NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F044853

Metatranscriptome Family F044853

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044853
Family Type Metatranscriptome
Number of Sequences 153
Average Sequence Length 162 residues
Representative Sequence RARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Number of Associated Samples 72
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.69 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 63
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(91.503 % of family members)
Environment Ontology (ENVO) Unclassified
(98.039 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.771 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 3.00%    β-sheet: 19.50%    Coil/Unstructured: 77.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009679|Ga0115105_10662913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare704Open in IMG/M
3300016798|Ga0186287_106241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare932Open in IMG/M
3300016798|Ga0186287_106384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare908Open in IMG/M
3300018502|Ga0193334_101492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare802Open in IMG/M
3300018504|Ga0193465_103781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare670Open in IMG/M
3300018524|Ga0193057_108551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare562Open in IMG/M
3300018529|Ga0193003_103278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare810Open in IMG/M
3300018536|Ga0193508_101978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare768Open in IMG/M
3300018537|Ga0193019_102676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare773Open in IMG/M
3300018575|Ga0193474_1008928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare778Open in IMG/M
3300018575|Ga0193474_1009423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare757Open in IMG/M
3300018575|Ga0193474_1009694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare745Open in IMG/M
3300018575|Ga0193474_1013372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare621Open in IMG/M
3300018596|Ga0193060_1012063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare753Open in IMG/M
3300018596|Ga0193060_1015851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare625Open in IMG/M
3300018596|Ga0193060_1015924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare623Open in IMG/M
3300018605|Ga0193339_1014149All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare758Open in IMG/M
3300018628|Ga0193355_1023219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare588Open in IMG/M
3300018692|Ga0192944_1033870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare740Open in IMG/M
3300018716|Ga0193324_1023916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare775Open in IMG/M
3300018741|Ga0193534_1045490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare673Open in IMG/M
3300018746|Ga0193468_1035533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare734Open in IMG/M
3300018755|Ga0192896_1037023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare740Open in IMG/M
3300018755|Ga0192896_1037326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare737Open in IMG/M
3300018755|Ga0192896_1040100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare710Open in IMG/M
3300018755|Ga0192896_1043133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare683Open in IMG/M
3300018761|Ga0193063_1037082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare805Open in IMG/M
3300018765|Ga0193031_1040381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare759Open in IMG/M
3300018765|Ga0193031_1043691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare735Open in IMG/M
3300018765|Ga0193031_1045489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare723Open in IMG/M
3300018765|Ga0193031_1045490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare723Open in IMG/M
3300018765|Ga0193031_1055601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare662Open in IMG/M
3300018780|Ga0193472_1021939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare699Open in IMG/M
3300018792|Ga0192956_1097703All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare736Open in IMG/M
3300018806|Ga0192898_1051627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare719Open in IMG/M
3300018806|Ga0192898_1059668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare662Open in IMG/M
3300018813|Ga0192872_1052657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare727Open in IMG/M
3300018819|Ga0193497_1055365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare738Open in IMG/M
3300018825|Ga0193048_1036943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare738Open in IMG/M
3300018825|Ga0193048_1036944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare738Open in IMG/M
3300018825|Ga0193048_1040456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare705Open in IMG/M
3300018831|Ga0192949_1065968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare720Open in IMG/M
3300018836|Ga0192870_1047824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare737Open in IMG/M
3300018836|Ga0192870_1054124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare689Open in IMG/M
3300018836|Ga0192870_1055256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare681Open in IMG/M
3300018836|Ga0192870_1056289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare674Open in IMG/M
3300018838|Ga0193302_1041816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare784Open in IMG/M
3300018852|Ga0193284_1030385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare801Open in IMG/M
3300018852|Ga0193284_1032523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare779Open in IMG/M
3300018852|Ga0193284_1035788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare749Open in IMG/M
3300018852|Ga0193284_1036239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare745Open in IMG/M
3300018852|Ga0193284_1036241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare745Open in IMG/M
3300018852|Ga0193284_1036560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare742Open in IMG/M
3300018852|Ga0193284_1037977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare730Open in IMG/M
3300018853|Ga0192958_1119976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare616Open in IMG/M
3300018855|Ga0193475_1036701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare783Open in IMG/M
3300018855|Ga0193475_1037583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare774Open in IMG/M
3300018855|Ga0193475_1038794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare762Open in IMG/M
3300018855|Ga0193475_1041847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare734Open in IMG/M
3300018855|Ga0193475_1042167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare731Open in IMG/M
3300018855|Ga0193475_1046224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare698Open in IMG/M
3300018861|Ga0193072_1062069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare735Open in IMG/M
3300018861|Ga0193072_1064413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare720Open in IMG/M
3300018861|Ga0193072_1066380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare708Open in IMG/M
3300018862|Ga0193308_1039388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare774Open in IMG/M
3300018870|Ga0193533_1071640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare753Open in IMG/M
3300018870|Ga0193533_1074115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare738Open in IMG/M
3300018870|Ga0193533_1077682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare717Open in IMG/M
3300018879|Ga0193027_1062958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare742Open in IMG/M
3300018879|Ga0193027_1065447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare727Open in IMG/M
3300018879|Ga0193027_1069130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare706Open in IMG/M
3300018885|Ga0193311_10028381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare789Open in IMG/M
3300018888|Ga0193304_1053663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare772Open in IMG/M
3300018889|Ga0192901_1075956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare736Open in IMG/M
3300018889|Ga0192901_1081909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare703Open in IMG/M
3300018889|Ga0192901_1084196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare691Open in IMG/M
3300018889|Ga0192901_1087296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare676Open in IMG/M
3300018905|Ga0193028_1060080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare758Open in IMG/M
3300018905|Ga0193028_1062323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare743Open in IMG/M
3300018905|Ga0193028_1065613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare722Open in IMG/M
3300018913|Ga0192868_10032859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare747Open in IMG/M
3300018913|Ga0192868_10034798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare732Open in IMG/M
3300018913|Ga0192868_10036423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare720Open in IMG/M
3300018913|Ga0192868_10044371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare671Open in IMG/M
3300018947|Ga0193066_10132859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare727Open in IMG/M
3300018961|Ga0193531_10214423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare715Open in IMG/M
3300018968|Ga0192894_10186174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare682Open in IMG/M
3300018974|Ga0192873_10337938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare628Open in IMG/M
3300018977|Ga0193353_10110510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare829Open in IMG/M
3300018977|Ga0193353_10151169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare694Open in IMG/M
3300018979|Ga0193540_10113220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare756Open in IMG/M
3300018979|Ga0193540_10159287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare631Open in IMG/M
3300018982|Ga0192947_10148064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare783Open in IMG/M
3300018982|Ga0192947_10152297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare771Open in IMG/M
3300018982|Ga0192947_10174189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare714Open in IMG/M
3300018982|Ga0192947_10187116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare684Open in IMG/M
3300018989|Ga0193030_10131384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare798Open in IMG/M
3300018989|Ga0193030_10137600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare782Open in IMG/M
3300018989|Ga0193030_10140927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare774Open in IMG/M
3300018989|Ga0193030_10146091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare762Open in IMG/M
3300018989|Ga0193030_10146092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare762Open in IMG/M
3300019000|Ga0192953_10113325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare663Open in IMG/M
3300019001|Ga0193034_10075852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare737Open in IMG/M
3300019003|Ga0193033_10143891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare689Open in IMG/M
3300019003|Ga0193033_10150904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare669Open in IMG/M
3300019010|Ga0193044_10149890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare761Open in IMG/M
3300019010|Ga0193044_10149893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare761Open in IMG/M
3300019010|Ga0193044_10153144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare751Open in IMG/M
3300019010|Ga0193044_10162228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare725Open in IMG/M
3300019017|Ga0193569_10265986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare727Open in IMG/M
3300019017|Ga0193569_10281776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare697Open in IMG/M
3300019020|Ga0193538_10204066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare669Open in IMG/M
3300019022|Ga0192951_10191380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare745Open in IMG/M
3300019022|Ga0192951_10349620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare560Open in IMG/M
3300019024|Ga0193535_10149714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare757Open in IMG/M
3300019024|Ga0193535_10154913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare742Open in IMG/M
3300019024|Ga0193535_10169012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare705Open in IMG/M
3300019027|Ga0192909_10093828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare760Open in IMG/M
3300019027|Ga0192909_10099430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare747Open in IMG/M
3300019027|Ga0192909_10117000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare711Open in IMG/M
3300019032|Ga0192869_10244183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare775Open in IMG/M
3300019032|Ga0192869_10244186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare775Open in IMG/M
3300019032|Ga0192869_10254520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare760Open in IMG/M
3300019032|Ga0192869_10260818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare751Open in IMG/M
3300019036|Ga0192945_10139839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare777Open in IMG/M
3300019036|Ga0192945_10151483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare746Open in IMG/M
3300019036|Ga0192945_10174285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare693Open in IMG/M
3300019037|Ga0192886_10125293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare778Open in IMG/M
3300019037|Ga0192886_10126543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare775Open in IMG/M
3300019037|Ga0192886_10131183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare764Open in IMG/M
3300019037|Ga0192886_10147728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare728Open in IMG/M
3300019037|Ga0192886_10225685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare607Open in IMG/M
3300019045|Ga0193336_10171062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare837Open in IMG/M
3300019100|Ga0193045_1041490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare761Open in IMG/M
3300019100|Ga0193045_1042366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare751Open in IMG/M
3300019100|Ga0193045_1046392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare710Open in IMG/M
3300019103|Ga0192946_1035256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare753Open in IMG/M
3300019103|Ga0192946_1044307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare665Open in IMG/M
3300019111|Ga0193541_1062637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare656Open in IMG/M
3300019111|Ga0193541_1082768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare557Open in IMG/M
3300019125|Ga0193104_1043492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare629Open in IMG/M
3300019151|Ga0192888_10158738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare717Open in IMG/M
3300021877|Ga0063123_1025390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare602Open in IMG/M
3300021892|Ga0063137_1013128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare667Open in IMG/M
3300021892|Ga0063137_1029597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare511Open in IMG/M
3300031710|Ga0307386_10376989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare726Open in IMG/M
3300031725|Ga0307381_10260744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare617Open in IMG/M
3300031725|Ga0307381_10346610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare541Open in IMG/M
3300031725|Ga0307381_10409376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare501Open in IMG/M
3300031739|Ga0307383_10440775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare644Open in IMG/M
3300031739|Ga0307383_10620631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare546Open in IMG/M
3300031739|Ga0307383_10627868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare543Open in IMG/M
3300031743|Ga0307382_10313125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare707Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine91.50%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.19%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.31%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016798Metatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 168 ?mol photons light - Prasinoderma singularis RCC 927 (MMETSP1315)Host-AssociatedOpen in IMG/M
3300018502Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001750 (ERX1782144-ERR1711886)EnvironmentalOpen in IMG/M
3300018504Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002418 (ERX1782261-ERR1712132)EnvironmentalOpen in IMG/M
3300018524Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002422 (ERX1782099-ERR1711883)EnvironmentalOpen in IMG/M
3300018529Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001748 (ERX1782284-ERR1712201)EnvironmentalOpen in IMG/M
3300018536Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003037 (ERX1789626-ERR1719185)EnvironmentalOpen in IMG/M
3300018537Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003035 (ERX1789644-ERR1719455)EnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018755Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000720 (ERX1789582-ERR1719407)EnvironmentalOpen in IMG/M
3300018761Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300021877Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0115105_1066291313300009679MarineARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQE*
Ga0186287_10624113300016798Host-AssociatedMRSVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPSSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0186287_10638413300016798Host-AssociatedMRSVTSSALALALALAVGGASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQGEKPKCGPTGMDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0193334_10149213300018502MarineMGTPQRARIPILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193465_10378113300018504MarineALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGQKPKCGTHSGQVDPNTLDTQNIVDCQQQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193057_10855113300018524MarineKDKDINIVVANTYNSQEEKPKCGTHNGPVDPNTLDTQNIVDCQQQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKKKYPCVDPMTCSKHCLHHGCKQE
Ga0193003_10327813300018529MarineMGTPQRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193508_10197813300018536MarineRIPILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193019_10267613300018537MarineRARIPILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193474_100892813300018575MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPSSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0193474_100942313300018575MarineMGTPQCTRIPILHSIKMRSVAFAALALALALAVGGASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQDQKPKCGPTGTDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCNVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193474_100969413300018575MarineMGTPQCTRIPILHSIKMRSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDINIVVANTYNSQEEKPKCGTHNGPVDPNTLDTQNIVDCQLQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193474_101337213300018575MarineGGGGGFWEECPHKDKDIDIVVANTYNSQGQKPKCGTHSGQVDPNTLDTQNIVDCQQQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193060_101206313300018596MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPNSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0193060_101585113300018596MarineASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQGEKPKCGPTGMDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193060_101592413300018596MarineVGGASADGHLGMPGGFEECPHKDKDINIVVANTYNSQEEKPKCGTHNGPVDPNTLDTQNIVDCQLQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193339_101414913300018605MarineMGTPQRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193355_102321913300018628MarinePGGFEECPHKDKDINIVVANTYNSQEEKPKCGTHNGPVDPNTLDTQNIVDCQLQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKKKYPCVDPMTCSKHCLHHGCKQ
Ga0192944_103387013300018692MarineHGDTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193324_102391613300018716MarineRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193534_104549013300018741MarineALALALAVGGASAQEMEGMPGGWSESPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193468_103553313300018746MarineTRILILLSIKMRSVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPNSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0192896_103702313300018755MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHPHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0192896_103732613300018755MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNSFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192896_104010013300018755MarineRARILILHSIKMPSVAFAALALALALAVGGASAQLEGGGGGFWEECPHPHSDNDIDIVVANTYNSQEQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192896_104313313300018755MarineFAALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0193063_103708213300018761MarineRRTPQRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193031_104038113300018765MarineMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193031_104369113300018765MarineMGTPQRARILILHSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193031_104548913300018765MarineMGTPQRARILTLHSIKMRSVTFAALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193031_104549013300018765MarineMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193031_105560113300018765MarineALALAVGGASAQIMMEDGGWEECPTPYILGTDYEDIGNIVALTYDSQGEKPKCGPTGPDGAVDANVLDTQNIIECHQKLEAGTQYNFVLNAMDGVLYCDVFWPLPTAPTGPEYTCSLHPHAKNKYPCVDPDTCSKHCLHHGCKQA
Ga0193472_102193913300018780MarineRILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCNVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0192956_109770313300018792MarineMGHTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192898_105162713300018806MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNNFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192898_105966813300018806MarineRARILILHSIKMPSVAFAALALALALAVGGASADGHLEGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTPLTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192872_105265713300018813MarineMGQRTRILILLSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193497_105536513300018819MarineILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193048_103694313300018825MarineARILILHSIKMPSVAFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193048_103694413300018825MarineARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGFEECPTPYKLGTEYEDIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193048_104045613300018825MarineARILILHSIKMPSVAFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192949_106596813300018831MarineILILHSIKMPSVAFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192870_104782413300018836MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNSFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192870_105412413300018836MarineAFAALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192870_105525613300018836MarineRARILILHSIKMPSVAFAALALALALAVGGASADGHLEGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTPLTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192870_105628913300018836MarineAFAALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193302_104181613300018838MarineARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193284_103038513300018852MarineMGTPQRARILILHSIKMRSVTFSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193284_103252313300018852MarineYMGTPQCTRIPILHSIKMRSVAFAALALALALAVGGASAQLEGMPGSFEECPHPHSNNDIQIVAANTYNSQGEKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193284_103578813300018852MarineYMGTPQCTRIPILHSIKMRSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTPLTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193284_103623913300018852MarineFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193284_103624113300018852MarineFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHQKLEAGTEYNFVLNSNDGVLFCHVFWPFIGSEKSPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193284_103656013300018852MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNNFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193284_103797713300018852MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAIPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQA
Ga0192958_111997613300018853MarineGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPPAGDGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193475_103670113300018855MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQIMMEDGGWEECPTPYILGTDYEDIGNIVALTYDSQGEKPKCGPTGPDGAVDANVLDTQNIIECHQKLEAGTQYNFVLNAMDGVLYCDVFWPLPTAPTGPEYTCSLHPHAKNKYPCVDPDTCSKHCLHHGCKQA
Ga0193475_103758313300018855MarineMGTPQRARILILHSIKMPSVAFAALALALALAVGGASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQDQKPKCGPTGTDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCNVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193475_103879413300018855MarineMGTPQRARILILHSIKMPSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDINIVVANTYNSQEEKPKCGTHNGPVDPNTLDTQNIVDCQLQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193475_104184713300018855MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCNVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193475_104216713300018855MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPDGAVDPNSFDTQNIIECHQQVTNGMHYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
Ga0193475_104622413300018855MarineFAALALALALAVGGASAQLEGGGGGFWEECPHKDKDIDIVVANTYNSQGQKPKCGTHSGQVDPNTLDTQNIVDCQQQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193072_106206913300018861MarineRARILILHSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193072_106441313300018861MarineRARILILHSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193072_106638013300018861MarineRARILILHSIKMPSVAFAALALALALAVGGASAQLEGGGGGFWEECPHKDKDIDIVVANTYNSQGQKPKCGTHNGAVDPNTLDTQNIVDCQLQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKKKYPCVDPMTCSKHCLHHGCKQA
Ga0193308_103938813300018862MarineARILILHSTKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193533_107164013300018870MarineTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193533_107411513300018870MarineTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193533_107768213300018870MarineTPQRARILILHSIKMPSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193027_106295813300018879MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193027_106544713300018879MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193027_106913013300018879MarineRARILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFWEECPHKDKDIDIVVANTYNSQGQKPKCGTHNGAVDPNTLDTQNIVDCQLQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKKKYPCVDPMTCSKHCLHHGCKQE
Ga0193311_1002838113300018885MarineARIPILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193304_105366313300018888MarineARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0192901_107595613300018889MarineRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNSFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192901_108190913300018889MarineRARILILHSIKMPSVAFAALALALALAVGGASAQLEGGGGGFCEECPHKDKDIDIVVANTYNSAGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192901_108419613300018889MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192901_108729623300018889MarineFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193028_106008013300018905MarineATPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193028_106232313300018905MarineATPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193028_106561313300018905MarineATPQRARILILHSIKMPSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0192868_1003285913300018913MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192868_1003479813300018913MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0192868_1003642313300018913MarineMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTHNGPVNPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192868_1004437113300018913MarineLALALALAVGGASAQVEDGWEECPTPYKLGTEYEDIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSDDLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193066_1013285913300018947MarineLALALAVGGASAQVMEGMPGGYEECPTPYKLGSEYNDIGNIVAKTYDSQGQKPKCEAPGTNNGPDGAVDPNFLDTQNIVECHVKVEKGKEYNFVLNAQDGVLFCDVFWPLVSSNDLPKYHCSLHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193531_1021442313300018961MarineARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192894_1018617413300018968MarineHGTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNNFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192873_1033793813300018974MarineVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193353_1011051013300018977MarineWGTPQRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193353_1015116913300018977MarineASAQLEGGGGGFWEECPHPHSDNDIDIVVANTYNSQEQKPKCGTHDGPVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHPHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0193540_1011322013300018979MarineMGTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193540_1015928713300018979MarineALAVGGASAQLEGGGGGFWEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVDCQLQKVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0192947_1014806413300018982MarineQRRVHGDTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192947_1015229713300018982MarineQRRVHGDTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEVGDWEECPTPYKLGTEYGDIGLIVANTYDEYGQKPKCGPTGPDGAVDPNFLDTQNIVECHQKLEAGTKYNFVLNAMDGVLYCDVFWPLIGSDLSPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192947_1017418913300018982MarineFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPPAGDGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192947_1018711613300018982MarineFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193030_1013138423300018989MarineYMGTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193030_1013760013300018989MarineMGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQIMMEDGGWEECPTPYILGTDYEDIGNIVALTYDSQGEKPKCGPTGPDGAVDANVLDTQNIIECHQKLEAGTQYNFVLNAMDGVLYCDVFWPLPTAPTGPEYTCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193030_1014092723300018989MarineYMGTPQRARILILHSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193030_1014609113300018989MarineYMGTPQRARILILHSIKMRSVTFAALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193030_1014609213300018989MarineYMGTPQRARILILHSIKMPSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0192953_1011332513300019000MarineAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNFFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPLPTAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193034_1007585213300019001MarineHGTPQRTRILILLSIKMRSVTSSALALALALAVGGASAQIMMEDGGWEECPTPYILGTDYEDIGNIVALTYDSQGEKPKCGPTGPDGAVDANVLDTQNIIECHQKLEAGTQYNFVLNAMDGVLYCDVFWPLPTAPTGPEYTCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQA
Ga0193033_1014389113300019003MarineARILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193033_1015090413300019003MarineVTSSALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193044_1014989013300019010MarineHGDTPQRARILILHSIKMPSVAFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193044_1014989313300019010MarineHGDTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGFEECPTPYKLGTEYEDIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193044_1015314413300019010MarineTWGHTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193044_1016222813300019010MarineHGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193569_1026598613300019017MarineRILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193569_1028177613300019017MarineRARILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193538_1020406613300019020MarineILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGQKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPTEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0192951_1019138013300019022MarineHGDTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192951_1034962013300019022MarineMGNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193535_1014971413300019024MarineRRTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193535_1015491313300019024MarineRRTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193535_1016901213300019024MarineRARILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFWEECPHKDKDIDIVVANTYNSQGQKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192909_1009382813300019027MarineTWGQRTRILILHSIKMRSVTFSALALALALAVGGASAQIMMEDGGWEECPTPYKLGTDYEDIGNIVALTYDSQGQKPKCGPTGPDGAVDANVLDTQNIVECHVHVTEGKNYNFELNAQDGVLFCNVHWPPAGDGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192909_1009943013300019027MarineMGTPQRARILILHSIKMPSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192909_1011700013300019027MarineLALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192869_1024418313300019032MarineMGTPQRARILILHSIKMRSVTFSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCMAPGTNNGPDGAVDPNSFDTQNIIECHVQDAEGLNYNFVLNAMDGVLFCNVVWPLPNAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192869_1024418613300019032MarineMGTPQRARILILHSIKMRSVTFSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192869_1025452013300019032MarineMGTPQRARILILHSIKMRSVTFSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0192869_1026081813300019032MarineMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASADGHLEGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0192945_1013983913300019036MarineTWGHTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192945_1015148313300019036MarineMGTPQRARILILHSIKMRSFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192945_1017428513300019036MarineALALALALAVGGASAQMEVGDWEECPTPYKLGTEYGDIGLIVANTYDEYGQKPKCGPTGPDGAVDPNFLDTQNIVECHQKLEAGTKYNFVLNAMDGVLYCDVFWPLIGSDLSPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192886_1012529313300019037MarineYMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHPHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0192886_1012654313300019037MarineYMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNSFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCVQA
Ga0192886_1013118313300019037MarineYMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCNVFWPLPSSDDLPEYNCNLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192886_1014772813300019037MarineYMGTPQRTRIPILHSIKMRSVAFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSVGEKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYDCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0192886_1022568513300019037MarineWSECPTPYEMGFGGDKIGYIIANTYDQAEQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHKHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0193336_1017106223300019045MarineHGTPQRARILILHSIKMRSVAFAALALALALAVGGASAQVMEGMPGGYEECPTPYKLGTEYNDIGYIIANTYDHAEQMPKCEAPGTNNGPDGAVDANSFDTQNIIECHQQVVAGMNYNFVLNAQDGVLFCDVFWPLASSDDLPKYDCALHKHAKNKYPCVPKGTCSKHCLHHGCKQA
Ga0193045_104149013300019100MarineMGTPQRARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGFEECPTPYKLGTEYEDIGYIIANTYDYAEQSPKCEAPGTDDGPPGAVDANSFDTQNIIECHQQIVAGTNYNFVLNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193045_104236613300019100MarineHGDTTTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193045_104639213300019100MarineMGTPQRARILILHSIKMRSFAALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVEPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192946_103525613300019103MarineMGTPQRARILILHSIKMRSFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0192946_104430713300019103MarineLALALALAVGGASAQMEVGDWEECPTPYKLGTEYGDIGLIVANTYDEYGQKPKCGPTGPDGAVDPNFLDTQNIVECHQKLEAGTKYNFVLNAMDGVLYCDVFWPLIGSDLSPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193541_106263713300019111MarineAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDSAGQSPKCQAPGTFNGPDGAVDPNSFDTQNIIECHVQETEGKNYNFVLNAMDGVLFCNVVWPLPDAPTGPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0193541_108276813300019111MarineHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0193104_104349213300019125MarineGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQ
Ga0192888_1015873813300019151MarineARILILHSIKMPSVAFAALALALALAVGGASAQEMEGMPGGWSECPTPYEMGFGGDKIGYIIANTYDYAEQSPKCEAPGTDNGPKGAVNPNSFDTQNIIECHQQVTNGMHYNFELNAMDGVLFCDVQWPPAGGGLPEYKCSLHPHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0063123_102539013300021877MarineFAALALALALAVGGASADGHLGMPGGFEECPHKDKDIDIVVANTYNSAGQKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMDGVLFCDVFEPLPSSNESPEYXCXLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0063137_101312813300021892MarineRILILHSIKMRSVTFSALALALALAVGGASAQLEGGGGGFYEECPHKDKDIDIVVANTYNSQGEKPKCGTHNGAVDPNTLDTQNIVECHQQIVAGTNYNLVLNAMNGVLFCDVFEPLPSSNESPEYKCSLHKHAKNKYPCVGPGTCSKHCLHHGCKQE
Ga0063137_102959713300021892MarineRILILHSIKMRSVTSSALALALALAVGGASAQVEVGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAVPGQNGPDGAVDPNSFDTQNIVACHVQVTEGLNYNFQLNAKDGVLFCDVHWSESPEYDCSLHEHAKNKWPCVDPGTCSKHCLHHGCKQE
Ga0307386_1037698913300031710MarineRARILILHSIKMPSVAFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0307381_1026074413300031725MarineALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0307381_1034661013300031725MarineHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0307381_1040937613300031725MarineFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPPAGDGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0307383_1044077513300031739MarineRARILILHSIKMRSFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA
Ga0307383_1062063113300031739MarineARILILHSIKMPSVAFAALALALALAVGGASAQVMEGMPGGFEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIVECHVQVTEGLNYNFELNAKDGVLFCDVHWPPAGDGLPEYDCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0307383_1062786813300031739MarineTHTHTHLLSIKMRSVTSSALALALALAVGGASAQMEDGGWEECPTPYEMGFGGDKIGYIIANTYDQAGQSPKCEAPGTNNGPDGAVDPNSFDTQNIIKCHVQVTEGKNYNFELNAKDGVLFCDVHWPLPTAPTGPEYKCSLHKHAKNKYPCVDPGTCSKHCLHHGCKQE
Ga0307382_1031312513300031743MarineARILILHSIKMRSFAALALALALAVGGASAQLEGMPGGFEECPHPHSDNDIDIVVANTYNSQGQKPKCGTHNGPVDPNTLDTQNIVECHQQIVAGTNYNLELNAMDGVLFCDVFWPLPSSNESPEYKCSLHKHAKNKYPCVDPMTCSKHCLHHGCKQA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.