Basic Information | |
---|---|
Family ID | F044753 |
Family Type | Metagenome |
Number of Sequences | 154 |
Average Sequence Length | 44 residues |
Representative Sequence | LVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAVSL |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.05 % |
% of genes near scaffold ends (potentially truncated) | 98.70 % |
% of genes from short scaffolds (< 2000 bps) | 88.96 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.883 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.987 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.026 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.597 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 2.86% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF00551 | Formyl_trans_N | 24.68 |
PF12706 | Lactamase_B_2 | 9.74 |
PF01593 | Amino_oxidase | 6.49 |
PF01842 | ACT | 5.19 |
PF02678 | Pirin | 2.60 |
PF00072 | Response_reg | 1.30 |
PF03070 | TENA_THI-4 | 1.30 |
PF08042 | PqqA | 1.30 |
PF04674 | Phi_1 | 0.65 |
PF01321 | Creatinase_N | 0.65 |
PF00196 | GerE | 0.65 |
PF04820 | Trp_halogenase | 0.65 |
PF13620 | CarboxypepD_reg | 0.65 |
PF01229 | Glyco_hydro_39 | 0.65 |
PF08669 | GCV_T_C | 0.65 |
PF00848 | Ring_hydroxyl_A | 0.65 |
PF01431 | Peptidase_M13 | 0.65 |
PF01571 | GCV_T | 0.65 |
PF14312 | FG-GAP_2 | 0.65 |
PF01757 | Acyl_transf_3 | 0.65 |
PF03575 | Peptidase_S51 | 0.65 |
PF13450 | NAD_binding_8 | 0.65 |
PF13520 | AA_permease_2 | 0.65 |
PF00753 | Lactamase_B | 0.65 |
PF00291 | PALP | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 2.60 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.30 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.65 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.88 % |
Unclassified | root | N/A | 33.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG01CC0HB | Not Available | 533 | Open in IMG/M |
2189573001|GZR05M102GN3MN | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300000567|JGI12270J11330_10215934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300000953|JGI11615J12901_10194414 | Not Available | 744 | Open in IMG/M |
3300001593|JGI12635J15846_10835507 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101087809 | Not Available | 686 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101573079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → marine gamma proteobacterium HTCC2080 | 554 | Open in IMG/M |
3300002911|JGI25390J43892_10130592 | Not Available | 578 | Open in IMG/M |
3300004479|Ga0062595_102275587 | Not Available | 533 | Open in IMG/M |
3300004643|Ga0062591_102673088 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005167|Ga0066672_10732114 | Not Available | 630 | Open in IMG/M |
3300005172|Ga0066683_10151495 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300005177|Ga0066690_10335506 | Not Available | 1024 | Open in IMG/M |
3300005179|Ga0066684_11067700 | Not Available | 518 | Open in IMG/M |
3300005180|Ga0066685_10317763 | Not Available | 1079 | Open in IMG/M |
3300005184|Ga0066671_10290258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
3300005184|Ga0066671_11008638 | Not Available | 523 | Open in IMG/M |
3300005290|Ga0065712_10427575 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300005436|Ga0070713_101057002 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005444|Ga0070694_100913790 | Not Available | 725 | Open in IMG/M |
3300005533|Ga0070734_10720628 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005538|Ga0070731_10056084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2622 | Open in IMG/M |
3300005541|Ga0070733_10580328 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005542|Ga0070732_10155935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
3300005555|Ga0066692_10361069 | Not Available | 921 | Open in IMG/M |
3300005607|Ga0070740_10088441 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
3300006031|Ga0066651_10089852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1527 | Open in IMG/M |
3300006050|Ga0075028_100043606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2127 | Open in IMG/M |
3300006059|Ga0075017_101481573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 534 | Open in IMG/M |
3300006163|Ga0070715_10415798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300006175|Ga0070712_100803105 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300006755|Ga0079222_12662115 | Not Available | 503 | Open in IMG/M |
3300006797|Ga0066659_10368275 | Not Available | 1120 | Open in IMG/M |
3300006903|Ga0075426_11268373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300006914|Ga0075436_100837773 | Not Available | 686 | Open in IMG/M |
3300007076|Ga0075435_101106305 | Not Available | 693 | Open in IMG/M |
3300007265|Ga0099794_10702507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300009012|Ga0066710_101659413 | Not Available | 975 | Open in IMG/M |
3300009090|Ga0099827_11938842 | Not Available | 513 | Open in IMG/M |
3300009101|Ga0105247_11019499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300009137|Ga0066709_102660704 | Not Available | 668 | Open in IMG/M |
3300009137|Ga0066709_103147298 | Not Available | 603 | Open in IMG/M |
3300009523|Ga0116221_1054030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1860 | Open in IMG/M |
3300009523|Ga0116221_1266960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300009551|Ga0105238_10305746 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300009665|Ga0116135_1164885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300009672|Ga0116215_1289037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300010304|Ga0134088_10431213 | Not Available | 645 | Open in IMG/M |
3300010335|Ga0134063_10607510 | Not Available | 557 | Open in IMG/M |
3300010358|Ga0126370_12069955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300010373|Ga0134128_10061162 | All Organisms → cellular organisms → Bacteria | 4334 | Open in IMG/M |
3300010373|Ga0134128_10202884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2232 | Open in IMG/M |
3300010396|Ga0134126_10028261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7108 | Open in IMG/M |
3300010401|Ga0134121_13088341 | Not Available | 513 | Open in IMG/M |
3300011270|Ga0137391_10014362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6415 | Open in IMG/M |
3300012201|Ga0137365_10299479 | Not Available | 1192 | Open in IMG/M |
3300012362|Ga0137361_10505263 | Not Available | 1110 | Open in IMG/M |
3300012363|Ga0137390_10023903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5723 | Open in IMG/M |
3300012582|Ga0137358_10110041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1869 | Open in IMG/M |
3300012917|Ga0137395_10568497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300012923|Ga0137359_10232248 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
3300012925|Ga0137419_11090124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 665 | Open in IMG/M |
3300012929|Ga0137404_10614346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
3300012929|Ga0137404_12020715 | Not Available | 538 | Open in IMG/M |
3300012985|Ga0164308_12303152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 501 | Open in IMG/M |
3300012988|Ga0164306_10083118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2043 | Open in IMG/M |
3300013307|Ga0157372_11546147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300014165|Ga0181523_10840287 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300014498|Ga0182019_10630788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
3300014502|Ga0182021_12336766 | Not Available | 643 | Open in IMG/M |
3300017823|Ga0187818_10061361 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300017928|Ga0187806_1179106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300017930|Ga0187825_10044121 | Not Available | 1509 | Open in IMG/M |
3300017943|Ga0187819_10255688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
3300017943|Ga0187819_10540269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300017947|Ga0187785_10068383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
3300018040|Ga0187862_10737194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 574 | Open in IMG/M |
3300018085|Ga0187772_10372133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300018088|Ga0187771_10357702 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300018431|Ga0066655_10633946 | Not Available | 722 | Open in IMG/M |
3300018433|Ga0066667_10864121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300019789|Ga0137408_1034307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 539 | Open in IMG/M |
3300019878|Ga0193715_1049584 | Not Available | 901 | Open in IMG/M |
3300019890|Ga0193728_1195373 | Not Available | 854 | Open in IMG/M |
3300020018|Ga0193721_1159420 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300020022|Ga0193733_1002133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5793 | Open in IMG/M |
3300020579|Ga0210407_10372145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
3300020581|Ga0210399_10260239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
3300020581|Ga0210399_11447399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 535 | Open in IMG/M |
3300020582|Ga0210395_11045687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300020583|Ga0210401_10233210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1699 | Open in IMG/M |
3300020583|Ga0210401_10880590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300020583|Ga0210401_11154610 | Not Available | 633 | Open in IMG/M |
3300021088|Ga0210404_10252141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300021344|Ga0193719_10095197 | Not Available | 1294 | Open in IMG/M |
3300021401|Ga0210393_10319918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300021403|Ga0210397_11181787 | Not Available | 595 | Open in IMG/M |
3300021432|Ga0210384_10018164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6850 | Open in IMG/M |
3300021445|Ga0182009_10111639 | Not Available | 1260 | Open in IMG/M |
3300021477|Ga0210398_10134678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2008 | Open in IMG/M |
3300021478|Ga0210402_10608600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
3300021559|Ga0210409_10551796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300022881|Ga0224545_1021470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
3300023101|Ga0224557_1168861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300025898|Ga0207692_10193080 | Not Available | 1193 | Open in IMG/M |
3300025906|Ga0207699_10842690 | Not Available | 675 | Open in IMG/M |
3300025911|Ga0207654_11396489 | Not Available | 511 | Open in IMG/M |
3300025915|Ga0207693_11345697 | Not Available | 532 | Open in IMG/M |
3300025921|Ga0207652_10066081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3133 | Open in IMG/M |
3300025922|Ga0207646_10754058 | Not Available | 868 | Open in IMG/M |
3300025924|Ga0207694_10085807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2478 | Open in IMG/M |
3300025934|Ga0207686_11195773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300026078|Ga0207702_11104627 | Not Available | 787 | Open in IMG/M |
3300026088|Ga0207641_12302759 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300026294|Ga0209839_10040342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1728 | Open in IMG/M |
3300026301|Ga0209238_1250330 | Not Available | 527 | Open in IMG/M |
3300026330|Ga0209473_1038624 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300026360|Ga0257173_1037853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300026552|Ga0209577_10010473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8425 | Open in IMG/M |
3300026552|Ga0209577_10363895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1059 | Open in IMG/M |
3300027432|Ga0209421_1087884 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300027502|Ga0209622_1105842 | Not Available | 516 | Open in IMG/M |
3300027641|Ga0208827_1067620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300027662|Ga0208565_1237003 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027737|Ga0209038_10054871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
3300027846|Ga0209180_10656256 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300027854|Ga0209517_10344342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300027882|Ga0209590_10927797 | Not Available | 547 | Open in IMG/M |
3300027903|Ga0209488_10558045 | Not Available | 835 | Open in IMG/M |
3300027915|Ga0209069_10647552 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027986|Ga0209168_10481995 | Not Available | 600 | Open in IMG/M |
3300030000|Ga0311337_10518982 | Not Available | 1019 | Open in IMG/M |
3300031573|Ga0310915_10845445 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031681|Ga0318572_10619598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300031716|Ga0310813_11180364 | Not Available | 704 | Open in IMG/M |
3300031720|Ga0307469_11808606 | Not Available | 590 | Open in IMG/M |
3300031724|Ga0318500_10554830 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031823|Ga0307478_11611108 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031910|Ga0306923_10224400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2149 | Open in IMG/M |
3300031938|Ga0308175_102242882 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300031941|Ga0310912_10575433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300032001|Ga0306922_12058440 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300032008|Ga0318562_10615175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 627 | Open in IMG/M |
3300032160|Ga0311301_12164944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300032180|Ga0307471_101508404 | Not Available | 830 | Open in IMG/M |
3300032205|Ga0307472_100206109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1500 | Open in IMG/M |
3300032782|Ga0335082_11414369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300032805|Ga0335078_11799897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300032829|Ga0335070_10935206 | Not Available | 802 | Open in IMG/M |
3300032897|Ga0335071_10655403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300032898|Ga0335072_10646669 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300032898|Ga0335072_11616001 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300033405|Ga0326727_10857027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300033977|Ga0314861_0052653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2250 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.99% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.19% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.90% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.60% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.60% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.95% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.95% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.30% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.30% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.65% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.65% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_01524400 | 2067725004 | Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLE |
FD2_08148600 | 2189573001 | Grass Soil | LAEDPKWELAILATVQGFYEKLLQEAVDGEVPVPVGLEAVSLQDES |
JGI12270J11330_102159343 | 3300000567 | Peatlands Soil | VVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPAGLEAIS |
JGI11615J12901_101944142 | 3300000953 | Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDHDAAEILGS |
JGI12635J15846_108355072 | 3300001593 | Forest Soil | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPA |
JGIcombinedJ26739_1010878092 | 3300002245 | Forest Soil | LVEDPKWELAILATVQGFYEKLLQTPLEGEVPVPQGLEAI |
JGIcombinedJ26739_1015730792 | 3300002245 | Forest Soil | VRAGATVVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGL |
JGI25390J43892_101305921 | 3300002911 | Grasslands Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISL |
Ga0062595_1022755872 | 3300004479 | Soil | LVEDPKWELAILATVQGFCEKLLQGSVGGEVPVPAELATISLQQDGEVPQ |
Ga0062591_1026730881 | 3300004643 | Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGD |
Ga0066672_107321142 | 3300005167 | Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQADGDV |
Ga0066683_101514951 | 3300005172 | Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSD |
Ga0066690_103355062 | 3300005177 | Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLESISLQQADGDV |
Ga0066684_110677001 | 3300005179 | Soil | LAEDPKWELAILATVQGFYEKLLQSAVDGEVPVPVGLEAV |
Ga0066685_103177631 | 3300005180 | Soil | VRLIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDT |
Ga0066671_102902582 | 3300005184 | Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQG |
Ga0066671_110086382 | 3300005184 | Soil | VSEDPKWELAILASVQSFHEKLLQEYIDGEVPVPQGLEAISLQQDDGDV |
Ga0065712_104275752 | 3300005290 | Miscanthus Rhizosphere | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSDVGEMLGA |
Ga0070713_1010570021 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEDPKWELAILATVQGFYEKLLQECVGGEVPVPAGLEGISLQQGEGE |
Ga0070694_1009137901 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADGDVHETL |
Ga0070734_107206282 | 3300005533 | Surface Soil | LVEDPKWELAILATVQGFYEKLLQVPVGGEVPVPAGLEAVSLQSENDVTETLSV |
Ga0070731_100560843 | 3300005538 | Surface Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDGEV |
Ga0070733_105803282 | 3300005541 | Surface Soil | VGTGLIEDPKWELAILATVQGFYEKLLQEHVGGEVPVPEGLETVSLQETDDNIVGTLS |
Ga0070732_101559351 | 3300005542 | Surface Soil | VVEDPKWELAILATVQGFYEKLLQEAVCGEVPVPAGLEAISLQSSDDSVVETLS |
Ga0066692_103610692 | 3300005555 | Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQA |
Ga0070740_100884413 | 3300005607 | Surface Soil | LAEDPKWELAILATVQGFYEKLLQDAVDGEVPVPAGLETVSLQDD |
Ga0066651_100898523 | 3300006031 | Soil | LVEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDGD |
Ga0075028_1000436061 | 3300006050 | Watersheds | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQSDGSVLETLSSM |
Ga0075017_1014815732 | 3300006059 | Watersheds | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDG |
Ga0070715_104157982 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQ |
Ga0070712_1008031051 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEDPKWELAILATVQGFYERLLQEPLRGEVPVPAGL |
Ga0079222_126621151 | 3300006755 | Agricultural Soil | LVEDPKWELAILATVQGFYEKLLQDAVGGEVPVPAMLEAVSLQQA |
Ga0066659_103682751 | 3300006797 | Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGENDVGEIL |
Ga0075426_112683732 | 3300006903 | Populus Rhizosphere | VAEDPKWELAILATVQGFYEKLLQEYVGGEVPVPAGLEAISLQQGDGEVHGTL |
Ga0075436_1008377732 | 3300006914 | Populus Rhizosphere | LAEDPKWELAILATVQGFYEKLLQAAVDGEVPVPVGLEAVSLQDDGNVGGT |
Ga0075435_1011063052 | 3300007076 | Populus Rhizosphere | LVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPA |
Ga0099794_107025072 | 3300007265 | Vadose Zone Soil | VAEDPKWELAILATVQGFYEKLMQEYVGGEVPVPAGLEAISLQQGEGE |
Ga0066710_1016594131 | 3300009012 | Grasslands Soil | LAEDPKWELAILATVQGFYEKLLQEAVDGEVPVPVG |
Ga0099827_119388422 | 3300009090 | Vadose Zone Soil | LIEDPKWELAILATVQGFYEKLLQEPVGADVPVPAGL |
Ga0105247_110194991 | 3300009101 | Switchgrass Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVHATLDR |
Ga0066709_1026607042 | 3300009137 | Grasslands Soil | VRLIEDPKWELAILATVQGFHEKLLQEPVGADVPVPAGLDT |
Ga0066709_1031472981 | 3300009137 | Grasslands Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQADGDVNET |
Ga0116221_10540303 | 3300009523 | Peatlands Soil | VVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQSDDSVLETLSTM |
Ga0116221_12669602 | 3300009523 | Peatlands Soil | LVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQS |
Ga0105238_103057463 | 3300009551 | Corn Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVH |
Ga0116135_11648851 | 3300009665 | Peatland | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQSDDGVQQTL |
Ga0116215_12890371 | 3300009672 | Peatlands Soil | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGL |
Ga0134088_104312131 | 3300010304 | Grasslands Soil | LIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDTIS |
Ga0134063_106075101 | 3300010335 | Grasslands Soil | LIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDTVSLQ |
Ga0126370_120699551 | 3300010358 | Tropical Forest Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLHG |
Ga0134128_100611625 | 3300010373 | Terrestrial Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPTGLEAVSLQDEEGDV* |
Ga0134128_102028843 | 3300010373 | Terrestrial Soil | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLE |
Ga0134126_100282616 | 3300010396 | Terrestrial Soil | LAEDPKWELAILATVQGFYEKLLQTAVDGEVPVPVGLEAV* |
Ga0134121_130883411 | 3300010401 | Terrestrial Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLET |
Ga0137391_100143621 | 3300011270 | Vadose Zone Soil | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDNDVGETL |
Ga0137365_102994791 | 3300012201 | Vadose Zone Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPI |
Ga0137361_105052632 | 3300012362 | Vadose Zone Soil | LVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPVGLEAISLQQSDGDVH |
Ga0137390_100239031 | 3300012363 | Vadose Zone Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADGDVHETLAA |
Ga0137358_101100412 | 3300012582 | Vadose Zone Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQEGEVHATL |
Ga0137395_105684971 | 3300012917 | Vadose Zone Soil | VVEDPKWELAILATVQGFFEKLLQSSIAGEVPVPLGLEAISLQQSEGD |
Ga0137359_102322483 | 3300012923 | Vadose Zone Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLE |
Ga0137419_110901242 | 3300012925 | Vadose Zone Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQEG |
Ga0137404_106143462 | 3300012929 | Vadose Zone Soil | VAEDPKWELAILATVQGFYEKLMQEYVGGEVPVPAGLEAIS |
Ga0137404_120207151 | 3300012929 | Vadose Zone Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADG |
Ga0164308_123031521 | 3300012985 | Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPSGLEAIS |
Ga0164306_100831182 | 3300012988 | Soil | LAILATVQGFYEKLLQDSIGGEVAVPAGLEAISLQEGYREVHATLER |
Ga0157372_115461473 | 3300013307 | Corn Rhizosphere | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLHGEA |
Ga0181523_108402871 | 3300014165 | Bog | VVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQS |
Ga0182019_106307881 | 3300014498 | Fen | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVHSTLDRM |
Ga0182021_123367661 | 3300014502 | Fen | VVEDPKWDLAILATVQGFYEKLLQELVGGEVPVPG |
Ga0187818_100613612 | 3300017823 | Freshwater Sediment | VVEDPKWELAILATVQGFYEKLLQTSVGGEVPVPAGLEAISLQES |
Ga0187806_11791062 | 3300017928 | Freshwater Sediment | VVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPAGLEAISLQSDDN |
Ga0187825_100441213 | 3300017930 | Freshwater Sediment | LVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPAGLEAVSLQ |
Ga0187819_102556881 | 3300017943 | Freshwater Sediment | VVEDPKWELAILATVQGFYEKLLQEPVCGEVPVPAGLEAISLQSDDSVLET |
Ga0187819_105402692 | 3300017943 | Freshwater Sediment | LVEDPKWELAILATVQGFYEKLLQDHVAGEVPVPAGLEVV |
Ga0187785_100683831 | 3300017947 | Tropical Peatland | LVDDPKWELAILATVQGFYEKLLQEPIGGEVPVPAGLEA |
Ga0187862_107371942 | 3300018040 | Peatland | VVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQSDDGVQQ |
Ga0187772_103721331 | 3300018085 | Tropical Peatland | LVEDPKWELAILATVQGFYEKLLQEPVAGEVPVPGGLEAVS |
Ga0187771_103577021 | 3300018088 | Tropical Peatland | MGEDSQWELAILATVQSFYEKLLQEHVEGEVPVPAGLEAISLQEADEDVRST |
Ga0066655_106339461 | 3300018431 | Grasslands Soil | VRLIEDPKWELAILATVQGLYEKLLQEPVGADVPVPAGLDT |
Ga0066667_108641211 | 3300018433 | Grasslands Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLET |
Ga0137408_10343072 | 3300019789 | Vadose Zone Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISL |
Ga0193715_10495841 | 3300019878 | Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEIPVPDGLE |
Ga0193728_11953732 | 3300019890 | Soil | LAEDPKWELAILATVQGFYEKLLQDRVQGEVPVPHGLEAISLQDDSNVHE |
Ga0193721_11594201 | 3300020018 | Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSL |
Ga0193733_10021335 | 3300020022 | Soil | VAEDPKWELAILATVQGFYEKLLQDSVGGEVPVPAGLEAISLQQGEGEVRATLD |
Ga0210407_103721451 | 3300020579 | Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAI |
Ga0210399_102602392 | 3300020581 | Soil | VVDDPKWELAILATVQGFYEKLLQECVRGEVPVPAGLEAISLQSDDN |
Ga0210399_114473992 | 3300020581 | Soil | VVEDPKWELAILATVQGFYEKLLQNSVGGEVPVPVGLEAISLQESGADVLQTLSQMH |
Ga0210395_110456872 | 3300020582 | Soil | VVEDPKWELAILATVQGFYEKLLQEPVGGEVPVPAGLEAISLQSDG |
Ga0210401_102332101 | 3300020583 | Soil | MSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQ |
Ga0210401_108805901 | 3300020583 | Soil | VVEDPKWELAILATVQGFYEKLLQDHVGGEVPVPAGLEAISLQ |
Ga0210401_111546101 | 3300020583 | Soil | MPRGQLLAEDPKWELAILATVQGFYEKLLQEFVEGEVPVPAGLE |
Ga0210404_102521412 | 3300021088 | Soil | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGL |
Ga0193719_100951972 | 3300021344 | Soil | LAEDPKWELAILATVQGFYEKLLQESVDGEVPVPAG |
Ga0210393_103199181 | 3300021401 | Soil | VVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQSDDSVLET |
Ga0210397_111817872 | 3300021403 | Soil | LVEDPKWELAILATVQGFYEKLLQTPLEGEVPVPQGLEAISLQENDGD |
Ga0210384_100181641 | 3300021432 | Soil | MSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDGEVHA |
Ga0182009_101116392 | 3300021445 | Soil | LVEDPKWELAILATVQGFCEKLLQAPVGGEIPVPLRSE |
Ga0210398_101346781 | 3300021477 | Soil | VVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISL |
Ga0210402_106086003 | 3300021478 | Soil | VVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPSGLE |
Ga0210409_105517961 | 3300021559 | Soil | MSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGD |
Ga0224545_10214702 | 3300022881 | Soil | VVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQSDDSVV |
Ga0224557_11688612 | 3300023101 | Soil | VVEDPKWELAILATVQGFYEKLLQQAVGGEVPVPAGL |
Ga0207692_101930802 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDNDVNG |
Ga0207699_108426902 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDPKWELAILATVQGFCEKLLQQAVAGEVPVPVGL |
Ga0207654_113964892 | 3300025911 | Corn Rhizosphere | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLHGEADV |
Ga0207693_113456972 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETV |
Ga0207652_100660811 | 3300025921 | Corn Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEG |
Ga0207646_107540581 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEDPKWELAILATVQGFYEKLLQEVVGGEVPVPTALEAVSLQQSDGDVNPTLAT |
Ga0207694_100858071 | 3300025924 | Corn Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAIS |
Ga0207686_111957731 | 3300025934 | Miscanthus Rhizosphere | VVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGL |
Ga0207702_111046272 | 3300026078 | Corn Rhizosphere | LVEDPKWELAILATVQGFCEKLLQAPVGGEIPVPAQLETISLQHEGDVQG |
Ga0207641_123027592 | 3300026088 | Switchgrass Rhizosphere | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSDVG |
Ga0209839_100403422 | 3300026294 | Soil | VVEDPKWELAILATVQGFYEKLLQESIGGEVPVPAGLEAISLQEG |
Ga0209238_12503302 | 3300026301 | Grasslands Soil | LVEDPKWELAILATVQGFYEKLLQNSVGGEVPVPIGLEA |
Ga0209473_10386243 | 3300026330 | Soil | LAEDPKWELAILSTVQGFYEKLLQETVGGEVPVPSGL |
Ga0257173_10378531 | 3300026360 | Soil | VVEDSKWELAILATVQGFYEKLLQDSVGGEVPVPAGLEAISLQEG |
Ga0209577_100104737 | 3300026552 | Soil | LVEDPKWELAILATVQGFYEKLLQEPLAGEVPVPVGLEAISLQQSDGDV |
Ga0209577_103638953 | 3300026552 | Soil | LVEDPKWELAILATVQGFYEKLLQAPLAGEVPVPVGLEAISLQQSDGDV |
Ga0209421_10878842 | 3300027432 | Forest Soil | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLESISLQ |
Ga0209622_11058421 | 3300027502 | Forest Soil | LVEDPKWELAILATVQGFYEKLLQEPLDGEVPVPSGLEAISLQQSDGDVHLTL |
Ga0208827_10676201 | 3300027641 | Peatlands Soil | VVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQS |
Ga0208565_12370032 | 3300027662 | Peatlands Soil | LVEDPKWELAILATVQGFYEKLLQEPIAGEVPVPAGLEAVSLQS |
Ga0209038_100548712 | 3300027737 | Bog Forest Soil | VVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAIS |
Ga0209180_106562561 | 3300027846 | Vadose Zone Soil | VVEDPKWELAILATVQGFYEKLLQDSMGGEIPVPAGL |
Ga0209517_103443421 | 3300027854 | Peatlands Soil | VVEDPKWELAILATVQGFYEKLLQEPVGGEVPVPSGLEAISL |
Ga0209590_109277971 | 3300027882 | Vadose Zone Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPDPAQP |
Ga0209488_105580452 | 3300027903 | Vadose Zone Soil | LAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVS |
Ga0209069_106475521 | 3300027915 | Watersheds | VVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQS |
Ga0209168_104819952 | 3300027986 | Surface Soil | LVEDPKWELAILATVQGFYEKLLQVPVGGEVPVPAGLEAVSLQSENDVTET |
Ga0311337_105189821 | 3300030000 | Fen | VAEDPKWELAILASVQAFYEKLLQVPLEGEVPVPYGL |
Ga0310915_108454451 | 3300031573 | Soil | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLQGDSDVAEMLG |
Ga0318572_106195982 | 3300031681 | Soil | MRLVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLE |
Ga0310813_111803641 | 3300031716 | Soil | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLH |
Ga0307469_118086061 | 3300031720 | Hardwood Forest Soil | LVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIG |
Ga0318500_105548301 | 3300031724 | Soil | LVEDPKWELAILATVQGCYEKLLQPYAKGEVPVPAGLEDISL |
Ga0307478_116111081 | 3300031823 | Hardwood Forest Soil | LVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPAGLEAVSLQNEENVGATLA |
Ga0306923_102244002 | 3300031910 | Soil | LAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSL |
Ga0308175_1022428821 | 3300031938 | Soil | LVEDPKWELAILATVQGFYEKLLQSSIGGEVPVPQGLE |
Ga0310912_105754331 | 3300031941 | Soil | MRLVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLEDISL |
Ga0306922_120584401 | 3300032001 | Soil | LVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLEDISLQGE |
Ga0318562_106151752 | 3300032008 | Soil | LVEDPKWELAILATVQGFYERLLQEPLHGEVPVPAGLEAVSLQQS |
Ga0311301_121649442 | 3300032160 | Peatlands Soil | LVDDPKWELAILATVQGFYEKLLQDSVGGEVPVPA |
Ga0307471_1015084041 | 3300032180 | Hardwood Forest Soil | LAEDPKWELAILASVQSFEEKLLQEYVDGEVPVPQGLED |
Ga0307472_1002061092 | 3300032205 | Hardwood Forest Soil | VTTEVAEDPKWELAILATVQGFYEKLLQEYVGGEVPVPAGL |
Ga0335082_114143692 | 3300032782 | Soil | LVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAVSL |
Ga0335078_117998971 | 3300032805 | Soil | LVDDPKWELAILATVQGFYEKLLQEPIGGEVPVPTGLEAVSLQD |
Ga0335070_109352062 | 3300032829 | Soil | VEDPKWELAILATVQGFYEKLLQESLEGEVPVPAGLETISLQQDD |
Ga0335071_106554032 | 3300032897 | Soil | LVDDPKWELAILATVQGFYEKLLQEPVGGEVPVPA |
Ga0335072_106466691 | 3300032898 | Soil | LAEDPKWELAILATVQGFYEKLLQDAVEGEVPVPAGLETV |
Ga0335072_116160011 | 3300032898 | Soil | LAEDPKWELAILATVQGFYEKLLQSPVGGEVPVPAGLEAVSLQSDNDVGET |
Ga0326727_108570271 | 3300033405 | Peat Soil | VVEDPKWELAILATVQGFYEKLLQQAVGGEVPVPAGLE |
Ga0314861_0052653_2102_2248 | 3300033977 | Peatland | VVEDSKWELAILATVQGFYEKLLQEHVAGEVPVPAGLEAISLQESEDGL |
⦗Top⦘ |