Basic Information | |
---|---|
Family ID | F044661 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 45 residues |
Representative Sequence | QLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.92 % |
% of genes near scaffold ends (potentially truncated) | 92.21 % |
% of genes from short scaffolds (< 2000 bps) | 88.31 % |
Associated GOLD sequencing projects | 131 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.870 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.792 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.753 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.24% β-sheet: 0.00% Coil/Unstructured: 56.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF00027 | cNMP_binding | 16.23 |
PF07992 | Pyr_redox_2 | 7.14 |
PF04851 | ResIII | 3.90 |
PF02837 | Glyco_hydro_2_N | 3.25 |
PF08837 | DUF1810 | 3.25 |
PF00440 | TetR_N | 1.95 |
PF16653 | Sacchrp_dh_C | 1.95 |
PF13450 | NAD_binding_8 | 1.95 |
PF05960 | DUF885 | 1.95 |
PF13470 | PIN_3 | 1.30 |
PF11104 | PilM_2 | 1.30 |
PF12728 | HTH_17 | 1.30 |
PF10067 | DUF2306 | 1.30 |
PF01765 | RRF | 1.30 |
PF12704 | MacB_PCD | 1.30 |
PF08240 | ADH_N | 1.30 |
PF13495 | Phage_int_SAM_4 | 0.65 |
PF02604 | PhdYeFM_antitox | 0.65 |
PF03795 | YCII | 0.65 |
PF02852 | Pyr_redox_dim | 0.65 |
PF01946 | Thi4 | 0.65 |
PF04542 | Sigma70_r2 | 0.65 |
PF01738 | DLH | 0.65 |
PF04226 | Transgly_assoc | 0.65 |
PF05168 | HEPN | 0.65 |
PF01229 | Glyco_hydro_39 | 0.65 |
PF00676 | E1_dh | 0.65 |
PF07978 | NIPSNAP | 0.65 |
PF08818 | DUF1801 | 0.65 |
PF13565 | HTH_32 | 0.65 |
PF14470 | bPH_3 | 0.65 |
PF03884 | YacG | 0.65 |
PF13533 | Biotin_lipoyl_2 | 0.65 |
PF00348 | polyprenyl_synt | 0.65 |
PF13751 | DDE_Tnp_1_6 | 0.65 |
PF14329 | DUF4386 | 0.65 |
PF12838 | Fer4_7 | 0.65 |
PF05649 | Peptidase_M13_N | 0.65 |
PF01207 | Dus | 0.65 |
PF09471 | Peptidase_M64 | 0.65 |
PF04014 | MazE_antitoxin | 0.65 |
PF02641 | DUF190 | 0.65 |
PF04185 | Phosphoesterase | 0.65 |
PF00263 | Secretin | 0.65 |
PF10417 | 1-cysPrx_C | 0.65 |
PF10041 | DUF2277 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 3.25 |
COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 3.25 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.95 |
COG0233 | Ribosome recycling factor | Translation, ribosomal structure and biogenesis [J] | 1.30 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 0.65 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.65 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.65 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.65 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.65 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.65 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.65 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.65 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.65 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.65 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.65 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
COG1635 | Thiazole synthase/Archaeal ribulose 1,5-bisphosphate synthetase | Carbohydrate transport and metabolism [G] | 0.65 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.65 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.65 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.65 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.65 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.87 % |
Unclassified | root | N/A | 20.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_101197875 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300001686|C688J18823_10003553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9865 | Open in IMG/M |
3300004092|Ga0062389_104089622 | Not Available | 548 | Open in IMG/M |
3300005434|Ga0070709_10874327 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300005454|Ga0066687_10004292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4883 | Open in IMG/M |
3300005456|Ga0070678_100355256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300005539|Ga0068853_100587202 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300005587|Ga0066654_10781119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300005602|Ga0070762_11225170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
3300005842|Ga0068858_100244233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1704 | Open in IMG/M |
3300005921|Ga0070766_10106714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1666 | Open in IMG/M |
3300005921|Ga0070766_11191054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300006028|Ga0070717_11185070 | Not Available | 695 | Open in IMG/M |
3300006173|Ga0070716_101644801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300006806|Ga0079220_11752344 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300007076|Ga0075435_100541135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
3300007265|Ga0099794_10165037 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300007788|Ga0099795_10121072 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300007982|Ga0102924_1013665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6497 | Open in IMG/M |
3300009162|Ga0075423_12646830 | Not Available | 549 | Open in IMG/M |
3300009518|Ga0116128_1157510 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009623|Ga0116133_1045636 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300009631|Ga0116115_1122919 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300009792|Ga0126374_10403001 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300010046|Ga0126384_11250708 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010048|Ga0126373_10958481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 920 | Open in IMG/M |
3300010048|Ga0126373_11298796 | Not Available | 794 | Open in IMG/M |
3300010048|Ga0126373_13309943 | Not Available | 501 | Open in IMG/M |
3300010341|Ga0074045_10175131 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300010343|Ga0074044_10005091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10758 | Open in IMG/M |
3300010358|Ga0126370_11419298 | Not Available | 656 | Open in IMG/M |
3300010358|Ga0126370_12668350 | Not Available | 500 | Open in IMG/M |
3300010364|Ga0134066_10291429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300010371|Ga0134125_10933295 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300010371|Ga0134125_12459579 | Not Available | 566 | Open in IMG/M |
3300010376|Ga0126381_105072865 | Not Available | 504 | Open in IMG/M |
3300010379|Ga0136449_101486931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
3300012189|Ga0137388_11167396 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300012285|Ga0137370_10534251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300012362|Ga0137361_10793291 | Not Available | 862 | Open in IMG/M |
3300012917|Ga0137395_10285364 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300012925|Ga0137419_10288726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1250 | Open in IMG/M |
3300012955|Ga0164298_10296346 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300012958|Ga0164299_10402222 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300012961|Ga0164302_10327441 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300012971|Ga0126369_10181513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2011 | Open in IMG/M |
3300012986|Ga0164304_11189727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300013104|Ga0157370_10053277 | All Organisms → cellular organisms → Bacteria | 3858 | Open in IMG/M |
3300013308|Ga0157375_10642953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
3300013308|Ga0157375_12023404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300014161|Ga0181529_10494771 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300014165|Ga0181523_10227837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
3300014169|Ga0181531_10086712 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
3300014501|Ga0182024_10822678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
3300014657|Ga0181522_10720570 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300014658|Ga0181519_11062341 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300016319|Ga0182033_11649958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 580 | Open in IMG/M |
3300016341|Ga0182035_11055974 | Not Available | 722 | Open in IMG/M |
3300016341|Ga0182035_11735487 | Not Available | 564 | Open in IMG/M |
3300016341|Ga0182035_11954310 | Not Available | 533 | Open in IMG/M |
3300016387|Ga0182040_11904116 | Not Available | 510 | Open in IMG/M |
3300016422|Ga0182039_10269369 | Not Available | 1397 | Open in IMG/M |
3300016445|Ga0182038_11631903 | Not Available | 580 | Open in IMG/M |
3300017823|Ga0187818_10273112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300017938|Ga0187854_10318494 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300017940|Ga0187853_10164180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1057 | Open in IMG/M |
3300017943|Ga0187819_10420391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300017943|Ga0187819_10785831 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300017955|Ga0187817_10814003 | Not Available | 596 | Open in IMG/M |
3300017959|Ga0187779_10651571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300017959|Ga0187779_11176896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300017973|Ga0187780_10012201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6314 | Open in IMG/M |
3300017975|Ga0187782_11220287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300017999|Ga0187767_10256683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300018014|Ga0187860_1283159 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300018018|Ga0187886_1086701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1333 | Open in IMG/M |
3300018020|Ga0187861_10133547 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300018022|Ga0187864_10317284 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300018025|Ga0187885_10034025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2732 | Open in IMG/M |
3300018030|Ga0187869_10409709 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300018035|Ga0187875_10012274 | All Organisms → cellular organisms → Bacteria | 5367 | Open in IMG/M |
3300018037|Ga0187883_10538925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300018042|Ga0187871_10112636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1559 | Open in IMG/M |
3300018043|Ga0187887_10743673 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300018062|Ga0187784_10201558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1624 | Open in IMG/M |
3300018085|Ga0187772_11060658 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300018088|Ga0187771_10501612 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300018088|Ga0187771_10575049 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300018090|Ga0187770_10118868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1990 | Open in IMG/M |
3300019786|Ga0182025_1375568 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300019890|Ga0193728_1353720 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300020579|Ga0210407_10548112 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300021388|Ga0213875_10443874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300021402|Ga0210385_11187209 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021432|Ga0210384_10409671 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300021432|Ga0210384_10580004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1008 | Open in IMG/M |
3300021474|Ga0210390_11099944 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300021559|Ga0210409_10288058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
3300021560|Ga0126371_12278542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 654 | Open in IMG/M |
3300021953|Ga0213880_10231846 | Not Available | 527 | Open in IMG/M |
3300022532|Ga0242655_10150616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300022557|Ga0212123_10318735 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300025912|Ga0207707_11156551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300025915|Ga0207693_10897532 | Not Available | 680 | Open in IMG/M |
3300025932|Ga0207690_11107957 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300025981|Ga0207640_10665802 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300026023|Ga0207677_12236654 | Not Available | 509 | Open in IMG/M |
3300026865|Ga0207746_1012962 | Not Available | 718 | Open in IMG/M |
3300026869|Ga0207821_1009674 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300027045|Ga0207726_1024501 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300027825|Ga0209039_10149752 | Not Available | 972 | Open in IMG/M |
3300027862|Ga0209701_10267161 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300027903|Ga0209488_10139772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1828 | Open in IMG/M |
3300028574|Ga0302153_10168236 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300028731|Ga0302301_1057531 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300028788|Ga0302189_10191895 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300029910|Ga0311369_10000898 | All Organisms → cellular organisms → Bacteria | 43110 | Open in IMG/M |
3300029945|Ga0311330_10086122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3204 | Open in IMG/M |
3300029952|Ga0311346_10319434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1579 | Open in IMG/M |
3300029955|Ga0311342_10098375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3115 | Open in IMG/M |
3300029982|Ga0302277_1256292 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300029992|Ga0302276_10355423 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300030580|Ga0311355_10408861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1326 | Open in IMG/M |
3300030739|Ga0302311_11068945 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300030778|Ga0075398_10746970 | Not Available | 632 | Open in IMG/M |
3300031524|Ga0302320_10031878 | All Organisms → cellular organisms → Bacteria | 9982 | Open in IMG/M |
3300031545|Ga0318541_10164613 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300031573|Ga0310915_10319129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
3300031715|Ga0307476_10208476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
3300031753|Ga0307477_10195285 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300031753|Ga0307477_10501020 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300031753|Ga0307477_11046748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300031754|Ga0307475_11204900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300031788|Ga0302319_10050301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6719 | Open in IMG/M |
3300031823|Ga0307478_10717884 | Not Available | 837 | Open in IMG/M |
3300031912|Ga0306921_10515258 | Not Available | 1389 | Open in IMG/M |
3300031947|Ga0310909_11308577 | Not Available | 583 | Open in IMG/M |
3300031959|Ga0318530_10435394 | Not Available | 544 | Open in IMG/M |
3300031962|Ga0307479_10218623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1878 | Open in IMG/M |
3300031962|Ga0307479_10795359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
3300032001|Ga0306922_11010186 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032261|Ga0306920_100619094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
3300032261|Ga0306920_104252776 | Not Available | 515 | Open in IMG/M |
3300032515|Ga0348332_12081639 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300032770|Ga0335085_10043593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6128 | Open in IMG/M |
3300032770|Ga0335085_10046534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5902 | Open in IMG/M |
3300032770|Ga0335085_11145787 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300032783|Ga0335079_10020960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7487 | Open in IMG/M |
3300032828|Ga0335080_12064951 | Not Available | 550 | Open in IMG/M |
3300033134|Ga0335073_10818043 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300033134|Ga0335073_11834452 | Not Available | 564 | Open in IMG/M |
3300033977|Ga0314861_0122444 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300034090|Ga0326723_0220742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.49% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.55% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.60% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.95% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.30% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.30% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.30% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.30% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.30% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030778 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1011978752 | 3300001213 | Wetland | RLALLKNVNVDLEQSYRDYKKFRASSRIVAVDEVQPPK* |
C688J18823_100035538 | 3300001686 | Soil | LQFKVDLRLALLKSFRVDAEQTFRDYKKFRTDAKIVGIGDVQPEK* |
Ga0062389_1040896221 | 3300004092 | Bog Forest Soil | VKIDLRLALLKNFNEDIEQTYRDYKKFRTTAKIVGIGEVKP* |
Ga0070709_108743272 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QVDFKINLRLALLKNFNMDAQQTFRDYKKFRTDSKIIGVSEAQ* |
Ga0066687_100042923 | 3300005454 | Soil | VDVKVDVRLALLKNFNEDIDLSYRDYKKFRTDAKIVGVGEVQEQK* |
Ga0070678_1003552561 | 3300005456 | Miscanthus Rhizosphere | HVTAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK* |
Ga0068853_1005872021 | 3300005539 | Corn Rhizosphere | AHVTAKIDVRVARVKGFNVGLEQTFRDYKKFRASSKIVSVGEVKEQKELDLSLP* |
Ga0066654_107811191 | 3300005587 | Soil | QVQFKLDLRLALLKTFRMDAEQTFRDYKKFRTDAKIVGIGDVQPEK* |
Ga0070762_112251702 | 3300005602 | Soil | WLPRELTVKVDVRLALLKNYNVDLEQSFRDYKKFRATSRVLAVEDVQKK* |
Ga0068858_1002442331 | 3300005842 | Switchgrass Rhizosphere | WLPAHVTAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK* |
Ga0070766_101067142 | 3300005921 | Soil | EVWLPRELTVKVDVRLALLKNFNVDLEQSFRDYKKFRATSRVLAVEDVQKK* |
Ga0070766_111910542 | 3300005921 | Soil | KIDVRLALLKNFDVNLEQTYRDYKKFRATAKIVSVGEPQEK* |
Ga0070717_111850701 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DVRLALVKGFNVGVEQTFRDYKKFRSSSKIVGVAEVQDERK* |
Ga0070716_1016448011 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IDVRLALLKNFNVDAQQTFRDYKKFRTDSKIIGVSEAQ* |
Ga0079220_117523442 | 3300006806 | Agricultural Soil | ALLKNFRVESEQTFRDYKKFRTDSKVIGFSEVQK* |
Ga0075435_1005411352 | 3300007076 | Populus Rhizosphere | WLPAHLTARIDVRVALVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK* |
Ga0099794_101650371 | 3300007265 | Vadose Zone Soil | HVVFHIDVRLALLKNFNEEIEQTFRDYKKFRTETKFTVVGETQ* |
Ga0099795_101210721 | 3300007788 | Vadose Zone Soil | KHVAFHIDVRLALLKNFNQDVEQTFRDYKKFRTETKFTVVEETQ* |
Ga0102924_10136652 | 3300007982 | Iron-Sulfur Acid Spring | VNEEVWLPRQLTAKIDVRLDLLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK* |
Ga0075423_126468302 | 3300009162 | Populus Rhizosphere | ALLKNFRVEAQQTFRDYKKFRTDSKILGVSELKTEK* |
Ga0116128_11575102 | 3300009518 | Peatland | AVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK* |
Ga0116133_10456361 | 3300009623 | Peatland | LKIDVRLALLKNFNVNVEQSFRDYQKFRATTRILPVEEVQKK* |
Ga0116115_11229192 | 3300009631 | Peatland | PQHVAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK* |
Ga0126374_104030013 | 3300009792 | Tropical Forest Soil | QLDFKIDARFALLKNFRMEAQQTFKDYKKFRTDSKIVGMSEVQTEK* |
Ga0126384_112507081 | 3300010046 | Tropical Forest Soil | LLKNFRMEAQQTFRDYKKFRTDSKIVGISEVQTEK* |
Ga0126373_109584812 | 3300010048 | Tropical Forest Soil | RELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSKIVGIGEVQGPK* |
Ga0126373_112987962 | 3300010048 | Tropical Forest Soil | VWLPAHVAAKIDVRLALVKGFNVDLEQTFRDYKKFRTESKIVRVGEVEESK* |
Ga0126373_133099431 | 3300010048 | Tropical Forest Soil | ELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSRIVGIGEEQGPK* |
Ga0074045_101751311 | 3300010341 | Bog Forest Soil | WLPFHVTAKIDVRLALVKNFDVEVEQTYRDYKKFRATTKILSIGEAQQK* |
Ga0074044_1000509111 | 3300010343 | Bog Forest Soil | TAKIDVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK* |
Ga0126370_114192981 | 3300010358 | Tropical Forest Soil | LPKHVQFHADVRLALVKNFNVDVEQTFRDYKKFRSESKFTVTGEAH* |
Ga0126370_126683501 | 3300010358 | Tropical Forest Soil | KIDVRVALVKGFNVGLEQTFRDYKKYRVSSKIVGAGEVQEQK* |
Ga0134066_102914292 | 3300010364 | Grasslands Soil | FKIDVRVALLKNFNMDAEQSFRDYKKFRTDSRIVGVSETVTDK* |
Ga0134125_109332951 | 3300010371 | Terrestrial Soil | DEVWLPAHVTAKIDVRLGLIKNFDVDLEQSFRDYKKFGSSTKVVAGGEVEEQK* |
Ga0134125_124595791 | 3300010371 | Terrestrial Soil | IDVRVALVKGFNIGLDQTFRDYKKFRATSKIVKVGDVDEPK* |
Ga0126381_1050728651 | 3300010376 | Tropical Forest Soil | EVWLPRELAVKVDVRLALLKNFNVDVEQSYRDYKKFRASSRIVGIGEEQGPK* |
Ga0136449_1014869312 | 3300010379 | Peatlands Soil | LHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATAKIVSVGDVQP* |
Ga0137388_111673962 | 3300012189 | Vadose Zone Soil | KVGVRLALLKNFNVEMDQTYRDYKKFRATGRIVGVGEVQEK* |
Ga0137370_105342511 | 3300012285 | Vadose Zone Soil | RLALLKNFRVEAQQSFRDYKKFRTDSKIIGMSEVQTER* |
Ga0137361_107932913 | 3300012362 | Vadose Zone Soil | HIDVRLALLKNFNEEVEQTFRDYKKFRTETKFTVVGETQ* |
Ga0137395_102853642 | 3300012917 | Vadose Zone Soil | WLPKNIVFKVDVRLALLKNFNVDMQQTCRDYKKFRATAKIVGVEDIQEK* |
Ga0137419_102887261 | 3300012925 | Vadose Zone Soil | LALLKNFNVEADQTFRDYKKFGATTRILGVVEVQDK* |
Ga0164298_102963461 | 3300012955 | Soil | WLPQHVTAKIDVRLALVKGFNVGLEQTFRDYKKFRSSSRIAGWGEVEEKK* |
Ga0164299_104022221 | 3300012958 | Soil | TAKIDVRLALVKGFNVGLEQTFRDYKKFRSSSRIAGWGEVEEKK* |
Ga0164302_103274412 | 3300012961 | Soil | LPAHLTARIDVRVALVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK* |
Ga0126369_101815133 | 3300012971 | Tropical Forest Soil | RLALLKNLNVDVEQTFRDYKKFRSESKITVVGETQ* |
Ga0164304_111897272 | 3300012986 | Soil | DVRVALLKNFDVELEQAYRDYKKFRSSSKIVGVAEAPDKSK* |
Ga0157370_100532775 | 3300013104 | Corn Rhizosphere | WLPAHVTAKIDVRVARVKGFNVGLEQTFRDYKKFRASSKMSAWEK* |
Ga0157375_106429531 | 3300013308 | Miscanthus Rhizosphere | LALLKGFNIGLEQTFRDYKKFRVSSKIVGGGEVQEQK* |
Ga0157375_120234042 | 3300013308 | Miscanthus Rhizosphere | TAKIDVRLALLKGFNVGLEQTFRDYRKFRVSSKIVGTGEVQEQK* |
Ga0181529_104947711 | 3300014161 | Bog | LTAKINVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK* |
Ga0181523_102278371 | 3300014165 | Bog | VWLPLHLTAKVDARLALLKNIDVNVEQSYRDYKKFRATARVVGVIDPQQK* |
Ga0181531_100867122 | 3300014169 | Bog | RLALLKNFDVNLEQTYRDYKKFRATAKIVGVGEVQP* |
Ga0182024_108226782 | 3300014501 | Permafrost | LHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATAKIVSVGAVQEK* |
Ga0181522_107205702 | 3300014657 | Bog | LTAKVDVRLALLKNFNVDVEQSFRDYKKFRATTKIMAVEDVQKK* |
Ga0181519_110623412 | 3300014658 | Bog | VALKVDARIALLKEYNVEQDVTFRDYKKFRATTRIVNLADPKL* |
Ga0182033_116499581 | 3300016319 | Soil | LAVKVDVRLALLKDFNIDLEQTFRDYKKFRSSSKIVSVGEVQEQK |
Ga0182035_110559741 | 3300016341 | Soil | VWLPAHVAAKVDVRLGLVKNFDVKLEQTFRDYKKFRSSSRVIAVGEVHN |
Ga0182035_117354871 | 3300016341 | Soil | RQLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK |
Ga0182035_119543102 | 3300016341 | Soil | EVWLPAHVAAKVDVRLGLVKNFDVNLEQTFRDYKKFRSSSRVIAVGEVHDQR |
Ga0182040_119041162 | 3300016387 | Soil | VNDEIWLPHQLAVKVDVRLALLKNYNVDIEQTFRDYKKFRTSSKVVGMGEVQEPR |
Ga0182039_102693693 | 3300016422 | Soil | LAVKVDVRVVLLKNFNVDVEQTFRDYRKFRTSSKIVGMGEVPKPK |
Ga0182038_116319031 | 3300016445 | Soil | LALLKNFNVDVEQTFRDYKKFTASSKIVGISEVQGPK |
Ga0187818_102731122 | 3300017823 | Freshwater Sediment | LKIDVRLALLKNFNVEDEITYRDYQKFRTGTKIVPLGEVSEQQ |
Ga0187854_103184942 | 3300017938 | Peatland | PLHVAAKIDVRLALLKNFDVNVEQTFRDYKKFRATARIVSVGEVKP |
Ga0187853_101641803 | 3300017940 | Peatland | PLHVAAHVDVRLALLKNFDVNVEQTYRDYKKFRATAKIVDLGEVQPNAPPK |
Ga0187819_104203912 | 3300017943 | Freshwater Sediment | QHLTFKLDARLALLKGFKIEDEQTFRDYKKFRTDAKITGVGEVQEQK |
Ga0187819_107858312 | 3300017943 | Freshwater Sediment | RLALVKNFNVDMEQTFRDYKKFRTSAKIVGVGEIQEQK |
Ga0187817_108140031 | 3300017955 | Freshwater Sediment | PLLLTAKIDVRLALVKNFNVGVEQTYRDYKKFRTSATIVGVSEVQDQK |
Ga0187779_106515712 | 3300017959 | Tropical Peatland | WLPQHVTFKVDVRLALLKNFNIDGEQTYRDYKKFRTSAKIVGVGEVQDPK |
Ga0187779_111768961 | 3300017959 | Tropical Peatland | VWLPQHVTFKVDVRLALLKNFNIDGEQTYRDYKKFRTSAKIVGIGEVQDSK |
Ga0187780_100122017 | 3300017973 | Tropical Peatland | MSGLALVKNFNVDVDQTYRDYKKFRTSARIVGVGEVQDQK |
Ga0187782_110963962 | 3300017975 | Tropical Peatland | GEVWLPRHVQFHVDARVALLKEYREDVDPTFRDYKKFRTESKITLVGDPQ |
Ga0187782_112202872 | 3300017975 | Tropical Peatland | MTRVPLWKRATKIDVRLALVKNFNVDVDQTYRDYKKFRTSARIVGVGEVQEQK |
Ga0187767_102566831 | 3300017999 | Tropical Peatland | VALLKGFKMEDEQTFRDYKKFRTDAKVTGIGEVQPEK |
Ga0187860_12831592 | 3300018014 | Peatland | AVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK |
Ga0187886_10867012 | 3300018018 | Peatland | VNEEVWLPRQLTAKINVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK |
Ga0187861_101335471 | 3300018020 | Peatland | DEVWLPLHVAAKIDVRLALLKNFDVNVEQTFRDYKKFRATARIVSVGEVKP |
Ga0187864_103172842 | 3300018022 | Peatland | QHVAVKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK |
Ga0187885_100340253 | 3300018025 | Peatland | ANDEVWLPQHVGLKIDARLALLKEYHVELEQTFRDYKRFRATTKILAVEDVQKK |
Ga0187869_104097091 | 3300018030 | Peatland | VKVDARLALLKEYNVEQEQTFRDYKKFRATTRILAVEDVQKK |
Ga0187875_100122743 | 3300018035 | Peatland | VNEEVWLPRQLTAKIDVRLALLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK |
Ga0187883_105389252 | 3300018037 | Peatland | MLEQTRVNDEAWLPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATARIVSVGDVKP |
Ga0187871_101126361 | 3300018042 | Peatland | AWLPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATAKIVSVGEAKP |
Ga0187887_107436732 | 3300018043 | Peatland | LLPRQVSLNIDVRLALLKNFNVNVEQSFHDYKKFRATTRILAVEDVQKK |
Ga0187784_102015581 | 3300018062 | Tropical Peatland | RLALLKNFDVGLEQTYRDYKKFRTSARIVSIGEVKDK |
Ga0187772_110606581 | 3300018085 | Tropical Peatland | VWLPLHLTAKIDVRLALLKHFDVNVEQSYRDYKKFRATAKIVTTGAIREK |
Ga0187771_105016122 | 3300018088 | Tropical Peatland | LALLRNFDIGLDQTYRDYKKFRTSAKIVGVGEVRDDK |
Ga0187771_105750492 | 3300018088 | Tropical Peatland | LVKNFNVALEQTYRGYRKFRTSARIVGVGEVQDPK |
Ga0187770_101188681 | 3300018090 | Tropical Peatland | LRLALLKNFRVDLEQTFHDYKKFRADTKIVGIGEVQEQK |
Ga0182025_13755681 | 3300019786 | Permafrost | VRLALLKNFNVDVEQTFRDYKKFRATTKIFTVEDVQKK |
Ga0193728_13537202 | 3300019890 | Soil | WLPLHLAAKIDVRLGLIKNFDVDLEQSFRDYKKFRASSKITAGGEVQDQK |
Ga0210407_105481121 | 3300020579 | Soil | QLAFKIGVRLALLKSFKLDAEQTFRDYKKFRTDAKIVGVGELQPEK |
Ga0213875_104438741 | 3300021388 | Plant Roots | HVDVKVDARLALLKSFNQDIDLTYRDYKKFRSGSRILGVGAPAEEK |
Ga0210385_111872091 | 3300021402 | Soil | LALLKNFNVDVEQTFRDYKKFRATTRIVGVGEVKQ |
Ga0210384_104096711 | 3300021432 | Soil | QLKVDVRLALVKDFKVEQEQTFRDYKKFRTSTRIVGTSEIQPK |
Ga0210384_105800043 | 3300021432 | Soil | QFHIDVRLALLKNYDEDVEQTFRDYKKFRADSKITFIGETQ |
Ga0210390_110999442 | 3300021474 | Soil | LPLHVTAKIDVRLALLKNFDVDVEQTYRDYKKFRTTAKIVSVGDVK |
Ga0210409_102880583 | 3300021559 | Soil | EVWLPSHVQLKVDVRLALLKDFKVEQEQTFRDYKKFRTSTRIVGTSEIQPK |
Ga0126371_122785422 | 3300021560 | Tropical Forest Soil | ALFKNVNVDVEQSCRDYKKFRASSKIVGVGEVQGPK |
Ga0213880_102318461 | 3300021953 | Exposed Rock | NFKIDVRLALLKNFNVDAEQTFRDYKKFRTDSKIVGVSREPVEK |
Ga0242655_101506162 | 3300022532 | Soil | KLDARLALLKGFKIEDEQTFRDYKKFRTDAKITGVGEVQEQK |
Ga0212123_103187351 | 3300022557 | Iron-Sulfur Acid Spring | VNEEVWLPRQLTAKIDVRLDLLKNFNVDVEQTFRDYKKFRATSRILAVEDLQKK |
Ga0207707_111565512 | 3300025912 | Corn Rhizosphere | ARVALLKGFKMDGEETFRDYKKFRASSKIVGVGEVQKQQ |
Ga0207693_108975321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DVRLALVKEFNVGVEQTFRDYKKFRSSSKIVGVAEVQDERK |
Ga0207690_111079572 | 3300025932 | Corn Rhizosphere | LVKGFNVGLEQTFRDYKKFRVSSKVVGMGEVQEQK |
Ga0207640_106658023 | 3300025981 | Corn Rhizosphere | GVALVKGFNVGPEQTFRDYKKFRASSKIVSVGEVKEQKELDLSLP |
Ga0207677_122366542 | 3300026023 | Miscanthus Rhizosphere | HVTAKIGVRLALLKGFNIGLEQTFRDYKKFRVSSKIVGGGEVQEQK |
Ga0207746_10129622 | 3300026865 | Tropical Forest Soil | LLKNFNVDLEQSYRDYKKFRASSKIIGIGEVQGPK |
Ga0207821_10096741 | 3300026869 | Tropical Forest Soil | AVKVDVRLALFKNYNVDIEQTFRDYKKFRTSSKVVGMGEVQEPR |
Ga0207726_10245011 | 3300027045 | Tropical Forest Soil | VKVDVRLALLKNFNVDLEQSYRDYKKFRASSKIIGIGEVQGPK |
Ga0209039_101497522 | 3300027825 | Bog Forest Soil | HITVKVDVRLALLKDFSLEEEVSFRDYKKFRATARIVGVGDVQEK |
Ga0209701_102671612 | 3300027862 | Vadose Zone Soil | LALLKNFNVEMDQTYRDYKKFRATGRIVGVGEVQEK |
Ga0209488_101397721 | 3300027903 | Vadose Zone Soil | KVDVRLALLKNFNVEADQTFRDYKKFGATTRILDVVDVQDK |
Ga0302153_101682362 | 3300028574 | Bog | KVDARIALLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH |
Ga0302301_10575312 | 3300028731 | Palsa | LPLHVTAKIDVRLALLKNFDVNVEQTYRDYKKFRATARIVGVGEVKP |
Ga0302189_101918952 | 3300028788 | Bog | WLPLHLTAKIDVRIGLIKNFDVDVEQTYRDYKKFRATAKIVGVGDVQEK |
Ga0311369_1000089840 | 3300029910 | Palsa | LKVDVRLALLKEYNVEQEQTFRDYKKFRATARIVGVGDVKP |
Ga0311330_100861225 | 3300029945 | Bog | KHVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDEK |
Ga0311346_103194341 | 3300029952 | Bog | QHVALKVDARIALLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH |
Ga0311342_100983754 | 3300029955 | Bog | HVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDEK |
Ga0302277_12562922 | 3300029982 | Bog | LLKEYNVEQDMTFRDYKKFRATSRILAVEDVQKKQPPIAPVH |
Ga0302276_103554231 | 3300029992 | Bog | RIGLIKNFDVDVEQTYRDYKKFRATAKIVGVGDVQEK |
Ga0311355_104088612 | 3300030580 | Palsa | VRLALLKNFDVNVEQTYRDYKKFRATARIVGVGEVKP |
Ga0302311_110689452 | 3300030739 | Palsa | LHVTAKIDVRLALLKNFDVDLEQTYRDYKKFRATARIVGVGEVQEK |
Ga0075398_107469701 | 3300030778 | Soil | VWLPAHVTAKIDVRVGLIKNFDVDLDQSFRDYKKFRSSSKVVVGDEVKE |
Ga0302320_100318781 | 3300031524 | Bog | KHVSVKIDVRLALLKNFNAEQEQTFRDYKKFRASARVVGIGDVK |
Ga0318541_101646132 | 3300031545 | Soil | QLAVKVDVRLALLKDFNVDIEQTFRDYKKFRSSSKIVSVGEVQEPK |
Ga0310915_103191292 | 3300031573 | Soil | QLAVKVDVRLALLKNFNVDIEQTFRDYKKFRTSSKVVGVGEVQEPK |
Ga0307476_102084761 | 3300031715 | Hardwood Forest Soil | RLALLKEFNVSMDQTYRDYKKFRATTRIVDVGSVEK |
Ga0307477_101952851 | 3300031753 | Hardwood Forest Soil | IDVRLALVKNFNVDMEQTFRDYKKFRTSAKIVGVSEVQDQKVADQK |
Ga0307477_105010202 | 3300031753 | Hardwood Forest Soil | LPRQLTVKIDVRLALLKNFNVDVEQTFRDYKKFRATTKIVGVGEVKQ |
Ga0307477_110467481 | 3300031753 | Hardwood Forest Soil | VWLPSHVQLKVDVRLALLKDFKVEQEQTFRDYKKFRASTRIVGTSEIQPK |
Ga0307475_112049001 | 3300031754 | Hardwood Forest Soil | WLPSQVAFKIGVRLAVLKNFNVDEEQTFRDYKKFRTDTKIVGVGEVQSEK |
Ga0302319_100503015 | 3300031788 | Bog | MTAKIDVRLALLKNFDVEVEQTYRDYKKFRATAKIVSVGDVKP |
Ga0307478_107178841 | 3300031823 | Hardwood Forest Soil | VDVRVALLKEFNVDGEQTFRDYKKFQATTKILGMTEVKDTK |
Ga0306921_105152582 | 3300031912 | Soil | MLEQMRVNDEIWLPHQLAVKVGVRLALLKNYNVDIEQTFRDYKKFRTSSRVVGMGEVQ |
Ga0310909_113085771 | 3300031947 | Soil | VNDVVWLPRQLAVKVDVRVVLLKNFNVDVEQTFRDYRKFRTSSKIVGMGEVPKPK |
Ga0318530_104353942 | 3300031959 | Soil | VRLGLVKNFDVNLEQTFRDYKKFRSSSRVIAVGEVHD |
Ga0307479_102186233 | 3300031962 | Hardwood Forest Soil | KVDVRLVLLKDFKVEQEQTFRDYKKFRTSTRIVGTSEIPPK |
Ga0307479_107953592 | 3300031962 | Hardwood Forest Soil | EVWLPRQVAFKIDVRLALLKNFNVNEEQTFRDYKKFRTDSKIVGMSEVQTEK |
Ga0306922_110101861 | 3300032001 | Soil | AVKVDVRLALLKNFNVDLEQSYRDYKKFRASSRIVGIGELQGPK |
Ga0306920_1006190942 | 3300032261 | Soil | MLEQMRVNDEIWLPHQLAVKVDVRLALLKNYNVDIEQTFRDYKKFRTSSRVVGMGEVQ |
Ga0306920_1042527761 | 3300032261 | Soil | WLPRQLAVKVDVRLALLKNFNVDVEQTFRDYKKFTASSKIVGVGEVPGPK |
Ga0348332_120816392 | 3300032515 | Plant Litter | KIDVRLALVKNFDVGVEQTYRDYKKFRATSRIVGVSDAKQ |
Ga0335085_100435938 | 3300032770 | Soil | VQFHADIRLALLKNFDVDVEQTFRDYKKFRSESKITVVGETQ |
Ga0335085_100465349 | 3300032770 | Soil | DVRLALMKNFNVDLEQSYRDYKKFRSSSRIVGFEEVQQPK |
Ga0335085_111457872 | 3300032770 | Soil | TAKVDVRLALLKNFNADIEQEYRDYKKFRTSSKIVGVAEVKDHQ |
Ga0335079_100209601 | 3300032783 | Soil | EQTRVNNEVWLPLHLEAKIDARLALLKNLDVGLEQSFRDYKKFGSSTKIVGMSEVQEQK |
Ga0335080_120649512 | 3300032828 | Soil | IAKIDVRLALLKNFDIDLEQSYRDYKKFRTSTKILGFGEVKDTK |
Ga0335073_108180433 | 3300033134 | Soil | RELTAKIDVRLALFKNFDVDVEQSFRDYKKFRATTKLLPADAVQEPEEKK |
Ga0335073_118344522 | 3300033134 | Soil | LTAKIDVRLGLVKNFDVQLEQAFRDYKKFGSSTKVIAGGEVKERD |
Ga0314861_0122444_1187_1300 | 3300033977 | Peatland | LALVKNVDVGLEQTYRDYKKFRTSSRIVSVGEVQQQK |
Ga0326723_0220742_3_128 | 3300034090 | Peat Soil | QFHVDVRLALLKNFNVDVEQTFRDYKKFRSESKITLVGESQ |
⦗Top⦘ |