NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044661

Metagenome / Metatranscriptome Family F044661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044661
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 45 residues
Representative Sequence QLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK
Number of Associated Samples 134
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.92 %
% of genes near scaffold ends (potentially truncated) 92.21 %
% of genes from short scaffolds (< 2000 bps) 88.31 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.870 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(7.792 % of family members)
Environment Ontology (ENVO) Unclassified
(21.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.753 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.24%    β-sheet: 0.00%    Coil/Unstructured: 56.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF00027cNMP_binding 16.23
PF07992Pyr_redox_2 7.14
PF04851ResIII 3.90
PF02837Glyco_hydro_2_N 3.25
PF08837DUF1810 3.25
PF00440TetR_N 1.95
PF16653Sacchrp_dh_C 1.95
PF13450NAD_binding_8 1.95
PF05960DUF885 1.95
PF13470PIN_3 1.30
PF11104PilM_2 1.30
PF12728HTH_17 1.30
PF10067DUF2306 1.30
PF01765RRF 1.30
PF12704MacB_PCD 1.30
PF08240ADH_N 1.30
PF13495Phage_int_SAM_4 0.65
PF02604PhdYeFM_antitox 0.65
PF03795YCII 0.65
PF02852Pyr_redox_dim 0.65
PF01946Thi4 0.65
PF04542Sigma70_r2 0.65
PF01738DLH 0.65
PF04226Transgly_assoc 0.65
PF05168HEPN 0.65
PF01229Glyco_hydro_39 0.65
PF00676E1_dh 0.65
PF07978NIPSNAP 0.65
PF08818DUF1801 0.65
PF13565HTH_32 0.65
PF14470bPH_3 0.65
PF03884YacG 0.65
PF13533Biotin_lipoyl_2 0.65
PF00348polyprenyl_synt 0.65
PF13751DDE_Tnp_1_6 0.65
PF14329DUF4386 0.65
PF12838Fer4_7 0.65
PF05649Peptidase_M13_N 0.65
PF01207Dus 0.65
PF09471Peptidase_M64 0.65
PF04014MazE_antitoxin 0.65
PF02641DUF190 0.65
PF04185Phosphoesterase 0.65
PF00263Secretin 0.65
PF104171-cysPrx_C 0.65
PF10041DUF2277 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 3.25
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 3.25
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.95
COG0233Ribosome recycling factorTranslation, ribosomal structure and biogenesis [J] 1.30
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG3024Endogenous inhibitor of DNA gyrase, YacG/DUF329 familyReplication, recombination and repair [L] 0.65
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.65
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.65
COG3664Beta-xylosidaseCarbohydrate transport and metabolism [G] 0.65
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.65
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.65
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.65
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.65
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.65
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.65
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.65
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.65
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.65
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.65
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.65
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.65
COG1635Thiazole synthase/Archaeal ribulose 1,5-bisphosphate synthetaseCarbohydrate transport and metabolism [G] 0.65
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.65
COG1993PII-like signaling proteinSignal transduction mechanisms [T] 0.65
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.65
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.65
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.87 %
UnclassifiedrootN/A20.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_101197875All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300001686|C688J18823_10003553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia9865Open in IMG/M
3300004092|Ga0062389_104089622Not Available548Open in IMG/M
3300005434|Ga0070709_10874327All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005454|Ga0066687_10004292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4883Open in IMG/M
3300005456|Ga0070678_100355256All Organisms → cellular organisms → Bacteria → Acidobacteria1261Open in IMG/M
3300005539|Ga0068853_100587202All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300005587|Ga0066654_10781119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300005602|Ga0070762_11225170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae520Open in IMG/M
3300005842|Ga0068858_100244233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1704Open in IMG/M
3300005921|Ga0070766_10106714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1666Open in IMG/M
3300005921|Ga0070766_11191054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300006028|Ga0070717_11185070Not Available695Open in IMG/M
3300006173|Ga0070716_101644801All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300006806|Ga0079220_11752344All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300007076|Ga0075435_100541135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1008Open in IMG/M
3300007265|Ga0099794_10165037All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300007788|Ga0099795_10121072All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300007982|Ga0102924_1013665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6497Open in IMG/M
3300009162|Ga0075423_12646830Not Available549Open in IMG/M
3300009518|Ga0116128_1157510All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009623|Ga0116133_1045636All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300009631|Ga0116115_1122919All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300009792|Ga0126374_10403001All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300010046|Ga0126384_11250708All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300010048|Ga0126373_10958481All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium920Open in IMG/M
3300010048|Ga0126373_11298796Not Available794Open in IMG/M
3300010048|Ga0126373_13309943Not Available501Open in IMG/M
3300010341|Ga0074045_10175131All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300010343|Ga0074044_10005091All Organisms → cellular organisms → Bacteria → Acidobacteria10758Open in IMG/M
3300010358|Ga0126370_11419298Not Available656Open in IMG/M
3300010358|Ga0126370_12668350Not Available500Open in IMG/M
3300010364|Ga0134066_10291429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300010371|Ga0134125_10933295All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300010371|Ga0134125_12459579Not Available566Open in IMG/M
3300010376|Ga0126381_105072865Not Available504Open in IMG/M
3300010379|Ga0136449_101486931All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300012189|Ga0137388_11167396All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300012285|Ga0137370_10534251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300012362|Ga0137361_10793291Not Available862Open in IMG/M
3300012917|Ga0137395_10285364All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300012925|Ga0137419_10288726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1250Open in IMG/M
3300012955|Ga0164298_10296346All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300012958|Ga0164299_10402222All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300012961|Ga0164302_10327441All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300012971|Ga0126369_10181513All Organisms → cellular organisms → Bacteria → Acidobacteria2011Open in IMG/M
3300012986|Ga0164304_11189727All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300013104|Ga0157370_10053277All Organisms → cellular organisms → Bacteria3858Open in IMG/M
3300013308|Ga0157375_10642953All Organisms → cellular organisms → Bacteria → Acidobacteria1217Open in IMG/M
3300013308|Ga0157375_12023404All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300014161|Ga0181529_10494771All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300014165|Ga0181523_10227837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1071Open in IMG/M
3300014169|Ga0181531_10086712All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300014501|Ga0182024_10822678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1129Open in IMG/M
3300014657|Ga0181522_10720570All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300014658|Ga0181519_11062341All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300016319|Ga0182033_11649958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4580Open in IMG/M
3300016341|Ga0182035_11055974Not Available722Open in IMG/M
3300016341|Ga0182035_11735487Not Available564Open in IMG/M
3300016341|Ga0182035_11954310Not Available533Open in IMG/M
3300016387|Ga0182040_11904116Not Available510Open in IMG/M
3300016422|Ga0182039_10269369Not Available1397Open in IMG/M
3300016445|Ga0182038_11631903Not Available580Open in IMG/M
3300017823|Ga0187818_10273112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300017938|Ga0187854_10318494All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300017940|Ga0187853_10164180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1057Open in IMG/M
3300017943|Ga0187819_10420391All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300017943|Ga0187819_10785831All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017955|Ga0187817_10814003Not Available596Open in IMG/M
3300017959|Ga0187779_10651571All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300017959|Ga0187779_11176896All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300017973|Ga0187780_10012201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6314Open in IMG/M
3300017975|Ga0187782_11220287All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300017999|Ga0187767_10256683All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300018014|Ga0187860_1283159All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018018|Ga0187886_1086701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1333Open in IMG/M
3300018020|Ga0187861_10133547All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300018022|Ga0187864_10317284All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018025|Ga0187885_10034025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2732Open in IMG/M
3300018030|Ga0187869_10409709All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300018035|Ga0187875_10012274All Organisms → cellular organisms → Bacteria5367Open in IMG/M
3300018037|Ga0187883_10538925All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300018042|Ga0187871_10112636All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1559Open in IMG/M
3300018043|Ga0187887_10743673All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300018062|Ga0187784_10201558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1624Open in IMG/M
3300018085|Ga0187772_11060658All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300018088|Ga0187771_10501612All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300018088|Ga0187771_10575049All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300018090|Ga0187770_10118868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1990Open in IMG/M
3300019786|Ga0182025_1375568All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300019890|Ga0193728_1353720All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300020579|Ga0210407_10548112All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300021388|Ga0213875_10443874All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300021402|Ga0210385_11187209All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300021432|Ga0210384_10409671All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300021432|Ga0210384_10580004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1008Open in IMG/M
3300021474|Ga0210390_11099944All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300021559|Ga0210409_10288058All Organisms → cellular organisms → Bacteria → Acidobacteria1482Open in IMG/M
3300021560|Ga0126371_12278542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia654Open in IMG/M
3300021953|Ga0213880_10231846Not Available527Open in IMG/M
3300022532|Ga0242655_10150616All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300022557|Ga0212123_10318735All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300025912|Ga0207707_11156551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300025915|Ga0207693_10897532Not Available680Open in IMG/M
3300025932|Ga0207690_11107957All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025981|Ga0207640_10665802All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300026023|Ga0207677_12236654Not Available509Open in IMG/M
3300026865|Ga0207746_1012962Not Available718Open in IMG/M
3300026869|Ga0207821_1009674All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300027045|Ga0207726_1024501All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300027825|Ga0209039_10149752Not Available972Open in IMG/M
3300027862|Ga0209701_10267161All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300027903|Ga0209488_10139772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1828Open in IMG/M
3300028574|Ga0302153_10168236All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300028731|Ga0302301_1057531All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300028788|Ga0302189_10191895All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300029910|Ga0311369_10000898All Organisms → cellular organisms → Bacteria43110Open in IMG/M
3300029945|Ga0311330_10086122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3204Open in IMG/M
3300029952|Ga0311346_10319434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1579Open in IMG/M
3300029955|Ga0311342_10098375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3115Open in IMG/M
3300029982|Ga0302277_1256292All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300029992|Ga0302276_10355423All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300030580|Ga0311355_10408861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1326Open in IMG/M
3300030739|Ga0302311_11068945All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300030778|Ga0075398_10746970Not Available632Open in IMG/M
3300031524|Ga0302320_10031878All Organisms → cellular organisms → Bacteria9982Open in IMG/M
3300031545|Ga0318541_10164613All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300031573|Ga0310915_10319129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300031715|Ga0307476_10208476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1420Open in IMG/M
3300031753|Ga0307477_10195285All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300031753|Ga0307477_10501020All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031753|Ga0307477_11046748All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300031754|Ga0307475_11204900All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300031788|Ga0302319_10050301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6719Open in IMG/M
3300031823|Ga0307478_10717884Not Available837Open in IMG/M
3300031912|Ga0306921_10515258Not Available1389Open in IMG/M
3300031947|Ga0310909_11308577Not Available583Open in IMG/M
3300031959|Ga0318530_10435394Not Available544Open in IMG/M
3300031962|Ga0307479_10218623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1878Open in IMG/M
3300031962|Ga0307479_10795359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300032001|Ga0306922_11010186All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032261|Ga0306920_100619094All Organisms → cellular organisms → Bacteria → Acidobacteria1601Open in IMG/M
3300032261|Ga0306920_104252776Not Available515Open in IMG/M
3300032515|Ga0348332_12081639All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300032770|Ga0335085_10043593All Organisms → cellular organisms → Bacteria → Acidobacteria6128Open in IMG/M
3300032770|Ga0335085_10046534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5902Open in IMG/M
3300032770|Ga0335085_11145787All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300032783|Ga0335079_10020960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7487Open in IMG/M
3300032828|Ga0335080_12064951Not Available550Open in IMG/M
3300033134|Ga0335073_10818043All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300033134|Ga0335073_11834452Not Available564Open in IMG/M
3300033977|Ga0314861_0122444All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300034090|Ga0326723_0220742All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.49%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.84%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.60%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.95%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.30%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.30%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.30%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.65%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026865Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes)EnvironmentalOpen in IMG/M
3300026869Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10119787523300001213WetlandRLALLKNVNVDLEQSYRDYKKFRASSRIVAVDEVQPPK*
C688J18823_1000355383300001686SoilLQFKVDLRLALLKSFRVDAEQTFRDYKKFRTDAKIVGIGDVQPEK*
Ga0062389_10408962213300004092Bog Forest SoilVKIDLRLALLKNFNEDIEQTYRDYKKFRTTAKIVGIGEVKP*
Ga0070709_1087432723300005434Corn, Switchgrass And Miscanthus RhizosphereQVDFKINLRLALLKNFNMDAQQTFRDYKKFRTDSKIIGVSEAQ*
Ga0066687_1000429233300005454SoilVDVKVDVRLALLKNFNEDIDLSYRDYKKFRTDAKIVGVGEVQEQK*
Ga0070678_10035525613300005456Miscanthus RhizosphereHVTAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK*
Ga0068853_10058720213300005539Corn RhizosphereAHVTAKIDVRVARVKGFNVGLEQTFRDYKKFRASSKIVSVGEVKEQKELDLSLP*
Ga0066654_1078111913300005587SoilQVQFKLDLRLALLKTFRMDAEQTFRDYKKFRTDAKIVGIGDVQPEK*
Ga0070762_1122517023300005602SoilWLPRELTVKVDVRLALLKNYNVDLEQSFRDYKKFRATSRVLAVEDVQKK*
Ga0068858_10024423313300005842Switchgrass RhizosphereWLPAHVTAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK*
Ga0070766_1010671423300005921SoilEVWLPRELTVKVDVRLALLKNFNVDLEQSFRDYKKFRATSRVLAVEDVQKK*
Ga0070766_1119105423300005921SoilKIDVRLALLKNFDVNLEQTYRDYKKFRATAKIVSVGEPQEK*
Ga0070717_1118507013300006028Corn, Switchgrass And Miscanthus RhizosphereDVRLALVKGFNVGVEQTFRDYKKFRSSSKIVGVAEVQDERK*
Ga0070716_10164480113300006173Corn, Switchgrass And Miscanthus RhizosphereIDVRLALLKNFNVDAQQTFRDYKKFRTDSKIIGVSEAQ*
Ga0079220_1175234423300006806Agricultural SoilALLKNFRVESEQTFRDYKKFRTDSKVIGFSEVQK*
Ga0075435_10054113523300007076Populus RhizosphereWLPAHLTARIDVRVALVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK*
Ga0099794_1016503713300007265Vadose Zone SoilHVVFHIDVRLALLKNFNEEIEQTFRDYKKFRTETKFTVVGETQ*
Ga0099795_1012107213300007788Vadose Zone SoilKHVAFHIDVRLALLKNFNQDVEQTFRDYKKFRTETKFTVVEETQ*
Ga0102924_101366523300007982Iron-Sulfur Acid SpringVNEEVWLPRQLTAKIDVRLDLLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK*
Ga0075423_1264683023300009162Populus RhizosphereALLKNFRVEAQQTFRDYKKFRTDSKILGVSELKTEK*
Ga0116128_115751023300009518PeatlandAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK*
Ga0116133_104563613300009623PeatlandLKIDVRLALLKNFNVNVEQSFRDYQKFRATTRILPVEEVQKK*
Ga0116115_112291923300009631PeatlandPQHVAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK*
Ga0126374_1040300133300009792Tropical Forest SoilQLDFKIDARFALLKNFRMEAQQTFKDYKKFRTDSKIVGMSEVQTEK*
Ga0126384_1125070813300010046Tropical Forest SoilLLKNFRMEAQQTFRDYKKFRTDSKIVGISEVQTEK*
Ga0126373_1095848123300010048Tropical Forest SoilRELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSKIVGIGEVQGPK*
Ga0126373_1129879623300010048Tropical Forest SoilVWLPAHVAAKIDVRLALVKGFNVDLEQTFRDYKKFRTESKIVRVGEVEESK*
Ga0126373_1330994313300010048Tropical Forest SoilELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSRIVGIGEEQGPK*
Ga0074045_1017513113300010341Bog Forest SoilWLPFHVTAKIDVRLALVKNFDVEVEQTYRDYKKFRATTKILSIGEAQQK*
Ga0074044_10005091113300010343Bog Forest SoilTAKIDVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK*
Ga0126370_1141929813300010358Tropical Forest SoilLPKHVQFHADVRLALVKNFNVDVEQTFRDYKKFRSESKFTVTGEAH*
Ga0126370_1266835013300010358Tropical Forest SoilKIDVRVALVKGFNVGLEQTFRDYKKYRVSSKIVGAGEVQEQK*
Ga0134066_1029142923300010364Grasslands SoilFKIDVRVALLKNFNMDAEQSFRDYKKFRTDSRIVGVSETVTDK*
Ga0134125_1093329513300010371Terrestrial SoilDEVWLPAHVTAKIDVRLGLIKNFDVDLEQSFRDYKKFGSSTKVVAGGEVEEQK*
Ga0134125_1245957913300010371Terrestrial SoilIDVRVALVKGFNIGLDQTFRDYKKFRATSKIVKVGDVDEPK*
Ga0126381_10507286513300010376Tropical Forest SoilEVWLPRELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSRIVGIGEEQGPK*
Ga0136449_10148693123300010379Peatlands SoilLHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATAKIVSVGDVQP*
Ga0137388_1116739623300012189Vadose Zone SoilKVGVRLALLKNFNVEMDQTYRDYKKFRATGRIVGVGEVQEK*
Ga0137370_1053425113300012285Vadose Zone SoilRLALLKNFRVEAQQSFRDYKKFRTDSKIIGMSEVQTER*
Ga0137361_1079329133300012362Vadose Zone SoilHIDVRLALLKNFNEEVEQTFRDYKKFRTETKFTVVGETQ*
Ga0137395_1028536423300012917Vadose Zone SoilWLPKNIVFKVDVRLALLKNFNVDMQQTCRDYKKFRATAKIVGVEDIQEK*
Ga0137419_1028872613300012925Vadose Zone SoilLALLKNFNVEADQTFRDYKKFGATTRILGVVEVQDK*
Ga0164298_1029634613300012955SoilWLPQHVTAKIDVRLALVKGFNVGLEQTFRDYKKFRSSSRIAGWGEVEEKK*
Ga0164299_1040222213300012958SoilTAKIDVRLALVKGFNVGLEQTFRDYKKFRSSSRIAGWGEVEEKK*
Ga0164302_1032744123300012961SoilLPAHLTARIDVRVALVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK*
Ga0126369_1018151333300012971Tropical Forest SoilRLALLKNLNVDVEQTFRDYKKFRSESKITVVGETQ*
Ga0164304_1118972723300012986SoilDVRVALLKNFDVELEQAYRDYKKFRSSSKIVGVAEAPDKSK*
Ga0157370_1005327753300013104Corn RhizosphereWLPAHVTAKIDVRVARVKGFNVGLEQTFRDYKKFRASSKMSAWEK*
Ga0157375_1064295313300013308Miscanthus RhizosphereLALLKGFNIGLEQTFRDYKKFRVSSKIVGGGEVQEQK*
Ga0157375_1202340423300013308Miscanthus RhizosphereTAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK*
Ga0181529_1049477113300014161BogLTAKINVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK*
Ga0181523_1022783713300014165BogVWLPLHLTAKVDARLALLKNIDVNVEQSYRDYKKFRATARVVGVIDPQQK*
Ga0181531_1008671223300014169BogRLALLKNFDVNLEQTYRDYKKFRATAKIVGVGEVQP*
Ga0182024_1082267823300014501PermafrostLHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATAKIVSVGAVQEK*
Ga0181522_1072057023300014657BogLTAKVDVRLALLKNFNVDVEQSFRDYKKFRATTKIMAVEDVQKK*
Ga0181519_1106234123300014658BogVALKVDARIALLKEYNVEQDVTFRDYKKFRATTRIVNLADPKL*
Ga0182033_1164995813300016319SoilLAVKVDVRLALLKDFNIDLEQTFRDYKKFRSSSKIVSVGEVQEQK
Ga0182035_1105597413300016341SoilVWLPAHVAAKVDVRLGLVKNFDVKLEQTFRDYKKFRSSSRVIAVGEVHN
Ga0182035_1173548713300016341SoilRQLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK
Ga0182035_1195431023300016341SoilEVWLPAHVAAKVDVRLGLVKNFDVNLEQTFRDYKKFRSSSRVIAVGEVHDQR
Ga0182040_1190411623300016387SoilVNDEIWLPHQLAVKVDVRLALLKNYNVDIEQTFRDYKKFRTSSKVVGMGEVQEPR
Ga0182039_1026936933300016422SoilLAVKVDVRVVLLKNFNVDVEQTFRDYRKFRTSSKIVGMGEVPKPK
Ga0182038_1163190313300016445SoilLALLKNFNVDVEQTFRDYKKFTASSKIVGISEVQGPK
Ga0187818_1027311223300017823Freshwater SedimentLKIDVRLALLKNFNVEDEITYRDYQKFRTGTKIVPLGEVSEQQ
Ga0187854_1031849423300017938PeatlandPLHVAAKIDVRLALLKNFDVNVEQTFRDYKKFRATARIVSVGEVKP
Ga0187853_1016418033300017940PeatlandPLHVAAHVDVRLALLKNFDVNVEQTYRDYKKFRATAKIVDLGEVQPNAPPK
Ga0187819_1042039123300017943Freshwater SedimentQHLTFKLDARLALLKGFKIEDEQTFRDYKKFRTDAKITGVGEVQEQK
Ga0187819_1078583123300017943Freshwater SedimentRLALVKNFNVDMEQTFRDYKKFRTSAKIVGVGEIQEQK
Ga0187817_1081400313300017955Freshwater SedimentPLLLTAKIDVRLALVKNFNVGVEQTYRDYKKFRTSATIVGVSEVQDQK
Ga0187779_1065157123300017959Tropical PeatlandWLPQHVTFKVDVRLALLKNFNIDGEQTYRDYKKFRTSAKIVGVGEVQDPK
Ga0187779_1117689613300017959Tropical PeatlandVWLPQHVTFKVDVRLALLKNFNIDGEQTYRDYKKFRTSAKIVGIGEVQDSK
Ga0187780_1001220173300017973Tropical PeatlandMSGLALVKNFNVDVDQTYRDYKKFRTSARIVGVGEVQDQK
Ga0187782_1109639623300017975Tropical PeatlandGEVWLPRHVQFHVDARVALLKEYREDVDPTFRDYKKFRTESKITLVGDPQ
Ga0187782_1122028723300017975Tropical PeatlandMTRVPLWKRATKIDVRLALVKNFNVDVDQTYRDYKKFRTSARIVGVGEVQEQK
Ga0187767_1025668313300017999Tropical PeatlandVALLKGFKMEDEQTFRDYKKFRTDAKVTGIGEVQPEK
Ga0187860_128315923300018014PeatlandAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK
Ga0187886_108670123300018018PeatlandVNEEVWLPRQLTAKINVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK
Ga0187861_1013354713300018020PeatlandDEVWLPLHVAAKIDVRLALLKNFDVNVEQTFRDYKKFRATARIVSVGEVKP
Ga0187864_1031728423300018022PeatlandQHVAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK
Ga0187885_1003402533300018025PeatlandANDEVWLPQHVGLKIDARLALLKEYHVELEQTFRDYKRFRATTKILAVEDVQKK
Ga0187869_1040970913300018030PeatlandVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK
Ga0187875_1001227433300018035PeatlandVNEEVWLPRQLTAKIDVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK
Ga0187883_1053892523300018037PeatlandMLEQTRVNDEAWLPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATARIVSVGDVKP
Ga0187871_1011263613300018042PeatlandAWLPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATAKIVSVGEAKP
Ga0187887_1074367323300018043PeatlandLLPRQVSLNIDVRLALLKNFNVNVEQSFHDYKKFRATTRILAVEDVQKK
Ga0187784_1020155813300018062Tropical PeatlandRLALLKNFDVGLEQTYRDYKKFRTSARIVSIGEVKDK
Ga0187772_1106065813300018085Tropical PeatlandVWLPLHLTAKIDVRLALLKHFDVNVEQSYRDYKKFRATAKIVTTGAIREK
Ga0187771_1050161223300018088Tropical PeatlandLALLRNFDIGLDQTYRDYKKFRTSAKIVGVGEVRDDK
Ga0187771_1057504923300018088Tropical PeatlandLVKNFNVALEQTYRGYRKFRTSARIVGVGEVQDPK
Ga0187770_1011886813300018090Tropical PeatlandLRLALLKNFRVDLEQTFHDYKKFRADTKIVGIGEVQEQK
Ga0182025_137556813300019786PermafrostVRLALLKNFNVDVEQTFRDYKKFRATTKIFTVEDVQKK
Ga0193728_135372023300019890SoilWLPLHLAAKIDVRLGLIKNFDVDLEQSFRDYKKFRASSKITAGGEVQDQK
Ga0210407_1054811213300020579SoilQLAFKIGVRLALLKSFKLDAEQTFRDYKKFRTDAKIVGVGELQPEK
Ga0213875_1044387413300021388Plant RootsHVDVKVDARLALLKSFNQDIDLTYRDYKKFRSGSRILGVGAPAEEK
Ga0210385_1118720913300021402SoilLALLKNFNVDVEQTFRDYKKFRATTRIVGVGEVKQ
Ga0210384_1040967113300021432SoilQLKVDVRLALVKDFKVEQEQTFRDYKKFRTSTRIVGTSEIQPK
Ga0210384_1058000433300021432SoilQFHIDVRLALLKNYDEDVEQTFRDYKKFRADSKITFIGETQ
Ga0210390_1109994423300021474SoilLPLHVTAKIDVRLALLKNFDVDVEQTYRDYKKFRTTAKIVSVGDVK
Ga0210409_1028805833300021559SoilEVWLPSHVQLKVDVRLALLKDFKVEQEQTFRDYKKFRTSTRIVGTSEIQPK
Ga0126371_1227854223300021560Tropical Forest SoilALFKNVNVDVEQSCRDYKKFRASSKIVGVGEVQGPK
Ga0213880_1023184613300021953Exposed RockNFKIDVRLALLKNFNVDAEQTFRDYKKFRTDSKIVGVSREPVEK
Ga0242655_1015061623300022532SoilKLDARLALLKGFKIEDEQTFRDYKKFRTDAKITGVGEVQEQK
Ga0212123_1031873513300022557Iron-Sulfur Acid SpringVNEEVWLPRQLTAKIDVRLDLLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK
Ga0207707_1115655123300025912Corn RhizosphereARVALLKGFKMDGEETFRDYKKFRASSKIVGVGEVQKQQ
Ga0207693_1089753213300025915Corn, Switchgrass And Miscanthus RhizosphereDVRLALVKEFNVGVEQTFRDYKKFRSSSKIVGVAEVQDERK
Ga0207690_1110795723300025932Corn RhizosphereLVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK
Ga0207640_1066580233300025981Corn RhizosphereGVALVKGFNVGPEQTFRDYKKFRASSKIVSVGEVKEQKELDLSLP
Ga0207677_1223665423300026023Miscanthus RhizosphereHVTAKIGVRLALLKGFNIGLEQTFRDYKKFRVSSKIVGGGEVQEQK
Ga0207746_101296223300026865Tropical Forest SoilLLKNFNVDLEQSYRDYKKFRASSKIIGIGEVQGPK
Ga0207821_100967413300026869Tropical Forest SoilAVKVDVRLALFKNYNVDIEQTFRDYKKFRTSSKVVGMGEVQEPR
Ga0207726_102450113300027045Tropical Forest SoilVKVDVRLALLKNFNVDLEQSYRDYKKFRASSKIIGIGEVQGPK
Ga0209039_1014975223300027825Bog Forest SoilHITVKVDVRLALLKDFSLEEEVSFRDYKKFRATARIVGVGDVQEK
Ga0209701_1026716123300027862Vadose Zone SoilLALLKNFNVEMDQTYRDYKKFRATGRIVGVGEVQEK
Ga0209488_1013977213300027903Vadose Zone SoilKVDVRLALLKNFNVEADQTFRDYKKFGATTRILDVVDVQDK
Ga0302153_1016823623300028574BogKVDARIALLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH
Ga0302301_105753123300028731PalsaLPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATARIVGVGEVKP
Ga0302189_1019189523300028788BogWLPLHLTAKIDVRIGLIKNFDVDVEQTYRDYKKFRATAKIVGVGDVQEK
Ga0311369_10000898403300029910PalsaLKVDVRLALLKEYNVEQEQTFRDYKKFRATARIVGVGDVKP
Ga0311330_1008612253300029945BogKHVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDEK
Ga0311346_1031943413300029952BogQHVALKVDARIALLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH
Ga0311342_1009837543300029955BogHVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDEK
Ga0302277_125629223300029982BogLLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH
Ga0302276_1035542313300029992BogRIGLIKNFDVDVEQTYRDYKKFRATAKIVGVGDVQEK
Ga0311355_1040886123300030580PalsaVRLALLKNFDVNVEQTYRDYKKFRATARIVGVGEVKP
Ga0302311_1106894523300030739PalsaLHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATARIVGVGEVQEK
Ga0075398_1074697013300030778SoilVWLPAHVTAKIDVRVGLIKNFDVDLDQSFRDYKKFRSSSKVVVGDEVKE
Ga0302320_1003187813300031524BogKHVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDVK
Ga0318541_1016461323300031545SoilQLAVKVDVRLALLKDFNVDIEQTFRDYKKFRSSSKIVSVGEVQEPK
Ga0310915_1031912923300031573SoilQLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK
Ga0307476_1020847613300031715Hardwood Forest SoilRLALLKEFNVSMDQTYRDYKKFRATTRIVDVGSVEK
Ga0307477_1019528513300031753Hardwood Forest SoilIDVRLALVKNFNVDMEQTFRDYKKFRTSAKIVGVSEVQDQKVADQK
Ga0307477_1050102023300031753Hardwood Forest SoilLPRQLTVKIDVRLALLKNFNVDVEQTFRDYKKFRATTKIVGVGEVKQ
Ga0307477_1104674813300031753Hardwood Forest SoilVWLPSHVQLKVDVRLALLKDFKVEQEQTFRDYKKFRASTRIVGTSEIQPK
Ga0307475_1120490013300031754Hardwood Forest SoilWLPSQVAFKIGVRLAVLKNFNVDEEQTFRDYKKFRTDTKIVGVGEVQSEK
Ga0302319_1005030153300031788BogMTAKIDVRLALLKNFDVEVEQTYRDYKKFRATAKIVSVGDVKP
Ga0307478_1071788413300031823Hardwood Forest SoilVDVRVALLKEFNVDGEQTFRDYKKFQATTKILGMTEVKDTK
Ga0306921_1051525823300031912SoilMLEQMRVNDEIWLPHQLAVKVGVRLALLKNYNVDIEQTFRDYKKFRTSSRVVGMGEVQ
Ga0310909_1130857713300031947SoilVNDVVWLPRQLAVKVDVRVVLLKNFNVDVEQTFRDYRKFRTSSKIVGMGEVPKPK
Ga0318530_1043539423300031959SoilVRLGLVKNFDVNLEQTFRDYKKFRSSSRVIAVGEVHD
Ga0307479_1021862333300031962Hardwood Forest SoilKVDVRLVLLKDFKVEQEQTFRDYKKFRTSTRIVGTSEIPPK
Ga0307479_1079535923300031962Hardwood Forest SoilEVWLPRQVAFKIDVRLALLKNFNVNEEQTFRDYKKFRTDSKIVGMSEVQTEK
Ga0306922_1101018613300032001SoilAVKVDVRLALLKNFNVDLEQSYRDYKKFRASSRIVGIGELQGPK
Ga0306920_10061909423300032261SoilMLEQMRVNDEIWLPHQLAVKVDVRLALLKNYNVDIEQTFRDYKKFRTSSRVVGMGEVQ
Ga0306920_10425277613300032261SoilWLPRQLAVKVDVRLALLKNFNVDVEQTFRDYKKFTASSKIVGVGEVPGPK
Ga0348332_1208163923300032515Plant LitterKIDVRLALVKNFDVGVEQTYRDYKKFRATSRIVGVSDAKQ
Ga0335085_1004359383300032770SoilVQFHADIRLALLKNFDVDVEQTFRDYKKFRSESKITVVGETQ
Ga0335085_1004653493300032770SoilDVRLALMKNFNVDLEQSYRDYKKFRSSSRIVGFEEVQQPK
Ga0335085_1114578723300032770SoilTAKVDVRLALLKNFNADIEQEYRDYKKFRTSSKIVGVAEVKDHQ
Ga0335079_1002096013300032783SoilEQTRVNNEVWLPLHLEAKIDARLALLKNLDVGLEQSFRDYKKFGSSTKIVGMSEVQEQK
Ga0335080_1206495123300032828SoilIAKIDVRLALLKNFDIDLEQSYRDYKKFRTSTKILGFGEVKDTK
Ga0335073_1081804333300033134SoilRELTAKIDVRLALFKNFDVDVEQSFRDYKKFRATTKLLPADAVQEPEEKK
Ga0335073_1183445223300033134SoilLTAKIDVRLGLVKNFDVQLEQAFRDYKKFGSSTKVIAGGEVKERD
Ga0314861_0122444_1187_13003300033977PeatlandLALVKNVDVGLEQTYRDYKKFRTSSRIVSVGEVQQQK
Ga0326723_0220742_3_1283300034090Peat SoilQFHVDVRLALLKNFNVDVEQTFRDYKKFRSESKITLVGESQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.