NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044753

Metagenome Family F044753

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044753
Family Type Metagenome
Number of Sequences 154
Average Sequence Length 44 residues
Representative Sequence LVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAVSL
Number of Associated Samples 142
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.05 %
% of genes near scaffold ends (potentially truncated) 98.70 %
% of genes from short scaffolds (< 2000 bps) 88.96 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.883 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.987 % of family members)
Environment Ontology (ENVO) Unclassified
(24.026 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.597 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.43%    β-sheet: 2.86%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF00551Formyl_trans_N 24.68
PF12706Lactamase_B_2 9.74
PF01593Amino_oxidase 6.49
PF01842ACT 5.19
PF02678Pirin 2.60
PF00072Response_reg 1.30
PF03070TENA_THI-4 1.30
PF08042PqqA 1.30
PF04674Phi_1 0.65
PF01321Creatinase_N 0.65
PF00196GerE 0.65
PF04820Trp_halogenase 0.65
PF13620CarboxypepD_reg 0.65
PF01229Glyco_hydro_39 0.65
PF08669GCV_T_C 0.65
PF00848Ring_hydroxyl_A 0.65
PF01431Peptidase_M13 0.65
PF01571GCV_T 0.65
PF14312FG-GAP_2 0.65
PF01757Acyl_transf_3 0.65
PF03575Peptidase_S51 0.65
PF13450NAD_binding_8 0.65
PF13520AA_permease_2 0.65
PF00753Lactamase_B 0.65
PF00291PALP 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 2.60
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.30
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.65
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.65
COG3664Beta-xylosidaseCarbohydrate transport and metabolism [G] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.88 %
UnclassifiedrootN/A33.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG01CC0HBNot Available533Open in IMG/M
2189573001|GZR05M102GN3MNAll Organisms → cellular organisms → Bacteria534Open in IMG/M
3300000567|JGI12270J11330_10215934All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300000953|JGI11615J12901_10194414Not Available744Open in IMG/M
3300001593|JGI12635J15846_10835507All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300002245|JGIcombinedJ26739_101087809Not Available686Open in IMG/M
3300002245|JGIcombinedJ26739_101573079All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → marine gamma proteobacterium HTCC2080554Open in IMG/M
3300002911|JGI25390J43892_10130592Not Available578Open in IMG/M
3300004479|Ga0062595_102275587Not Available533Open in IMG/M
3300004643|Ga0062591_102673088All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005167|Ga0066672_10732114Not Available630Open in IMG/M
3300005172|Ga0066683_10151495All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300005177|Ga0066690_10335506Not Available1024Open in IMG/M
3300005179|Ga0066684_11067700Not Available518Open in IMG/M
3300005180|Ga0066685_10317763Not Available1079Open in IMG/M
3300005184|Ga0066671_10290258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1022Open in IMG/M
3300005184|Ga0066671_11008638Not Available523Open in IMG/M
3300005290|Ga0065712_10427575All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005436|Ga0070713_101057002All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300005444|Ga0070694_100913790Not Available725Open in IMG/M
3300005533|Ga0070734_10720628All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005538|Ga0070731_10056084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2622Open in IMG/M
3300005541|Ga0070733_10580328All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005542|Ga0070732_10155935All Organisms → cellular organisms → Bacteria → Acidobacteria1360Open in IMG/M
3300005555|Ga0066692_10361069Not Available921Open in IMG/M
3300005607|Ga0070740_10088441All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300006031|Ga0066651_10089852All Organisms → cellular organisms → Bacteria → Proteobacteria1527Open in IMG/M
3300006050|Ga0075028_100043606All Organisms → cellular organisms → Bacteria → Acidobacteria2127Open in IMG/M
3300006059|Ga0075017_101481573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4534Open in IMG/M
3300006163|Ga0070715_10415798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300006175|Ga0070712_100803105All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006755|Ga0079222_12662115Not Available503Open in IMG/M
3300006797|Ga0066659_10368275Not Available1120Open in IMG/M
3300006903|Ga0075426_11268373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300006914|Ga0075436_100837773Not Available686Open in IMG/M
3300007076|Ga0075435_101106305Not Available693Open in IMG/M
3300007265|Ga0099794_10702507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300009012|Ga0066710_101659413Not Available975Open in IMG/M
3300009090|Ga0099827_11938842Not Available513Open in IMG/M
3300009101|Ga0105247_11019499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300009137|Ga0066709_102660704Not Available668Open in IMG/M
3300009137|Ga0066709_103147298Not Available603Open in IMG/M
3300009523|Ga0116221_1054030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1860Open in IMG/M
3300009523|Ga0116221_1266960All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300009551|Ga0105238_10305746All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300009665|Ga0116135_1164885All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300009672|Ga0116215_1289037All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300010304|Ga0134088_10431213Not Available645Open in IMG/M
3300010335|Ga0134063_10607510Not Available557Open in IMG/M
3300010358|Ga0126370_12069955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300010373|Ga0134128_10061162All Organisms → cellular organisms → Bacteria4334Open in IMG/M
3300010373|Ga0134128_10202884All Organisms → cellular organisms → Bacteria → Acidobacteria2232Open in IMG/M
3300010396|Ga0134126_10028261All Organisms → cellular organisms → Bacteria → Proteobacteria7108Open in IMG/M
3300010401|Ga0134121_13088341Not Available513Open in IMG/M
3300011270|Ga0137391_10014362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6415Open in IMG/M
3300012201|Ga0137365_10299479Not Available1192Open in IMG/M
3300012362|Ga0137361_10505263Not Available1110Open in IMG/M
3300012363|Ga0137390_10023903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5723Open in IMG/M
3300012582|Ga0137358_10110041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1869Open in IMG/M
3300012917|Ga0137395_10568497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300012923|Ga0137359_10232248All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300012925|Ga0137419_11090124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4665Open in IMG/M
3300012929|Ga0137404_10614346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium978Open in IMG/M
3300012929|Ga0137404_12020715Not Available538Open in IMG/M
3300012985|Ga0164308_12303152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4501Open in IMG/M
3300012988|Ga0164306_10083118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2043Open in IMG/M
3300013307|Ga0157372_11546147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300014165|Ga0181523_10840287All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300014498|Ga0182019_10630788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300014502|Ga0182021_12336766Not Available643Open in IMG/M
3300017823|Ga0187818_10061361All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300017928|Ga0187806_1179106All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300017930|Ga0187825_10044121Not Available1509Open in IMG/M
3300017943|Ga0187819_10255688All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300017943|Ga0187819_10540269All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300017947|Ga0187785_10068383All Organisms → cellular organisms → Bacteria → Acidobacteria1365Open in IMG/M
3300018040|Ga0187862_10737194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4574Open in IMG/M
3300018085|Ga0187772_10372133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300018088|Ga0187771_10357702All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300018431|Ga0066655_10633946Not Available722Open in IMG/M
3300018433|Ga0066667_10864121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300019789|Ga0137408_1034307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4539Open in IMG/M
3300019878|Ga0193715_1049584Not Available901Open in IMG/M
3300019890|Ga0193728_1195373Not Available854Open in IMG/M
3300020018|Ga0193721_1159420All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300020022|Ga0193733_1002133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5793Open in IMG/M
3300020579|Ga0210407_10372145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300020581|Ga0210399_10260239All Organisms → cellular organisms → Bacteria → Acidobacteria1447Open in IMG/M
3300020581|Ga0210399_11447399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium535Open in IMG/M
3300020582|Ga0210395_11045687All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300020583|Ga0210401_10233210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1699Open in IMG/M
3300020583|Ga0210401_10880590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300020583|Ga0210401_11154610Not Available633Open in IMG/M
3300021088|Ga0210404_10252141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium960Open in IMG/M
3300021344|Ga0193719_10095197Not Available1294Open in IMG/M
3300021401|Ga0210393_10319918All Organisms → cellular organisms → Bacteria → Acidobacteria1261Open in IMG/M
3300021403|Ga0210397_11181787Not Available595Open in IMG/M
3300021432|Ga0210384_10018164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6850Open in IMG/M
3300021445|Ga0182009_10111639Not Available1260Open in IMG/M
3300021477|Ga0210398_10134678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium2008Open in IMG/M
3300021478|Ga0210402_10608600All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300021559|Ga0210409_10551796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300022881|Ga0224545_1021470All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300023101|Ga0224557_1168861All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300025898|Ga0207692_10193080Not Available1193Open in IMG/M
3300025906|Ga0207699_10842690Not Available675Open in IMG/M
3300025911|Ga0207654_11396489Not Available511Open in IMG/M
3300025915|Ga0207693_11345697Not Available532Open in IMG/M
3300025921|Ga0207652_10066081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3133Open in IMG/M
3300025922|Ga0207646_10754058Not Available868Open in IMG/M
3300025924|Ga0207694_10085807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2478Open in IMG/M
3300025934|Ga0207686_11195773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300026078|Ga0207702_11104627Not Available787Open in IMG/M
3300026088|Ga0207641_12302759All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300026294|Ga0209839_10040342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1728Open in IMG/M
3300026301|Ga0209238_1250330Not Available527Open in IMG/M
3300026330|Ga0209473_1038624All Organisms → cellular organisms → Bacteria2129Open in IMG/M
3300026360|Ga0257173_1037853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300026552|Ga0209577_10010473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8425Open in IMG/M
3300026552|Ga0209577_10363895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_41059Open in IMG/M
3300027432|Ga0209421_1087884All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300027502|Ga0209622_1105842Not Available516Open in IMG/M
3300027641|Ga0208827_1067620All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300027662|Ga0208565_1237003All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027737|Ga0209038_10054871All Organisms → cellular organisms → Bacteria → Acidobacteria1193Open in IMG/M
3300027846|Ga0209180_10656256All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300027854|Ga0209517_10344342All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300027882|Ga0209590_10927797Not Available547Open in IMG/M
3300027903|Ga0209488_10558045Not Available835Open in IMG/M
3300027915|Ga0209069_10647552All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027986|Ga0209168_10481995Not Available600Open in IMG/M
3300030000|Ga0311337_10518982Not Available1019Open in IMG/M
3300031573|Ga0310915_10845445All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300031681|Ga0318572_10619598All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300031716|Ga0310813_11180364Not Available704Open in IMG/M
3300031720|Ga0307469_11808606Not Available590Open in IMG/M
3300031724|Ga0318500_10554830All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031823|Ga0307478_11611108All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031910|Ga0306923_10224400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2149Open in IMG/M
3300031938|Ga0308175_102242882All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031941|Ga0310912_10575433All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300032001|Ga0306922_12058440All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032008|Ga0318562_10615175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4627Open in IMG/M
3300032160|Ga0311301_12164944All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300032180|Ga0307471_101508404Not Available830Open in IMG/M
3300032205|Ga0307472_100206109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1500Open in IMG/M
3300032782|Ga0335082_11414369All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300032805|Ga0335078_11799897All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300032829|Ga0335070_10935206Not Available802Open in IMG/M
3300032897|Ga0335071_10655403All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300032898|Ga0335072_10646669All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300032898|Ga0335072_11616001All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300033405|Ga0326727_10857027All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300033977|Ga0314861_0052653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2250Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.25%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.30%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.30%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.30%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.65%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_015244002067725004SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLE
FD2_081486002189573001Grass SoilLAEDPKWELAILATVQGFYEKLLQEAVDGEVPVPVGLEAVSLQDES
JGI12270J11330_1021593433300000567Peatlands SoilVVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPAGLEAIS
JGI11615J12901_1019441423300000953SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDHDAAEILGS
JGI12635J15846_1083550723300001593Forest SoilVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPA
JGIcombinedJ26739_10108780923300002245Forest SoilLVEDPKWELAILATVQGFYEKLLQTPLEGEVPVPQGLEAI
JGIcombinedJ26739_10157307923300002245Forest SoilVRAGATVVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGL
JGI25390J43892_1013059213300002911Grasslands SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISL
Ga0062595_10227558723300004479SoilLVEDPKWELAILATVQGFCEKLLQGSVGGEVPVPAELATISLQQDGEVPQ
Ga0062591_10267308813300004643SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGD
Ga0066672_1073211423300005167SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQADGDV
Ga0066683_1015149513300005172SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSD
Ga0066690_1033550623300005177SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLESISLQQADGDV
Ga0066684_1106770013300005179SoilLAEDPKWELAILATVQGFYEKLLQSAVDGEVPVPVGLEAV
Ga0066685_1031776313300005180SoilVRLIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDT
Ga0066671_1029025823300005184SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQG
Ga0066671_1100863823300005184SoilVSEDPKWELAILASVQSFHEKLLQEYIDGEVPVPQGLEAISLQQDDGDV
Ga0065712_1042757523300005290Miscanthus RhizosphereLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSDVGEMLGA
Ga0070713_10105700213300005436Corn, Switchgrass And Miscanthus RhizosphereVSEDPKWELAILATVQGFYEKLLQECVGGEVPVPAGLEGISLQQGEGE
Ga0070694_10091379013300005444Corn, Switchgrass And Miscanthus RhizosphereLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADGDVHETL
Ga0070734_1072062823300005533Surface SoilLVEDPKWELAILATVQGFYEKLLQVPVGGEVPVPAGLEAVSLQSENDVTETLSV
Ga0070731_1005608433300005538Surface SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDGEV
Ga0070733_1058032823300005541Surface SoilVGTGLIEDPKWELAILATVQGFYEKLLQEHVGGEVPVPEGLETVSLQETDDNIVGTLS
Ga0070732_1015593513300005542Surface SoilVVEDPKWELAILATVQGFYEKLLQEAVCGEVPVPAGLEAISLQSSDDSVVETLS
Ga0066692_1036106923300005555SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQA
Ga0070740_1008844133300005607Surface SoilLAEDPKWELAILATVQGFYEKLLQDAVDGEVPVPAGLETVSLQDD
Ga0066651_1008985233300006031SoilLVEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDGD
Ga0075028_10004360613300006050WatershedsVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQSDGSVLETLSSM
Ga0075017_10148157323300006059WatershedsVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDG
Ga0070715_1041579823300006163Corn, Switchgrass And Miscanthus RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQ
Ga0070712_10080310513300006175Corn, Switchgrass And Miscanthus RhizosphereLVEDPKWELAILATVQGFYERLLQEPLRGEVPVPAGL
Ga0079222_1266211513300006755Agricultural SoilLVEDPKWELAILATVQGFYEKLLQDAVGGEVPVPAMLEAVSLQQA
Ga0066659_1036827513300006797SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGENDVGEIL
Ga0075426_1126837323300006903Populus RhizosphereVAEDPKWELAILATVQGFYEKLLQEYVGGEVPVPAGLEAISLQQGDGEVHGTL
Ga0075436_10083777323300006914Populus RhizosphereLAEDPKWELAILATVQGFYEKLLQAAVDGEVPVPVGLEAVSLQDDGNVGGT
Ga0075435_10110630523300007076Populus RhizosphereLVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPA
Ga0099794_1070250723300007265Vadose Zone SoilVAEDPKWELAILATVQGFYEKLMQEYVGGEVPVPAGLEAISLQQGEGE
Ga0066710_10165941313300009012Grasslands SoilLAEDPKWELAILATVQGFYEKLLQEAVDGEVPVPVG
Ga0099827_1193884223300009090Vadose Zone SoilLIEDPKWELAILATVQGFYEKLLQEPVGADVPVPAGL
Ga0105247_1101949913300009101Switchgrass RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVHATLDR
Ga0066709_10266070423300009137Grasslands SoilVRLIEDPKWELAILATVQGFHEKLLQEPVGADVPVPAGLDT
Ga0066709_10314729813300009137Grasslands SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPVGLEAISLQQADGDVNET
Ga0116221_105403033300009523Peatlands SoilVVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQSDDSVLETLSTM
Ga0116221_126696023300009523Peatlands SoilLVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQS
Ga0105238_1030574633300009551Corn RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVH
Ga0116135_116488513300009665PeatlandVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQSDDGVQQTL
Ga0116215_128903713300009672Peatlands SoilVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGL
Ga0134088_1043121313300010304Grasslands SoilLIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDTIS
Ga0134063_1060751013300010335Grasslands SoilLIEDPKWELAILATVQGFYERLLQEPVGADVPVPAGLDTVSLQ
Ga0126370_1206995513300010358Tropical Forest SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLHG
Ga0134128_1006116253300010373Terrestrial SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPTGLEAVSLQDEEGDV*
Ga0134128_1020288433300010373Terrestrial SoilLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLE
Ga0134126_1002826163300010396Terrestrial SoilLAEDPKWELAILATVQGFYEKLLQTAVDGEVPVPVGLEAV*
Ga0134121_1308834113300010401Terrestrial SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLET
Ga0137391_1001436213300011270Vadose Zone SoilLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDNDVGETL
Ga0137365_1029947913300012201Vadose Zone SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPI
Ga0137361_1050526323300012362Vadose Zone SoilLVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPVGLEAISLQQSDGDVH
Ga0137390_1002390313300012363Vadose Zone SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADGDVHETLAA
Ga0137358_1011004123300012582Vadose Zone SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQEGEVHATL
Ga0137395_1056849713300012917Vadose Zone SoilVVEDPKWELAILATVQGFFEKLLQSSIAGEVPVPLGLEAISLQQSEGD
Ga0137359_1023224833300012923Vadose Zone SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLE
Ga0137419_1109012423300012925Vadose Zone SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISLQEG
Ga0137404_1061434623300012929Vadose Zone SoilVAEDPKWELAILATVQGFYEKLMQEYVGGEVPVPAGLEAIS
Ga0137404_1202071513300012929Vadose Zone SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIGLEAISLQQADG
Ga0164308_1230315213300012985SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPSGLEAIS
Ga0164306_1008311823300012988SoilLAILATVQGFYEKLLQDSIGGEVAVPAGLEAISLQEGYREVHATLER
Ga0157372_1154614733300013307Corn RhizosphereLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLHGEA
Ga0181523_1084028713300014165BogVVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQS
Ga0182019_1063078813300014498FenVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAVSLQEGDGEVHSTLDRM
Ga0182021_1233676613300014502FenVVEDPKWDLAILATVQGFYEKLLQELVGGEVPVPG
Ga0187818_1006136123300017823Freshwater SedimentVVEDPKWELAILATVQGFYEKLLQTSVGGEVPVPAGLEAISLQES
Ga0187806_117910623300017928Freshwater SedimentVVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPAGLEAISLQSDDN
Ga0187825_1004412133300017930Freshwater SedimentLVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPAGLEAVSLQ
Ga0187819_1025568813300017943Freshwater SedimentVVEDPKWELAILATVQGFYEKLLQEPVCGEVPVPAGLEAISLQSDDSVLET
Ga0187819_1054026923300017943Freshwater SedimentLVEDPKWELAILATVQGFYEKLLQDHVAGEVPVPAGLEVV
Ga0187785_1006838313300017947Tropical PeatlandLVDDPKWELAILATVQGFYEKLLQEPIGGEVPVPAGLEA
Ga0187862_1073719423300018040PeatlandVVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQSDDGVQQ
Ga0187772_1037213313300018085Tropical PeatlandLVEDPKWELAILATVQGFYEKLLQEPVAGEVPVPGGLEAVS
Ga0187771_1035770213300018088Tropical PeatlandMGEDSQWELAILATVQSFYEKLLQEHVEGEVPVPAGLEAISLQEADEDVRST
Ga0066655_1063394613300018431Grasslands SoilVRLIEDPKWELAILATVQGLYEKLLQEPVGADVPVPAGLDT
Ga0066667_1086412113300018433Grasslands SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLET
Ga0137408_103430723300019789Vadose Zone SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGLEAISL
Ga0193715_104958413300019878SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEIPVPDGLE
Ga0193728_119537323300019890SoilLAEDPKWELAILATVQGFYEKLLQDRVQGEVPVPHGLEAISLQDDSNVHE
Ga0193721_115942013300020018SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSL
Ga0193733_100213353300020022SoilVAEDPKWELAILATVQGFYEKLLQDSVGGEVPVPAGLEAISLQQGEGEVRATLD
Ga0210407_1037214513300020579SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAI
Ga0210399_1026023923300020581SoilVVDDPKWELAILATVQGFYEKLLQECVRGEVPVPAGLEAISLQSDDN
Ga0210399_1144739923300020581SoilVVEDPKWELAILATVQGFYEKLLQNSVGGEVPVPVGLEAISLQESGADVLQTLSQMH
Ga0210395_1104568723300020582SoilVVEDPKWELAILATVQGFYEKLLQEPVGGEVPVPAGLEAISLQSDG
Ga0210401_1023321013300020583SoilMSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQ
Ga0210401_1088059013300020583SoilVVEDPKWELAILATVQGFYEKLLQDHVGGEVPVPAGLEAISLQ
Ga0210401_1115461013300020583SoilMPRGQLLAEDPKWELAILATVQGFYEKLLQEFVEGEVPVPAGLE
Ga0210404_1025214123300021088SoilVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGL
Ga0193719_1009519723300021344SoilLAEDPKWELAILATVQGFYEKLLQESVDGEVPVPAG
Ga0210393_1031991813300021401SoilVVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISLQSDDSVLET
Ga0210397_1118178723300021403SoilLVEDPKWELAILATVQGFYEKLLQTPLEGEVPVPQGLEAISLQENDGD
Ga0210384_1001816413300021432SoilMSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGDGEVHA
Ga0182009_1011163923300021445SoilLVEDPKWELAILATVQGFCEKLLQAPVGGEIPVPLRSE
Ga0210398_1013467813300021477SoilVVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAISL
Ga0210402_1060860033300021478SoilVVEDPKWELAILATVQGFYEKLLQEAVRGEVPVPSGLE
Ga0210409_1055179613300021559SoilMSGSESVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEGD
Ga0224545_102147023300022881SoilVVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQSDDSVV
Ga0224557_116886123300023101SoilVVEDPKWELAILATVQGFYEKLLQQAVGGEVPVPAGL
Ga0207692_1019308023300025898Corn, Switchgrass And Miscanthus RhizosphereLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETVSLQGDNDVNG
Ga0207699_1084269023300025906Corn, Switchgrass And Miscanthus RhizosphereLAEDPKWELAILATVQGFCEKLLQQAVAGEVPVPVGL
Ga0207654_1139648923300025911Corn RhizosphereLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLHGEADV
Ga0207693_1134569723300025915Corn, Switchgrass And Miscanthus RhizosphereLAEDPKWELAILATVQGFYEKLLQESVEGEVPVPAGLETV
Ga0207652_1006608113300025921Corn RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAISLQEG
Ga0207646_1075405813300025922Corn, Switchgrass And Miscanthus RhizosphereLVEDPKWELAILATVQGFYEKLLQEVVGGEVPVPTALEAVSLQQSDGDVNPTLAT
Ga0207694_1008580713300025924Corn RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEVPVPAGLEAIS
Ga0207686_1119577313300025934Miscanthus RhizosphereVVEDPKWELAILATVQGFYEKLLQDSIGGEIPVPAGL
Ga0207702_1110462723300026078Corn RhizosphereLVEDPKWELAILATVQGFCEKLLQAPVGGEIPVPAQLETISLQHEGDVQG
Ga0207641_1230275923300026088Switchgrass RhizosphereLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVSLQGDSDVG
Ga0209839_1004034223300026294SoilVVEDPKWELAILATVQGFYEKLLQESIGGEVPVPAGLEAISLQEG
Ga0209238_125033023300026301Grasslands SoilLVEDPKWELAILATVQGFYEKLLQNSVGGEVPVPIGLEA
Ga0209473_103862433300026330SoilLAEDPKWELAILSTVQGFYEKLLQETVGGEVPVPSGL
Ga0257173_103785313300026360SoilVVEDSKWELAILATVQGFYEKLLQDSVGGEVPVPAGLEAISLQEG
Ga0209577_1001047373300026552SoilLVEDPKWELAILATVQGFYEKLLQEPLAGEVPVPVGLEAISLQQSDGDV
Ga0209577_1036389533300026552SoilLVEDPKWELAILATVQGFYEKLLQAPLAGEVPVPVGLEAISLQQSDGDV
Ga0209421_108788423300027432Forest SoilVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLESISLQ
Ga0209622_110584213300027502Forest SoilLVEDPKWELAILATVQGFYEKLLQEPLDGEVPVPSGLEAISLQQSDGDVHLTL
Ga0208827_106762013300027641Peatlands SoilVVEDPKWELAILATVQGFYEKLLQEPVRGEVPVPAGLEAISLQS
Ga0208565_123700323300027662Peatlands SoilLVEDPKWELAILATVQGFYEKLLQEPIAGEVPVPAGLEAVSLQS
Ga0209038_1005487123300027737Bog Forest SoilVVEDPKWELAILATVQGFYEKLLQESVRGEVPVPAGLEAIS
Ga0209180_1065625613300027846Vadose Zone SoilVVEDPKWELAILATVQGFYEKLLQDSMGGEIPVPAGL
Ga0209517_1034434213300027854Peatlands SoilVVEDPKWELAILATVQGFYEKLLQEPVGGEVPVPSGLEAISL
Ga0209590_1092779713300027882Vadose Zone SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPDPAQP
Ga0209488_1055804523300027903Vadose Zone SoilLAEDPKWELAILATVQGFYEKLLQEAVEGEVPVPAGLETVS
Ga0209069_1064755213300027915WatershedsVVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAISLQS
Ga0209168_1048199523300027986Surface SoilLVEDPKWELAILATVQGFYEKLLQVPVGGEVPVPAGLEAVSLQSENDVTET
Ga0311337_1051898213300030000FenVAEDPKWELAILASVQAFYEKLLQVPLEGEVPVPYGL
Ga0310915_1084544513300031573SoilLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLQGDSDVAEMLG
Ga0318572_1061959823300031681SoilMRLVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLE
Ga0310813_1118036413300031716SoilLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSLH
Ga0307469_1180860613300031720Hardwood Forest SoilLVEDPKWELAILATVQGFYEKLLQDSVGGEVPVPIG
Ga0318500_1055483013300031724SoilLVEDPKWELAILATVQGCYEKLLQPYAKGEVPVPAGLEDISL
Ga0307478_1161110813300031823Hardwood Forest SoilLVEDPKWELAILATVQGFYEKLLQSAVGGEVPVPAGLEAVSLQNEENVGATLA
Ga0306923_1022440023300031910SoilLAEDPKWELAILATVQGFYEKLLQDSVEGEVPVPAGLETVSL
Ga0308175_10224288213300031938SoilLVEDPKWELAILATVQGFYEKLLQSSIGGEVPVPQGLE
Ga0310912_1057543313300031941SoilMRLVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLEDISL
Ga0306922_1205844013300032001SoilLVEDPKWELAILATVQGFYEKLLQPYAKGEVPVPTGLEDISLQGE
Ga0318562_1061517523300032008SoilLVEDPKWELAILATVQGFYERLLQEPLHGEVPVPAGLEAVSLQQS
Ga0311301_1216494423300032160Peatlands SoilLVDDPKWELAILATVQGFYEKLLQDSVGGEVPVPA
Ga0307471_10150840413300032180Hardwood Forest SoilLAEDPKWELAILASVQSFEEKLLQEYVDGEVPVPQGLED
Ga0307472_10020610923300032205Hardwood Forest SoilVTTEVAEDPKWELAILATVQGFYEKLLQEYVGGEVPVPAGL
Ga0335082_1141436923300032782SoilLVEDPKWELAILATVQGFYEKLLQESVGGEVPVPAGLEAVSL
Ga0335078_1179989713300032805SoilLVDDPKWELAILATVQGFYEKLLQEPIGGEVPVPTGLEAVSLQD
Ga0335070_1093520623300032829SoilVEDPKWELAILATVQGFYEKLLQESLEGEVPVPAGLETISLQQDD
Ga0335071_1065540323300032897SoilLVDDPKWELAILATVQGFYEKLLQEPVGGEVPVPA
Ga0335072_1064666913300032898SoilLAEDPKWELAILATVQGFYEKLLQDAVEGEVPVPAGLETV
Ga0335072_1161600113300032898SoilLAEDPKWELAILATVQGFYEKLLQSPVGGEVPVPAGLEAVSLQSDNDVGET
Ga0326727_1085702713300033405Peat SoilVVEDPKWELAILATVQGFYEKLLQQAVGGEVPVPAGLE
Ga0314861_0052653_2102_22483300033977PeatlandVVEDSKWELAILATVQGFYEKLLQEHVAGEVPVPAGLEAISLQESEDGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.