Metagenome / Metatranscriptome Family F044941

Basic Information
Family ID	F044941
Family Type	Metagenome / Metatranscriptome
Number of Sequences	153
Average Sequence Length	43 residues
Representative Sequence	MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSR
Number of Associated Samples	83
Number of Associated Scaffolds	152

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.99 %
% of genes near scaffold ends (potentially truncated)	94.77 %
% of genes from short scaffolds (< 2000 bps)	98.69 %
Associated GOLD sequencing projects	79
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.20

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (57.516 % of family members)
Environment Ontology (ENVO)	Unclassified (79.085 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (76.471 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 7.04% β-sheet: 0.00% Coil/Unstructured: 92.96%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300002126\|JGI24035J26624_1041268	Not Available	516	Open in IMG/M
3300005335\|Ga0070666_10899176	Not Available	654	Open in IMG/M
3300005335\|Ga0070666_10980373	Not Available	626	Open in IMG/M
3300005353\|Ga0070669_100658331	Not Available	881	Open in IMG/M
3300005355\|Ga0070671_100749876	Not Available	848	Open in IMG/M
3300005355\|Ga0070671_101644686	Not Available	569	Open in IMG/M
3300005355\|Ga0070671_101987378	Not Available	517	Open in IMG/M
3300005544\|Ga0070686_101628843	Not Available	546	Open in IMG/M
3300005618\|Ga0068864_101783780	Not Available	620	Open in IMG/M
3300005841\|Ga0068863_100707576	Not Available	1001	Open in IMG/M
3300005841\|Ga0068863_101500861	Not Available	682	Open in IMG/M
3300005843\|Ga0068860_100439584	Not Available	1295	Open in IMG/M
3300005843\|Ga0068860_100463233	Not Available	1261	Open in IMG/M
3300005843\|Ga0068860_101126096	Not Available	804	Open in IMG/M
3300005843\|Ga0068860_101809299	Not Available	632	Open in IMG/M
3300005843\|Ga0068860_102666318	Not Available	518	Open in IMG/M
3300006931\|Ga0097620_102159828	Not Available	614	Open in IMG/M
3300009994\|Ga0105126_1009997	Not Available	891	Open in IMG/M
3300010371\|Ga0134125_12864109	Not Available	524	Open in IMG/M
3300010373\|Ga0134128_13193694	Not Available	503	Open in IMG/M
3300010397\|Ga0134124_12188367	Not Available	592	Open in IMG/M
3300010399\|Ga0134127_11514051	Not Available	744	Open in IMG/M
3300010399\|Ga0134127_13376878	Not Available	522	Open in IMG/M
3300010400\|Ga0134122_10875640	Not Available	866	Open in IMG/M
3300010401\|Ga0134121_12414269	Not Available	566	Open in IMG/M
3300010403\|Ga0134123_12110638	Not Available	624	Open in IMG/M
3300014968\|Ga0157379_12188882	Not Available	549	Open in IMG/M
3300014968\|Ga0157379_12529021	Not Available	514	Open in IMG/M
3300015270\|Ga0182183_1070607	Not Available	555	Open in IMG/M
3300015270\|Ga0182183_1090044	Not Available	512	Open in IMG/M
3300015280\|Ga0182100_1089064	Not Available	524	Open in IMG/M
3300015280\|Ga0182100_1099335	Not Available	500	Open in IMG/M
3300015284\|Ga0182101_1048384	Not Available	645	Open in IMG/M
3300015284\|Ga0182101_1050144	Not Available	638	Open in IMG/M
3300015284\|Ga0182101_1098630	Not Available	505	Open in IMG/M
3300015293\|Ga0182103_1098719	Not Available	511	Open in IMG/M
3300015293\|Ga0182103_1102292	Not Available	504	Open in IMG/M
3300015306\|Ga0182180_1057214	Not Available	603	Open in IMG/M
3300015306\|Ga0182180_1085130	Not Available	523	Open in IMG/M
3300015310\|Ga0182162_1033286	Not Available	812	Open in IMG/M
3300015311\|Ga0182182_1033551	Not Available	785	Open in IMG/M
3300015311\|Ga0182182_1035800	Not Available	769	Open in IMG/M
3300015313\|Ga0182164_1133373	Not Available	508	Open in IMG/M
3300015315\|Ga0182120_1135875	Not Available	507	Open in IMG/M
3300015319\|Ga0182130_1064054	Not Available	664	Open in IMG/M
3300015319\|Ga0182130_1133859	Not Available	507	Open in IMG/M
3300015320\|Ga0182165_1061485	Not Available	705	Open in IMG/M
3300015320\|Ga0182165_1116211	Not Available	554	Open in IMG/M
3300015320\|Ga0182165_1121853	Not Available	543	Open in IMG/M
3300015324\|Ga0182134_1147581	Not Available	503	Open in IMG/M
3300015325\|Ga0182148_1089009	Not Available	609	Open in IMG/M
3300015325\|Ga0182148_1105864	Not Available	570	Open in IMG/M
3300015329\|Ga0182135_1085463	Not Available	636	Open in IMG/M
3300015329\|Ga0182135_1148407	Not Available	512	Open in IMG/M
3300015329\|Ga0182135_1148959	Not Available	511	Open in IMG/M
3300015330\|Ga0182152_1073454	Not Available	674	Open in IMG/M
3300015330\|Ga0182152_1100318	Not Available	599	Open in IMG/M
3300015330\|Ga0182152_1152091	Not Available	506	Open in IMG/M
3300015331\|Ga0182131_1095180	Not Available	614	Open in IMG/M
3300015331\|Ga0182131_1104968	Not Available	591	Open in IMG/M
3300015331\|Ga0182131_1105389	Not Available	590	Open in IMG/M
3300015331\|Ga0182131_1152339	Not Available	508	Open in IMG/M
3300015331\|Ga0182131_1157519	Not Available	500	Open in IMG/M
3300015332\|Ga0182117_1053375	Not Available	804	Open in IMG/M
3300015332\|Ga0182117_1087753	Not Available	665	Open in IMG/M
3300015332\|Ga0182117_1158809	Not Available	518	Open in IMG/M
3300015333\|Ga0182147_1107244	Not Available	608	Open in IMG/M
3300015334\|Ga0182132_1151146	Not Available	528	Open in IMG/M
3300015336\|Ga0182150_1156959	Not Available	515	Open in IMG/M
3300015336\|Ga0182150_1158090	Not Available	513	Open in IMG/M
3300015336\|Ga0182150_1158090	Not Available	513	Open in IMG/M
3300015338\|Ga0182137_1164719	Not Available	521	Open in IMG/M
3300015339\|Ga0182149_1106534	Not Available	618	Open in IMG/M
3300015348\|Ga0182115_1285321	Not Available	522	Open in IMG/M
3300015348\|Ga0182115_1288538	Not Available	519	Open in IMG/M
3300015349\|Ga0182185_1185680	Not Available	627	Open in IMG/M
3300015349\|Ga0182185_1217530	Not Available	579	Open in IMG/M
3300015350\|Ga0182163_1137845	Not Available	755	Open in IMG/M
3300015350\|Ga0182163_1213116	Not Available	605	Open in IMG/M
3300015350\|Ga0182163_1238707	Not Available	570	Open in IMG/M
3300015352\|Ga0182169_1157723	Not Available	741	Open in IMG/M
3300015352\|Ga0182169_1214997	Not Available	627	Open in IMG/M
3300015352\|Ga0182169_1232120	Not Available	601	Open in IMG/M
3300015353\|Ga0182179_1158064	Not Available	709	Open in IMG/M
3300015353\|Ga0182179_1178615	Not Available	670	Open in IMG/M
3300015353\|Ga0182179_1227861	Not Available	598	Open in IMG/M
3300015353\|Ga0182179_1269338	Not Available	551	Open in IMG/M
3300015353\|Ga0182179_1271318	Not Available	549	Open in IMG/M
3300015354\|Ga0182167_1345115	Not Available	521	Open in IMG/M
3300017414\|Ga0182195_1039441	Not Available	960	Open in IMG/M
3300017414\|Ga0182195_1055814	Not Available	854	Open in IMG/M
3300017414\|Ga0182195_1217761	Not Available	506	Open in IMG/M
3300017421\|Ga0182213_1221431	Not Available	541	Open in IMG/M
3300017422\|Ga0182201_1132505	Not Available	519	Open in IMG/M
3300017432\|Ga0182196_1010549	Not Available	1227	Open in IMG/M
3300017435\|Ga0182194_1122935	Not Available	548	Open in IMG/M
3300017439\|Ga0182200_1038320	Not Available	826	Open in IMG/M
3300017439\|Ga0182200_1149333	Not Available	520	Open in IMG/M
3300017445\|Ga0182198_1122314	Not Available	613	Open in IMG/M
3300017446\|Ga0182217_1128288	Not Available	596	Open in IMG/M
3300017691\|Ga0182212_1067972	Not Available	788	Open in IMG/M
3300017693\|Ga0182216_1122368	Not Available	641	Open in IMG/M
3300017693\|Ga0182216_1184689	Not Available	544	Open in IMG/M
3300017693\|Ga0182216_1200856	Not Available	525	Open in IMG/M
3300017694\|Ga0182211_1123613	Not Available	611	Open in IMG/M
3300017694\|Ga0182211_1153974	Not Available	547	Open in IMG/M
3300017694\|Ga0182211_1156867	Not Available	542	Open in IMG/M
3300017694\|Ga0182211_1174743	Not Available	513	Open in IMG/M
3300020023\|Ga0182178_1013208	Not Available	608	Open in IMG/M
3300020023\|Ga0182178_1017245	Not Available	555	Open in IMG/M
3300020023\|Ga0182178_1018404	Not Available	543	Open in IMG/M
3300020023\|Ga0182178_1019426	Not Available	533	Open in IMG/M
3300020223\|Ga0182118_103787	Not Available	753	Open in IMG/M
3300025931\|Ga0207644_10648994	Not Available	878	Open in IMG/M
3300025931\|Ga0207644_11866528	Not Available	502	Open in IMG/M
3300026088\|Ga0207641_11451958	Not Available	687	Open in IMG/M
3300026095\|Ga0207676_12515551	Not Available	511	Open in IMG/M
3300028051\|Ga0268344_1014513	Not Available	604	Open in IMG/M
3300028055\|Ga0268338_1020761	Not Available	642	Open in IMG/M
3300028056\|Ga0268330_1022250	Not Available	723	Open in IMG/M
3300028056\|Ga0268330_1027067	Not Available	677	Open in IMG/M
3300028056\|Ga0268330_1045532	Not Available	565	Open in IMG/M
3300028056\|Ga0268330_1045534	Not Available	565	Open in IMG/M
3300028058\|Ga0268332_1035895	Not Available	671	Open in IMG/M
3300028058\|Ga0268332_1068172	Not Available	532	Open in IMG/M
3300028061\|Ga0268314_1021368	Not Available	698	Open in IMG/M
3300028061\|Ga0268314_1021636	Not Available	695	Open in IMG/M
3300028062\|Ga0268342_1041036	Not Available	519	Open in IMG/M
3300028062\|Ga0268342_1041628	Not Available	516	Open in IMG/M
3300028064\|Ga0268340_1034255	Not Available	702	Open in IMG/M
3300028064\|Ga0268340_1086457	Not Available	502	Open in IMG/M
3300028142\|Ga0268347_1019708	Not Available	601	Open in IMG/M
3300028142\|Ga0268347_1027767	Not Available	541	Open in IMG/M
3300028142\|Ga0268347_1032641	Not Available	513	Open in IMG/M
3300028143\|Ga0268348_1006798	Not Available	761	Open in IMG/M
3300028147\|Ga0268303_104577	Not Available	588	Open in IMG/M
3300028151\|Ga0268308_1009979	Not Available	743	Open in IMG/M
3300028151\|Ga0268308_1022351	Not Available	576	Open in IMG/M
3300028151\|Ga0268308_1029502	Not Available	526	Open in IMG/M
3300028152\|Ga0268336_1020908	Not Available	570	Open in IMG/M
3300028153\|Ga0268320_1010409	Not Available	689	Open in IMG/M
3300028153\|Ga0268320_1017291	Not Available	596	Open in IMG/M
3300028262\|Ga0268310_1028623	Not Available	617	Open in IMG/M
3300028262\|Ga0268310_1039716	Not Available	553	Open in IMG/M
3300028381\|Ga0268264_12504413	Not Available	521	Open in IMG/M
3300028470\|Ga0268307_1002051	Not Available	1024	Open in IMG/M
3300028471\|Ga0268323_1014210	Not Available	575	Open in IMG/M
3300028473\|Ga0268319_1023185	Not Available	511	Open in IMG/M
3300030772\|Ga0061013_10029445	Not Available	530	Open in IMG/M
3300032591\|Ga0214484_1046146	Not Available	919	Open in IMG/M
3300033535\|Ga0314759_1150959	Not Available	739	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	94.12%
Environmental	Environmental	5.88%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.46%
Terrestrial	Environmental → Terrestrial	5.88%
Mammals	Host-Associated → Mammals	0.65%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	77.12%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.19%
Soil	Environmental → Terrestrial → Soil	5.88%
Digestive System	Host-Associated → Mammals → Digestive System	0.65%
Unclassified	Host-Associated → Plants → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	77.12%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.50%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.88%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	5.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.31%
Loam	Environmental → Terrestrial → Soil → Loam	0.65%
Foregut	Host-Associated → Mammals → Digestive System → Foregut	0.65%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	77.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.88%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	5.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.65%
Unclassified	Host-Associated → Mammals → Digestive System → Foregut → Unclassified	0.65%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	57.52%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	19.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.88%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	5.23%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.31%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.65%
Fungi-Associated Bovine Rumen	Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen	0.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.65%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300030772	Coassembly of Cow X Switchgrass	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24035J26624_10412681	3300002126	Corn, Switchgrass And Miscanthus Rhizosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCIL
Ga0070666_108991761	3300005335	Switchgrass Rhizosphere	LATNVVFPRISSIFDPQAIFSVELLPGEGQAHHKMDCALTPAFIGSR*
Ga0070666_109803731	3300005335	Switchgrass Rhizosphere	VVFPGISSIFDPQAIFSVELFPGGGQAHHKMDCILTPAFIGSRCGIRGDR*
Ga0070666_112861201	3300005335	Switchgrass Rhizosphere	LKNKQLATNVVFPRISSIFDPQAIFSVEFLPDGGQADHKMDCILNRHLFVVDVE*
Ga0070669_1006583311	3300005353	Switchgrass Rhizosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGVDEE*
Ga0070671_1007498762	3300005355	Switchgrass Rhizosphere	MVFPWISSIFDPLAIFSVELLPGGGQAHHKMDCTLTPEFIGSR*
Ga0070671_1016446862	3300005355	Switchgrass Rhizosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGVDAE*
Ga0070671_1019873781	3300005355	Switchgrass Rhizosphere	VVFPRISSIIDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSRCRIR
Ga0070686_1016288431	3300005544	Switchgrass Rhizosphere	TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDYALTPAFIHSK*
Ga0068864_1017837801	3300005618	Switchgrass Rhizosphere	MVFPRISSIFDPQTIFSVELLPGGGQAHHKMDCILTP
Ga0068863_1007075762	3300005841	Switchgrass Rhizosphere	VVFPRISLIFDPQVIFSVELLPGGGQAHHKMDCALTPAFMGS*
Ga0068863_1015008611	3300005841	Switchgrass Rhizosphere	VVFPRISSIFDPQAIFKVKLIPGGGQAHHKMDCILTPAFIGSRCIISGA
Ga0068860_1004395841	3300005843	Switchgrass Rhizosphere	MNVVFPRISSIFDPQAIFSVELLPGGDQAHHKIDCALTPAFMDS*
Ga0068860_1004632333	3300005843	Switchgrass Rhizosphere	MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR*RIGGARQ
Ga0068860_1011260962	3300005843	Switchgrass Rhizosphere	MNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCT
Ga0068860_1018092992	3300005843	Switchgrass Rhizosphere	VVFLRISSIFDPQAIFSVELLLGGGQAHHKMDCILTPAF
Ga0068860_1026663182	3300005843	Switchgrass Rhizosphere	MVFTRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGS
Ga0097620_1021598282	3300006931	Switchgrass Rhizosphere	NVVFPRISSIFDPQAIFNVELLPGGGQAHHKKDCTLTPAFIGSR*
Ga0105126_10099971	3300009994	Switchgrass Associated	TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR*
Ga0134125_128641091	3300010371	Terrestrial Soil	MNMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTLTPA
Ga0134128_131936941	3300010373	Terrestrial Soil	MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFI
Ga0134124_121883671	3300010397	Terrestrial Soil	ATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR*
Ga0134127_115140511	3300010399	Terrestrial Soil	VVFPWISSIFDPKAIFSVELLPGGGQAHHKMDCILTPAFIGSR
Ga0134127_133768781	3300010399	Terrestrial Soil	MVFPRISSIFDPQSIFSVELLPGGGQAHHKMDSILTPAFIGSR
Ga0134122_108756401	3300010400	Terrestrial Soil	VVFPQISSIFDPQAIFSVELLPDGGQAHHKMDCILTPAFIGS
Ga0134121_124142691	3300010401	Terrestrial Soil	RISSIFNPQAISSVELLLGGGQAHHKMVYALTLAFMGS*
Ga0134123_121106381	3300010403	Terrestrial Soil	VVFPQISSIFDPQAIFSVELLPGGGQAHHKMDLILTPTFIGSRCGIRGAH
Ga0157379_121888821	3300014968	Switchgrass Rhizosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILALAFIGGRCRIRGA
Ga0157379_125290211	3300014968	Switchgrass Rhizosphere	KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPTFIGSR*
Ga0182183_10706071	3300015270	Switchgrass Phyllosphere	MNVIFPRMSPIFVPQAIFNIELLPGGGQAHHKMDCTLTHAFIG
Ga0182183_10900441	3300015270	Switchgrass Phyllosphere	KYKQLATNVVFPRISSIFDPQAIFSIERLPGGGQAHHKMDCALTLAFMDS*
Ga0182100_10890641	3300015280	Switchgrass Phyllosphere	PRISSIFDPQAIFSDELLPGGGHAHHNMDCTLTPAFIGSR*
Ga0182100_10993351	3300015280	Switchgrass Phyllosphere	VFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR*
Ga0182101_10483841	3300015284	Switchgrass Phyllosphere	MIFPQISSIFDPQAFFSVELLPDGGQAHHKMDCILTPAFIGSRC
Ga0182101_10501441	3300015284	Switchgrass Phyllosphere	MNMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTL
Ga0182101_10986301	3300015284	Switchgrass Phyllosphere	KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHRKMDCALTPAFMGS*
Ga0182103_10987191	3300015293	Switchgrass Phyllosphere	KQLATNVVFPRISSIFDPQAIFSIELLPGGGQAHHKMDCTLTHAFIGSK*
Ga0182103_11022921	3300015293	Switchgrass Phyllosphere	VVFPRISEIFNTQAIFSVELLPGGGQAHHMTDCILTPAFIGSRFRIRGAR
Ga0182180_10572142	3300015306	Switchgrass Phyllosphere	MVFPRISSIFDPQAIYSVELLPGGGQAHHKMDCILTSAFIGSRC
Ga0182180_10851301	3300015306	Switchgrass Phyllosphere	IFDPQAIFGVELLPGEGQAHHKMDCALTLAFIGSR*
Ga0182162_10332861	3300015310	Switchgrass Phyllosphere	MVFPRLSSIFDAQAIFSVELLPGGGQAHHKMDCTLTPAFIGS
Ga0182182_10335511	3300015311	Switchgrass Phyllosphere	VFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFMGS*
Ga0182182_10358001	3300015311	Switchgrass Phyllosphere	VVFPRISSIFDPQAIFSVELLAGGGQAHHKMDCSLTPAFIG
Ga0182164_11333731	3300015313	Switchgrass Phyllosphere	NVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPACIGST*
Ga0182120_11358751	3300015315	Switchgrass Phyllosphere	KYKQLAMNVVFPRISSIFDPQAIFSVELLPGGGHAHHKMDCTLTPTFICSR*
Ga0182130_10640541	3300015319	Switchgrass Phyllosphere	MVFPRISLIFDPQAIFSVELLPGGGQAHHKMDCTL
Ga0182130_11338591	3300015319	Switchgrass Phyllosphere	KQLATNVVFPRISSIFDPQAIFSVELLPGGGQAQHKMDCPFTPAFIGSR*
Ga0182165_10614851	3300015320	Switchgrass Phyllosphere	RISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFMGS*
Ga0182165_11162111	3300015320	Switchgrass Phyllosphere	VVFPQISSIFDPQAIFSVELLPDGGQAHHKMDCILTP
Ga0182165_11218531	3300015320	Switchgrass Phyllosphere	MVFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAF
Ga0182134_11475811	3300015324	Switchgrass Phyllosphere	IFDPQAIFSVELLPGEGQAHQKIDCILTPTFIGSR*
Ga0182148_10890091	3300015325	Switchgrass Phyllosphere	SSIFDPQAIFSVEPLPGGGQANHKMDYTLTPAFIGSI*
Ga0182148_11058641	3300015325	Switchgrass Phyllosphere	MNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDC
Ga0182135_10854631	3300015329	Switchgrass Phyllosphere	NVVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPVFIGSR*
Ga0182135_11484071	3300015329	Switchgrass Phyllosphere	PRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR*
Ga0182135_11489591	3300015329	Switchgrass Phyllosphere	ATNVVFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR*
Ga0182152_10734541	3300015330	Switchgrass Phyllosphere	VVFPRISSIFDPQTIFSVELLPGGGQAHHKMDCILTPTFIG
Ga0182152_11003181	3300015330	Switchgrass Phyllosphere	TNVVFPQISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR*
Ga0182152_11520911	3300015330	Switchgrass Phyllosphere	MVFQRISSIFDPQAIFSVELLAGGDQAHHKMDCILTLAFI
Ga0182131_10951802	3300015331	Switchgrass Phyllosphere	MVFPRISSIFNPKAIFSVELLPGGGQAHHKMDCILTPAFIG
Ga0182131_11049681	3300015331	Switchgrass Phyllosphere	TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDGTLTPAFIGSS*
Ga0182131_11053891	3300015331	Switchgrass Phyllosphere	KQLATNMVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPAFIGSI*
Ga0182131_11523391	3300015331	Switchgrass Phyllosphere	VVFPRISSIFDPQAIFSIELLPGGGQAHHKMDCILTPAFIGSRCGI*
Ga0182131_11575191	3300015331	Switchgrass Phyllosphere	ATNVVFPRISSIFDPQAIFSVELLPGGGQALHKMG*
Ga0182117_10533751	3300015332	Switchgrass Phyllosphere	SSIFDPQAIFSVELLPGGGQAHHKIDCALTPAFICSR*
Ga0182117_10877531	3300015332	Switchgrass Phyllosphere	KQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR*
Ga0182117_11588091	3300015332	Switchgrass Phyllosphere	PRISSIFDPQAIFSVELLPGEGQAHHKMDCALTPAFIGSR*
Ga0182117_11591202	3300015332	Switchgrass Phyllosphere	VVFPRISSIFDPEAIFSVELLPGGGQADHKMDCILTPAFIVVDVE
Ga0182147_11072441	3300015333	Switchgrass Phyllosphere	TILAFPRISSIFDPQAIFGVDLLPGGGQAHHKMDCALTPAFMAS*
Ga0182132_11511461	3300015334	Switchgrass Phyllosphere	NLVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS*
Ga0182150_11569591	3300015336	Switchgrass Phyllosphere	MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFIGSRC
Ga0182150_11580901	3300015336	Switchgrass Phyllosphere	KQLATNVVFPRISSIFDPQAIFSVELLSGGGQAHHKMDCALTPAFIGSR*
Ga0182150_11580902	3300015336	Switchgrass Phyllosphere	VVFPRISLIFDPQAISIVELLPDGGQAHHKMDCILTPAFIGSR
Ga0182137_11647191	3300015338	Switchgrass Phyllosphere	ISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDSC*
Ga0182149_11065341	3300015339	Switchgrass Phyllosphere	LATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKRDCTLTPAFIGSR*
Ga0182115_12853211	3300015348	Switchgrass Phyllosphere	MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPA
Ga0182115_12885381	3300015348	Switchgrass Phyllosphere	TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDYTLTPAFIGSR*
Ga0182185_11856801	3300015349	Switchgrass Phyllosphere	NMVFPRISLKFDPQAIFSVELLPGGGQAHDKMDCTLTPAFIGSR*
Ga0182185_12175301	3300015349	Switchgrass Phyllosphere	TNVVFPRISSIFDPQAIFSVELLPGRGQAHHKMDSTLTPAFIGSR*
Ga0182163_11378451	3300015350	Switchgrass Phyllosphere	KYKHLATNVVFPRISSIFDLQAIFSVELLPCGGQAHHKMDCALTPAFIGSR*
Ga0182163_12131161	3300015350	Switchgrass Phyllosphere	SSIFDPQAIFSVELLPDGGQAHHKMDCALSPAFMGS*
Ga0182163_12387071	3300015350	Switchgrass Phyllosphere	KYKQLAMNLVFPRISSIFDPQAIFSVELLPGGGQAHHNMVCALTPAFMGS*
Ga0182169_11577231	3300015352	Switchgrass Phyllosphere	MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFI
Ga0182169_12149971	3300015352	Switchgrass Phyllosphere	TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTSTPAFIGSR*
Ga0182169_12321201	3300015352	Switchgrass Phyllosphere	MNVVFPRISSIFDPQAIFSVELLPGGDQAHHKIDCALTPAFMDS**RIRGA
Ga0182179_11580641	3300015353	Switchgrass Phyllosphere	MNVVFPRISSIFDPQAIFIVELLPGGGQAHHKMDCTL
Ga0182179_11786151	3300015353	Switchgrass Phyllosphere	LAMNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR*
Ga0182179_12278611	3300015353	Switchgrass Phyllosphere	NVVFPRISSIFDPQAIFSIELLPDGGQAHHKMDCTLTPAFIGSR*
Ga0182179_12693381	3300015353	Switchgrass Phyllosphere	MNVVLPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPA
Ga0182179_12713181	3300015353	Switchgrass Phyllosphere	RISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS*
Ga0182167_13451151	3300015354	Switchgrass Phyllosphere	NVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR*
Ga0182195_10394411	3300017414	Switchgrass Phyllosphere	FPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS
Ga0182195_10558141	3300017414	Switchgrass Phyllosphere	MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTL
Ga0182195_12177611	3300017414	Switchgrass Phyllosphere	YKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR
Ga0182213_12214311	3300017421	Switchgrass Phyllosphere	FPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR
Ga0182201_11325051	3300017422	Switchgrass Phyllosphere	VVFPRISPIFEPQAIFNVELLPGGGQAHHEMDCTLTPQIISSR
Ga0182196_10105492	3300017432	Switchgrass Phyllosphere	ATNVVFPRISSIFDPQAIFSVELLPGGGQAHLKMDCTLTPSFIGSR
Ga0182194_11229351	3300017435	Switchgrass Phyllosphere	MVFPRISSIFDPQAIFCVELLPNGGQADHKIDCVLTPAFIGSSWS
Ga0182200_10383201	3300017439	Switchgrass Phyllosphere	YKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMVCALTPAFMGS
Ga0182200_11493331	3300017439	Switchgrass Phyllosphere	MVFPRISSIFDLQAIFSVELLPGGGQAHHKMDCILTPAFI
Ga0182198_11223141	3300017445	Switchgrass Phyllosphere	MVFPRISLIFDRQAIFSVELLPGGGQAHHKMDCALTPAFMGS
Ga0182217_11282881	3300017446	Switchgrass Phyllosphere	MVFPRISTIFDPQAIFSVELFPGGDQAHHKMDCILTLAFIGSKCRI
Ga0182212_10679721	3300017691	Switchgrass Phyllosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHLKMDCTLTPSFIGSR
Ga0182216_11223681	3300017693	Switchgrass Phyllosphere	MVFPWISSIFDPQAIFSVELLPGGGQAHHKVDCISTPAFIG
Ga0182216_11846891	3300017693	Switchgrass Phyllosphere	KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPACIGST
Ga0182216_12008561	3300017693	Switchgrass Phyllosphere	NVVFPPISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS
Ga0182211_11236131	3300017694	Switchgrass Phyllosphere	MNMVFPWISPIFDPQAIFNVELLPDEGQAHHKMDC
Ga0182211_11539741	3300017694	Switchgrass Phyllosphere	MVFPRISSTFDPQAIFSVELLPGGGQAHHKMDCTLT
Ga0182211_11568671	3300017694	Switchgrass Phyllosphere	FPRISSIFDPQAIFSVELLAGGGQAHHKMDCSLTPAFIGSR
Ga0182211_11747431	3300017694	Switchgrass Phyllosphere	MVFPRISSIFNLQAIFSVELLPGGGQAQQKMDCIL
Ga0182178_10132081	3300020023	Switchgrass Phyllosphere	NMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTLTLAFIGSR
Ga0182178_10172451	3300020023	Switchgrass Phyllosphere	MNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCALTP
Ga0182178_10184041	3300020023	Switchgrass Phyllosphere	MVFPRISSIFDPQAIFSVELLPCGGQANRKMDCILTPAFIGSRY
Ga0182178_10194261	3300020023	Switchgrass Phyllosphere	VVFPQISSIFDPQAIFSVELLPDGGQAHHMMDCILTPTFIGSR
Ga0182118_1037871	3300020223	Switchgrass Phyllosphere	MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYA
Ga0207644_106489941	3300025931	Switchgrass Rhizosphere	MVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR
Ga0207644_118665282	3300025931	Switchgrass Rhizosphere	YLATNVVFPRISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS
Ga0207641_114519581	3300026088	Switchgrass Rhizosphere	MWYSPRISSIFDLQAIFSVKLLPGGGQVDHKMDCALTLAFIGS
Ga0207676_125155511	3300026095	Switchgrass Rhizosphere	ATNMVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPAFIGSR
Ga0268344_10145131	3300028051	Phyllosphere	MVFPRISLIFDPQAIFSVELLPGGGQAHHKMDFTLTPA
Ga0268338_10207611	3300028055	Phyllosphere	TVVFPRISSIYDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR
Ga0268330_10222501	3300028056	Phyllosphere	MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCIL
Ga0268330_10270671	3300028056	Phyllosphere	KYKQLATNMVFPWISSIFDPQAIFSVELLPGGGQAHHILDYTLTPTFIGSR
Ga0268330_10455321	3300028056	Phyllosphere	MVFPRISSIFDPKLFSSVELLPGGGQAHHKMDCILTPAFIVS
Ga0268330_10455341	3300028056	Phyllosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPEFIG
Ga0268332_10358951	3300028058	Phyllosphere	IFDPQAIFNVELLPGGGQAHHEMDCTLTPEIISSR
Ga0268332_10681721	3300028058	Phyllosphere	KKYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALIPAFIGSR
Ga0268314_10213681	3300028061	Phyllosphere	YSPGYHQFDPQAIFSVELLPGGGQAHHKMDYTLTPTFIGSR
Ga0268314_10216362	3300028061	Phyllosphere	YKQLAANVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR
Ga0268342_10410361	3300028062	Phyllosphere	MVFPRISSIFDPQAIFSFELLPGGGQAHHKMDCILTPAFIGS
Ga0268342_10416281	3300028062	Phyllosphere	MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR
Ga0268340_10342551	3300028064	Phyllosphere	VVFPQISSIFDPQAIFSVELLPGGGQAHHKMDCALAPAFIGSR
Ga0268340_10864571	3300028064	Phyllosphere	RISSMFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR
Ga0268347_10197081	3300028142	Phyllosphere	IFDAQAIFSVELLPGGVQAHRKMDCTLTPTFIGSR
Ga0268347_10277671	3300028142	Phyllosphere	RISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS
Ga0268347_10326411	3300028142	Phyllosphere	MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSR
Ga0268348_10067981	3300028143	Phyllosphere	MWYSPRISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFIGSR
Ga0268303_1045771	3300028147	Phyllosphere	LATNVVFPQISSIFDPQAIFSVELLPGGGQAHHKMDFTLTPGFIGSR
Ga0268308_10099791	3300028151	Phyllosphere	VVFPRISSIFDPQAIFSVELLAGGGQAHHKMDCFLTPAFI
Ga0268308_10223511	3300028151	Phyllosphere	LATNVVFPLISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDSC
Ga0268308_10295021	3300028151	Phyllosphere	PIFEPQAIFNVELLPGGGQAHHEMDCTLTPQIISSR
Ga0268336_10209081	3300028152	Phyllosphere	MVFPRISSIFDPQAIFCVELLPGGGQAHHKMDCALTPAF
Ga0268320_10104091	3300028153	Phyllosphere	VVFPRMSSIFDPQDIFSVELFPGGGQGHHKMDCTLTPAFFLVDEE
Ga0268320_10172911	3300028153	Phyllosphere	MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDCILTPAVIGS
Ga0268310_10286231	3300028262	Phyllosphere	SIFDPQAIFSVELLPDGGQAHHKMDCILTPAFIGSRCGI
Ga0268310_10397161	3300028262	Phyllosphere	SIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR
Ga0268264_125044131	3300028381	Switchgrass Rhizosphere	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFI
Ga0268307_10020511	3300028470	Phyllosphere	MNVVFPRISSIFDPQPIFSVELLPGAGQAHHKMDYALTPAFIGSR
Ga0268323_10142101	3300028471	Phyllosphere	MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYTLTPAFIGSR
Ga0268319_10231851	3300028473	Phyllosphere	MEFPRISSIFDPQAIFCVELLPGGGQAHNKMHCILTPAF
Ga0061013_100294451	3300030772	Fungi-Associated Bovine Rumen	VVFPQISSIFDSQAIFSVELLPGGGQAHHKMDCILTPAFIGSR
Ga0214484_10461461	3300032591	Switchgrass Phyllosphere	VVFPRISSIFDPEVIFSVIFLPGGGQAHHKMDCILTPAFIGSRCRIRGA
Ga0314759_11509591	3300033535	Switchgrass Phyllosphere	MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFIGSRCRIRGA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.20
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.20
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F044941

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign