil | MPNRLPPPRDFNWARTLRTLSFWALLIVGAVALLQFAQNR |
JGI25382J43887_100550861 | 3300002908 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASS |
Ga0066677_107739662 | 3300005171 | Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASNR |
Ga0066673_109023912 | 3300005175 | Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRR |
Ga0066679_101291643 | 3300005176 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAE |
Ga0066685_104994373 | 3300005180 | Soil | MANRVPPPREFNWGRTLRTLSFWALLIVGSIALVQFAASRRQDA |
Ga0066675_100433421 | 3300005187 | Soil | MAGRLPPREFNWARTIRTLSFWALLIVGSIALVQFASSRR |
Ga0066675_109534731 | 3300005187 | Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGSVVLVQFAANRRPEAVEISYS |
Ga0070708_1001877083 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNRVPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAARTRQDTAEISYSDFT |
Ga0066686_108060011 | 3300005446 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREE |
Ga0066686_110649421 | 3300005446 | Soil | MPNRLPPPRDFNWARTLRTLSFWALLIVGAVALLQFAQNRRQE |
Ga0066686_111377711 | 3300005446 | Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASNRRQEAV |
Ga0066681_106050982 | 3300005451 | Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITYT |
Ga0070698_1019782952 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRVPPPPRELNWARMLRTLSFWALLIVGSVALVKFAGGRGQDADFT |
Ga0066694_102290661 | 3300005574 | Soil | MPNRLPPPPREFSWIRVLRTLSFWGLVIVGCIALVQFAAGRRE |
Ga0066708_104960541 | 3300005576 | Soil | MAGRLPPREFNWARTIRTLSFWALLIVGSIALVQFASSRRQEAVDI |
Ga0066656_101529991 | 3300006034 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQL |
Ga0070712_1016209931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRLPPPPREFSWSRTLRTFSFWALLLIGSVALVQLAANRRQETA |
Ga0066658_109263632 | 3300006794 | Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQL |
Ga0066660_107280772 | 3300006800 | Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITYS |
Ga0075430_1013514752 | 3300006846 | Populus Rhizosphere | MANRVPPPPREFNWGRMLRTLSFWALLIVGSIALVQYASS |
Ga0075433_102783533 | 3300006852 | Populus Rhizosphere | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITYT |
Ga0075424_1025893662 | 3300006904 | Populus Rhizosphere | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQF |
Ga0066710_1000420058 | 3300009012 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSR |
Ga0066710_1009080611 | 3300009012 | Grasslands Soil | MAGRLPPREFNWARTIRTLSFWALLIVGSIALVQFASSRRQEA |
Ga0066710_1014970541 | 3300009012 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIAGSIALVQFASSR |
Ga0099827_117895211 | 3300009090 | Vadose Zone Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITY |
Ga0099827_118237872 | 3300009090 | Vadose Zone Soil | MANRIPPPPLEFNWARMLRTLSFWALLIVGTIALV |
Ga0066709_1024322812 | 3300009137 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREE |
Ga0066709_1029560352 | 3300009137 | Grasslands Soil | MAGRLPPREFNWARTIRTLSFWALLIVGSIALVQFASSRRQEAVD |
Ga0075423_127649741 | 3300009162 | Populus Rhizosphere | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALV |
Ga0105252_102450281 | 3300009678 | Soil | MANRIQPPRDFNWGRTLRTLSFWALLIAGSIALVQF |
Ga0127457_10209042 | 3300010081 | Grasslands Soil | MANRVPPPREFNWGRTLRTLSFWALLIVGSIALVQF |
Ga0127492_10194631 | 3300010087 | Grasslands Soil | VPNRLPPPPRKFNWAQMLRTLSFWALLIVGSIALVKFA |
Ga0127485_10177761 | 3300010091 | Grasslands Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQFASSRRQEAVEI |
Ga0127485_10744942 | 3300010091 | Grasslands Soil | VAGRIPPREFNWARTIRTLSFWALLIVGSIALVQFASSRRQEAVD |
Ga0127485_10747241 | 3300010091 | Grasslands Soil | MAGRLPPREFNWARTIRTLSFWALLIVGSIALVQFASSR |
Ga0127450_10810041 | 3300010099 | Grasslands Soil | MANRLPPPPREFSWARVLRTLSFWALVIVGAIALVQFAAGRREP |
Ga0127494_11367912 | 3300010107 | Grasslands Soil | MPNRLPPPPREFSWIRVLRTLSFWGLVIVGCIALVQFAAGRREPTADLNY |
Ga0127460_10563502 | 3300010114 | Grasslands Soil | MPNRLPPPPREFSWIRVLRTLSFWGLVIVGCIALVQFAAGRREPTADLN |
Ga0127466_11346052 | 3300010116 | Grasslands Soil | MANRLPPPPREVIWVRMLRTLSFWALLIVGTIALVQLASSRRREEAEITYT |
Ga0127488_10665601 | 3300010122 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLAS |
Ga0127482_11760432 | 3300010126 | Grasslands Soil | MADRIPPPPREFNWARMFRTLSFWALLIVGTIALVQVASKGRREEAEITFSQFQDELN |
Ga0127455_10195111 | 3300010132 | Grasslands Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGSVVLVQFAANR |
Ga0127459_10276991 | 3300010133 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRQETV |
Ga0127484_11735771 | 3300010134 | Grasslands Soil | VAGRIPPREFNWARTIRTLSFWALLIVGSIALVQFAS |
Ga0127499_12036662 | 3300010141 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIAGSIALVQFASSRRPETMDISYS* |
Ga0127499_12094552 | 3300010141 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLAS |
Ga0127483_12035122 | 3300010142 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRPETVD |
Ga0134088_103483211 | 3300010304 | Grasslands Soil | MPNRLPPPRDFNWARTLRTLSFWALLIVGAVALLQFAQNRRQEPDISFT |
Ga0134065_102075951 | 3300010326 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRPETV |
Ga0134071_100432281 | 3300010336 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEISYSQ |
Ga0134071_106365192 | 3300010336 | Grasslands Soil | MANRIPPQREFSWARTIRTLSFWALLIVGSILLVQFASSRRQEAVDISY |
Ga0138112_10300532 | 3300010905 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEIN |
Ga0137383_107815691 | 3300012199 | Vadose Zone Soil | MPNRVPPPREFSWARTLRTLSFWALLIVGSIFLVQF |
Ga0137399_117507382 | 3300012203 | Vadose Zone Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEI |
Ga0137380_107421101 | 3300012206 | Vadose Zone Soil | MANRVPPPREFNWGRTLRTLSFWALLIVGSIALVQFASSRRQ |
Ga0137381_111859412 | 3300012207 | Vadose Zone Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEINLTQFN |
Ga0137377_105236581 | 3300012211 | Vadose Zone Soil | MANRIPPPREFSWARTIRTLSFWALLIVGSVALVQF |
Ga0137377_117490241 | 3300012211 | Vadose Zone Soil | MPNRIPPPPRELNWARMLRTLSFWALLIVGSVALVKFAGGRGQDAV |
Ga0150985_1144779741 | 3300012212 | Avena Fatua Rhizosphere | MANRIPPPRDFNWGRTLRTLSFWALLIVGSIALVQFASSRRQDAVE |
Ga0134028_11256751 | 3300012224 | Grasslands Soil | MANRVPPPREFSWTRTLRTLSFWALLIVGSIFLVQFASNRRQEAVDLS |
Ga0137367_102138621 | 3300012353 | Vadose Zone Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIALVQF |
Ga0137384_109602191 | 3300012357 | Vadose Zone Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQFASSRRQEAV |
Ga0134042_11506882 | 3300012373 | Grasslands Soil | VAGRIPPREFNWARTIRTLSFWALLIVGSIALVQFASSCRQ |
Ga0134042_11677291 | 3300012373 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQ |
Ga0134029_10904302 | 3300012377 | Grasslands Soil | MPNRIPPPREFNWARMLRTLSFWALLVVGCIALVQFA |
Ga0134026_10304552 | 3300012381 | Grasslands Soil | MPDRIPPPPREFNWGRMLRTLSFWALLIVGTIALV |
Ga0134033_10627611 | 3300012383 | Grasslands Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQFASSRRQEAVDIS |
Ga0134030_10507201 | 3300012387 | Grasslands Soil | MPNRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASNRRQEALE |
Ga0134030_11331662 | 3300012387 | Grasslands Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIALVQFASSR |
Ga0134040_10438012 | 3300012389 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFASSRR |
Ga0134043_11189192 | 3300012392 | Grasslands Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGSVVLVQFAANRRPEAVEISY |
Ga0134061_10983583 | 3300012399 | Grasslands Soil | MPNRLPPPREFNWARTLRTLSFWALLIVGSIALVQ |
Ga0134055_12122782 | 3300012401 | Grasslands Soil | REFNWARTLRTLSFWALLIVGSIALVQFASSRRQ* |
Ga0134049_14036093 | 3300012403 | Grasslands Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASS |
Ga0134060_13328142 | 3300012410 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEIT |
Ga0137395_103375991 | 3300012917 | Vadose Zone Soil | MPNRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASNRRQEAVELSYTPQFTEQL |
Ga0137396_106222492 | 3300012918 | Vadose Zone Soil | MPNRVPPPREFNWGRTLRTLSFWALVAVGCVLLVQFASSRR |
Ga0137396_107668442 | 3300012918 | Vadose Zone Soil | MPNRLPSPPREFNWAQMLRTLSFWALLIVGSIALVKF |
Ga0137396_110777981 | 3300012918 | Vadose Zone Soil | MANRIPPPREFSWTRTLRTLSFWALLIVGSIALVQF |
Ga0137394_100786515 | 3300012922 | Vadose Zone Soil | MADRIPPPPREFNWSRMLRTLSFWALLIVGTIALVQIAS |
Ga0137394_114978722 | 3300012922 | Vadose Zone Soil | MANRNPPPREFSWARTVRTLSFWALLIVGSIALVQFAANRRQE |
Ga0137407_103555131 | 3300012930 | Vadose Zone Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRR |
Ga0134087_100321101 | 3300012977 | Grasslands Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGSVVLVQ |
Ga0134081_103373572 | 3300014150 | Grasslands Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGTIALVQLASSRRREEAEITY |
Ga0134075_104648821 | 3300014154 | Grasslands Soil | MANRIPPQREFSWARTIRTLSFWALLIVGSILLVQFASSRRQEAV |
Ga0134085_105661321 | 3300015359 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRRE |
Ga0134083_100030511 | 3300017659 | Grasslands Soil | MPNRLPPPREFNWARTLRTLSFWALLIVGSIALVQFA |
Ga0134083_101430703 | 3300017659 | Grasslands Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRQE |
Ga0187824_102751291 | 3300017927 | Freshwater Sediment | MTNRVPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAARTRQDTVEISYSD |
Ga0184621_103226921 | 3300018054 | Groundwater Sediment | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEA |
Ga0184623_104684112 | 3300018056 | Groundwater Sediment | MANRTPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAA |
Ga0066655_100027011 | 3300018431 | Grasslands Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASNRRQEA |
Ga0066662_118067112 | 3300018468 | Grasslands Soil | MANRVPPPRDFSWARTLRTLSFWALLTGAPVPLGPFAPNKQAAVG |
Ga0184646_14669841 | 3300019259 | Groundwater Sediment | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEIKY |
Ga0184646_16026801 | 3300019259 | Groundwater Sediment | MAERLPPPKRDVNWGRVSRTVAFWALLIVGSVALVQLAGRRR |
Ga0184642_10401491 | 3300019279 | Groundwater Sediment | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEIKYSEFM |
Ga0193722_10099255 | 3300019877 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEIKYSEFV |
Ga0210379_101058871 | 3300021081 | Groundwater Sediment | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEVTY |
Ga0222625_17095932 | 3300022195 | Groundwater Sediment | MANRVPPPRDFQWARLLRTLSFWALLTVGVVALIQFTSGRRQDVGDVSYTRFA |
Ga0224496_102942112 | 3300022204 | Sediment | MANRTPPPPREFNWARMLRTVSFWALVIVGSIALVQFASQRRQEAAEVSYSQFAEEL |
Ga0224512_101789951 | 3300022226 | Sediment | MANRTPPPPREFNWARMLRTVSFWALVIVGSIALVQFASQRRQEA |
Ga0242665_101219691 | 3300022724 | Soil | MANRIQPPRDFNWGRTLRTLSFWALLIAGSIALVQ |
Ga0209640_108943561 | 3300025324 | Soil | MANRIPPQRDFQWARLLRTLSFWALLTVGVVALIQFTAGRRQDVGDVSY |
Ga0209640_112892071 | 3300025324 | Soil | MANRVPPPPREFNWARMLRTLSFWALLIVGSIALVQFA |
Ga0207423_11065811 | 3300025535 | Natural And Restored Wetlands | MANRPPPPPREFDWARMLRTLSFWALVIVGSIALVQFAST |
Ga0207653_100214791 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRVPPPREFSWARTVRTLSFWALLIVGSIALVQFAANRR |
Ga0207646_100499097 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGRLPPRDFNWARTIRTLSFWALLIVGSIALVQFAS |
Ga0209350_10885092 | 3300026277 | Grasslands Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQ |
Ga0209237_12222561 | 3300026297 | Grasslands Soil | MPNRLPPPRDFNWARTLRTLSFWALLIVGAVALLQ |
Ga0209238_12303792 | 3300026301 | Grasslands Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALV |
Ga0209761_13282112 | 3300026313 | Grasslands Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQFASS |
Ga0209268_11646971 | 3300026314 | Soil | MPNRLPPPPREFSWIRVLRTLSFWGLVIVGCIALVQFAAGR |
Ga0209470_100634310 | 3300026324 | Soil | MANRIPPPREFSWARTLRTLSFWALLIAGSIALVQNDSV |
Ga0209470_11960522 | 3300026324 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLA |
Ga0209802_12220611 | 3300026328 | Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRQETVDISYSQ |
Ga0209803_12740052 | 3300026332 | Soil | MPNRVPPPREFNWARTLRTLSFWALLIVGSIALVQFASSRR |
Ga0209690_10863473 | 3300026524 | Soil | MANRIPPPREFSWARTIRTLSFWALLIVGSVALVQFAANRRP |
Ga0209690_11388051 | 3300026524 | Soil | MANRVPPPREFSWARTLRTLSFWALLVVGSIFLVQFASNRRQ |
Ga0209157_12825592 | 3300026537 | Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAANRRPETVDISY |
Ga0209056_105294282 | 3300026538 | Soil | MANRVPPPREFSWARTLRTLSFWALLIVGSIFLVQFASN |
Ga0209805_11478151 | 3300026542 | Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITYSE |
Ga0209156_101371511 | 3300026547 | Soil | MPNRIPPPREFSWARTLRTLSFWALLIVGSVVLVQFAANRRPEAVEIS |
Ga0209076_11878671 | 3300027643 | Vadose Zone Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRR |
Ga0208990_11683082 | 3300027663 | Forest Soil | MANRIPPPREFSWARTLRTLSFWALLIVGSIALVQFAASRRQE |
Ga0209588_11231691 | 3300027671 | Vadose Zone Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRR |
Ga0209689_10558781 | 3300027748 | Soil | MPNRLPPPRDFNWARTLRTLSFWALLIVGAVALLQFAQNRR |
Ga0209074_104846142 | 3300027787 | Agricultural Soil | MATRLPPREREFSWSRTFRTFSFWALLLVGAVALVQFAA |
Ga0209180_103310551 | 3300027846 | Vadose Zone Soil | MPNRLPPPPREFNWAQMLRTLSFWALLIVGSIALV |
Ga0209180_105773302 | 3300027846 | Vadose Zone Soil | MPNRLPQPPREFNWAQMLRTLSFWVLLIVGAIALVKFAAGRRQDA |
Ga0209283_100687823 | 3300027875 | Vadose Zone Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLA |
Ga0209481_104307343 | 3300027880 | Populus Rhizosphere | MPNRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEA |
Ga0209488_104171753 | 3300027903 | Vadose Zone Soil | MANRLPPTRDFNWGRTLRTLSFWALLIAGSIALVQ |
Ga0209488_106721681 | 3300027903 | Vadose Zone Soil | MANRIPPPREFSWTRTLRTLSFWALLIVGSIALVQFAANRRQE |
Ga0209382_117498861 | 3300027909 | Populus Rhizosphere | MANRPPPPPREFDWARMLRTLSFWALVIVGSIALVQF |
Ga0268265_106784282 | 3300028380 | Switchgrass Rhizosphere | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEAEITY |
Ga0137415_106003483 | 3300028536 | Vadose Zone Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSR |
Ga0137415_106900612 | 3300028536 | Vadose Zone Soil | MANRIPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRR |
Ga0307497_100110191 | 3300031226 | Soil | MANRLPPPPREFNWARMLRTLSFWALLIVGTVALVQLAS |
Ga0310886_107818491 | 3300031562 | Soil | MANRIQPPRDFNWGRTLRTLSFWALLIAGSIALVQFASSRRQDSVDM |
Ga0247727_101927193 | 3300031576 | Biofilm | MADRVPPPREFNWSRALRTVTFWALLVAGFVALAQVFAR |
Ga0214473_100583775 | 3300031949 | Soil | MANRTPPPPREFQLTRMLKTLSFWAFLIVGTVVLVQLAA |
Ga0307471_1008748583 | 3300032180 | Hardwood Forest Soil | MANRVPPPREFNWGRTLRTLSFWALLIVGSIVLVQFASSRRQDT |
Ga0307471_1035960431 | 3300032180 | Hardwood Forest Soil | MANRVPPPREFSWARTVRTLSFWALLIVGSIALVQFAANRRQETVEI |
Ga0335078_114933431 | 3300032805 | Soil | MANRMQPPREFNWGRTLRTLSFWALLIVGSIALVQFASSRRQD |
Ga0335081_108968923 | 3300032892 | Soil | MATRLPPPQREFSWSRTFRTFSFWALLLVGAVALVQFAANKKQDTAD |
Ga0335083_112323821 | 3300032954 | Soil | MATRLPPQRDFSWSRTFRNFSFWALLLVGAVALVQFAANK |
Ga0214472_106992181 | 3300033407 | Soil | MANRIPPPPREFNWGRMLRTLSFWALLIVGTIALVQIASR |
Ga0326726_100943814 | 3300033433 | Peat Soil | MTNRVPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAARTRQDSVDIGYSEFTAQVD |
Ga0326730_10487261 | 3300033500 | Peat Soil | MTNRAPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAARTRQDS |
Ga0364946_090180_536_673 | 3300033815 | Sediment | MANRLPPPPREFNWARMLRTLSFWALLIVGTIALVQLASSRRREEA |
Ga0364942_0320374_1_141 | 3300034165 | Sediment | MANRTPPPPREFQWSRMLRTLSFWAFLIVGTVLLVQLAARTRQDSVE |
Ga0364934_0407338_1_138 | 3300034178 | Sediment | MPDRIPPPPREFNWGRMLRTLSFWALLIVGTIALVQIASKGRREEA |
⦗Top⦘ |