NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045179

Metagenome / Metatranscriptome Family F045179

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045179
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 40 residues
Representative Sequence MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Number of Associated Samples 139
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.85 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.007 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(18.954 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.791 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 11.59%    β-sheet: 0.00%    Coil/Unstructured: 88.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF04879Molybdop_Fe4S4 82.35
PF10518TAT_signal 4.58
PF04216FdhE 3.27
PF00384Molybdopterin 1.31
PF12838Fer4_7 0.65
PF13468Glyoxalase_3 0.65
PF12704MacB_PCD 0.65
PF01638HxlR 0.65
PF01568Molydop_binding 0.65
PF04014MazE_antitoxin 0.65
PF13437HlyD_3 0.65
PF13193AMP-binding_C 0.65
PF02274ADI 0.65
PF02634FdhD-NarQ 0.65
PF11999Ice_binding 0.65
PF13147Obsolete Pfam Family 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG3058Formate dehydrogenase maturation protein FdhEPosttranslational modification, protein turnover, chaperones [O] 3.27
COG1526Formate dehydrogenase assembly factor FdhD, a sulfurtransferaseEnergy production and conversion [C] 0.65
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.65
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.65
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.65
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.01 %
UnclassifiedrootN/A16.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309002|MiccSOB_contig38790Not Available1164Open in IMG/M
3300004091|Ga0062387_101191685All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300004152|Ga0062386_100907942All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300004153|Ga0063455_101706903Not Available500Open in IMG/M
3300004156|Ga0062589_101935816All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300004471|Ga0068965_1066269All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300004643|Ga0062591_101393589All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300004800|Ga0058861_10015509All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300004800|Ga0058861_10064204All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005294|Ga0065705_10394055All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005328|Ga0070676_10986043All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005332|Ga0066388_107783874All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005334|Ga0068869_101115861All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005336|Ga0070680_100355901All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300005343|Ga0070687_100469060All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300005444|Ga0070694_100281295All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300005444|Ga0070694_101103371All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005447|Ga0066689_10661446All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005451|Ga0066681_10848414All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005455|Ga0070663_102079902All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005458|Ga0070681_10300043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1516Open in IMG/M
3300005459|Ga0068867_100575900All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300005467|Ga0070706_101834785All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005533|Ga0070734_10250456All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300005542|Ga0070732_10312611All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005544|Ga0070686_101177270All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005546|Ga0070696_100459203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1006Open in IMG/M
3300005554|Ga0066661_10710810All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005577|Ga0068857_100768307All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300005587|Ga0066654_10931319All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005602|Ga0070762_10111529All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300005618|Ga0068864_101100860All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005719|Ga0068861_100153557All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300005764|Ga0066903_101556604All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300005764|Ga0066903_104765000All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005843|Ga0068860_100977967All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005921|Ga0070766_11301799All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006034|Ga0066656_10527643All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300006224|Ga0079037_101902934All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006755|Ga0079222_10955906All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006844|Ga0075428_100075663All Organisms → cellular organisms → Bacteria3676Open in IMG/M
3300006844|Ga0075428_101732506All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006893|Ga0073928_10417954All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300006893|Ga0073928_10968057All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006904|Ga0075424_100773758All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300006931|Ga0097620_101809752All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300009137|Ga0066709_100986234All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300010339|Ga0074046_10003155All Organisms → cellular organisms → Bacteria13932Open in IMG/M
3300010359|Ga0126376_10219873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1591Open in IMG/M
3300010359|Ga0126376_10629834Not Available1020Open in IMG/M
3300010376|Ga0126381_101802689All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300010379|Ga0136449_100599606All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300011036|Ga0138590_123906Not Available520Open in IMG/M
3300011269|Ga0137392_11456820Not Available544Open in IMG/M
3300015374|Ga0132255_105283254Not Available547Open in IMG/M
3300016270|Ga0182036_10540874All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300017821|Ga0187812_1027777All Organisms → cellular organisms → Bacteria → Acidobacteria1938Open in IMG/M
3300017823|Ga0187818_10027310Not Available2443Open in IMG/M
3300017823|Ga0187818_10044197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1913Open in IMG/M
3300017955|Ga0187817_10579368All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300017959|Ga0187779_11173969All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300017961|Ga0187778_10490288Not Available815Open in IMG/M
3300017995|Ga0187816_10167017All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300017999|Ga0187767_10083784All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300018008|Ga0187888_1123813All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300018034|Ga0187863_10146635All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300018034|Ga0187863_10392431All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300018085|Ga0187772_10162363All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300019208|Ga0180110_1276863Not Available674Open in IMG/M
3300019248|Ga0180117_1016535Not Available668Open in IMG/M
3300019360|Ga0187894_10019843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4812Open in IMG/M
3300019487|Ga0187893_10501314All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300019487|Ga0187893_10928915All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300019767|Ga0190267_11490000All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300019787|Ga0182031_1111434All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300020078|Ga0206352_11354751All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300020580|Ga0210403_10615693All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300020581|Ga0210399_10045428All Organisms → cellular organisms → Bacteria3522Open in IMG/M
3300020582|Ga0210395_11223766All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300020583|Ga0210401_10627252All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300021170|Ga0210400_11136619All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021171|Ga0210405_10738783All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300021181|Ga0210388_11081125All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300021405|Ga0210387_10066010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2948Open in IMG/M
3300021405|Ga0210387_10286396All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300021432|Ga0210384_11094160Not Available700Open in IMG/M
3300021433|Ga0210391_10085734All Organisms → cellular organisms → Bacteria2486Open in IMG/M
3300021433|Ga0210391_10638103All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300021479|Ga0210410_10940950Not Available752Open in IMG/M
3300021559|Ga0210409_10080510All Organisms → cellular organisms → Bacteria3018Open in IMG/M
3300022508|Ga0222728_1020887Not Available947Open in IMG/M
3300022509|Ga0242649_1072666Not Available519Open in IMG/M
3300022532|Ga0242655_10095306Not Available810Open in IMG/M
3300022713|Ga0242677_1085987Not Available513Open in IMG/M
3300022726|Ga0242654_10172901Not Available736Open in IMG/M
3300022737|Ga0247747_1035801All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025414|Ga0208935_1024783All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300025904|Ga0207647_10336919All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025918|Ga0207662_11125634All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025925|Ga0207650_10740206All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300025932|Ga0207690_10045564All Organisms → cellular organisms → Bacteria2898Open in IMG/M
3300025932|Ga0207690_10715914All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300025933|Ga0207706_10762598All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300025934|Ga0207686_10447381All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300026095|Ga0207676_10791509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus925Open in IMG/M
3300026118|Ga0207675_100960149All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300026298|Ga0209236_1067255All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300026300|Ga0209027_1196359All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300026332|Ga0209803_1182910All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300027548|Ga0209523_1030401All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300027826|Ga0209060_10167657All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300027846|Ga0209180_10484386Not Available694Open in IMG/M
3300027853|Ga0209274_10216029Not Available977Open in IMG/M
3300027867|Ga0209167_10171168All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300027873|Ga0209814_10277825All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300027879|Ga0209169_10071531All Organisms → cellular organisms → Bacteria → Acidobacteria1794Open in IMG/M
3300027882|Ga0209590_10159476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1405Open in IMG/M
3300027911|Ga0209698_10247627All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300028381|Ga0268264_10634667All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300028673|Ga0257175_1019117Not Available1121Open in IMG/M
3300028776|Ga0302303_10178846Not Available741Open in IMG/M
3300029910|Ga0311369_11047468Not Available641Open in IMG/M
3300029944|Ga0311352_11120140All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300030580|Ga0311355_11452042All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300030730|Ga0307482_1125824Not Available727Open in IMG/M
3300030993|Ga0308190_1077387All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300031091|Ga0308201_10189889All Organisms → cellular organisms → Bacteria → Terrabacteria group672Open in IMG/M
3300031236|Ga0302324_100006389All Organisms → cellular organisms → Bacteria25410Open in IMG/M
3300031261|Ga0302140_10734210All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031421|Ga0308194_10170259All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300031474|Ga0170818_103039102Not Available988Open in IMG/M
3300031525|Ga0302326_10113718All Organisms → cellular organisms → Bacteria4790Open in IMG/M
3300031682|Ga0318560_10035883All Organisms → cellular organisms → Bacteria2375Open in IMG/M
3300031708|Ga0310686_104623711All Organisms → cellular organisms → Bacteria → Acidobacteria5217Open in IMG/M
3300031740|Ga0307468_102312691All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031777|Ga0318543_10440560All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031858|Ga0310892_10527312All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031858|Ga0310892_10940800All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031893|Ga0318536_10274905All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300031908|Ga0310900_10327088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1138Open in IMG/M
3300031908|Ga0310900_10732595All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300031938|Ga0308175_102907724All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032043|Ga0318556_10079890All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300032160|Ga0311301_11298205All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300032180|Ga0307471_101193225Not Available925Open in IMG/M
3300032256|Ga0315271_10870304Not Available777Open in IMG/M
3300032783|Ga0335079_10269225All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300032805|Ga0335078_10873372All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300032892|Ga0335081_10114163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3971Open in IMG/M
3300032897|Ga0335071_10418724All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300032898|Ga0335072_11152924All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300032955|Ga0335076_11565661All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300034178|Ga0364934_0268839All Organisms → cellular organisms → Bacteria646Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.61%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.96%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.31%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.31%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.31%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.31%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.65%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.65%
Concrete Drainage Pipe BiofilmEnvironmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm0.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.65%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.65%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309002Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assemblyEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004471Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011036Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MiccSOB_002499302070309002Concrete Drainage Pipe BiofilmMIQMTSAFLMSVQLFVIAPRPNVGPKLATVGPCQILALVFDLQ
Ga0062387_10119168513300004091Bog Forest SoilPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA*
Ga0062386_10090794213300004152Bog Forest SoilPPMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSR*
Ga0063455_10170690313300004153SoilLPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA*
Ga0062589_10193581623300004156SoilPPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM*
Ga0068965_106626923300004471Peatlands SoilPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR*
Ga0062591_10139358913300004643SoilNIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0058861_1001550913300004800Host-AssociatedPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0058861_1006420413300004800Host-AssociatedPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM*
Ga0065705_1039405513300005294Switchgrass RhizosphereMINIMSVFLMSIQPFVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0070676_1098604323300005328Miscanthus RhizospherePPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWVSR*
Ga0066388_10778387423300005332Tropical Forest SoilLPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0068869_10111586113300005334Miscanthus RhizosphereLPPMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0070680_10035590133300005336Corn RhizospherePPITNIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0070687_10046906013300005343Switchgrass RhizospherePMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWVSR*
Ga0070694_10028129513300005444Corn, Switchgrass And Miscanthus RhizosphereINITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLAWFSR*
Ga0070694_10110337113300005444Corn, Switchgrass And Miscanthus RhizosphereITNIMSVFLMSIQPVVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0066689_1066144613300005447SoilPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLAWFSM*
Ga0066681_1084841413300005451SoilPMINIMSVFLMSIQPFVIAPRPNVGPRLETVGPCQTRAWFSR*
Ga0070663_10207990213300005455Corn RhizospherePMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0070681_1030004333300005458Corn RhizosphereMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM*
Ga0068867_10057590033300005459Miscanthus RhizosphereNIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK*
Ga0070706_10183478523300005467Corn, Switchgrass And Miscanthus RhizosphereINIMSVFLMSIHPLVMAPRPKVGPKLETVGPCQTRAWVS*
Ga0070734_1025045633300005533Surface SoilAGFPPMINIMSVFLMSTQPFVMAPRPNVGPKLETVGPCQTLA*
Ga0070732_1031261113300005542Surface SoilPPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0070686_10117727023300005544Switchgrass RhizospherePPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTLAWFSR*
Ga0070696_10045920313300005546Corn, Switchgrass And Miscanthus RhizospherePMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK*
Ga0066661_1071081023300005554SoilPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0068857_10076830723300005577Corn RhizosphereLPPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0066654_1093131913300005587SoilPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK*
Ga0070762_1011152933300005602SoilISIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA*
Ga0068864_10110086013300005618Switchgrass RhizosphereLPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0068861_10015355743300005719Switchgrass RhizosphereLPPMINIMSVFLMSIHPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0066903_10155660433300005764Tropical Forest SoilLPPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0066903_10476500013300005764Tropical Forest SoilSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0068860_10097796713300005843Switchgrass RhizospherePMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLA*
Ga0070766_1130179923300005921SoilIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTLA*
Ga0066656_1052764323300006034SoilVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0079037_10190293413300006224Freshwater WetlandsPMTKTTSAFLMSTQPLVIAPRPNVAARLATVGECQTRAWESR*
Ga0079222_1095590613300006755Agricultural SoilMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0075428_10007566363300006844Populus RhizosphereMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0075428_10173250623300006844Populus RhizosphereINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK*
Ga0073928_1041795413300006893Iron-Sulfur Acid SpringPMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSM*
Ga0073928_1096805713300006893Iron-Sulfur Acid SpringMINIMSVFLMSIQPLVMAPLPNVGPKLETVGPCQTLA*
Ga0075424_10077375813300006904Populus RhizosphereSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0097620_10180975213300006931Switchgrass RhizosphereINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK*
Ga0066709_10098623423300009137Grasslands SoilMINIMSVFLMSIQPFVIAPLLNVDPNLEHVCPCQTRAWFS
Ga0074046_10003155173300010339Bog Forest SoilPPMINIMSVFLMSTQPLVMAPRPNVGPKLETVGPCQTLA*
Ga0126376_1021987333300010359Tropical Forest SoilPPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR*
Ga0126376_1062983433300010359Tropical Forest SoilPMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLA*
Ga0126381_10180268933300010376Tropical Forest SoilPMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLA*
Ga0136449_10059960613300010379Peatlands SoilIMSVFLMSIQPFVMAPRPKVGPKLETVGPCQTLA*
Ga0138590_12390613300011036Peatlands SoilINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR*
Ga0137392_1145682023300011269Vadose Zone SoilMMSIMSVFFMSTQPLVIAPRPNVGPKLETVGPCQTLA*
Ga0132255_10528325423300015374Arabidopsis RhizospherePPITVITYACLMSIQRLVIAPRPKEGAKLATDGPCQTLA*
Ga0182036_1054087413300016270SoilMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLA
Ga0187812_102777713300017821Freshwater SedimentPPMINIMSVFLMSIQPLVMAPRPNVGPKLETVGPCQTLAWFSR
Ga0187818_1002731013300017823Freshwater SedimentMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFS
Ga0187818_1004419713300017823Freshwater SedimentPPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0187817_1057936813300017955Freshwater SedimentPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0187779_1117396913300017959Tropical PeatlandPMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSI
Ga0187778_1049028813300017961Tropical PeatlandAFLMSTHPLVIAPRPNVAARLAPVGACQTRAWESR
Ga0187816_1016701713300017995Freshwater SedimentIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0187767_1008378433300017999Tropical PeatlandMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0187888_112381313300018008PeatlandPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0187863_1014663513300018034PeatlandNIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0187863_1039243113300018034PeatlandFPPMINIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLAWFSM
Ga0187772_1016236333300018085Tropical PeatlandSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0180110_127686323300019208Groundwater SedimentAFLMSTHPFVIAPRPNVAARLATVGACHTRAWESL
Ga0180117_101653523300019248Groundwater SedimentSAFLMSTQPLVIAPRPNVAARLATVGECQTRAWESR
Ga0187894_1001984313300019360Microbial Mat On RocksMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0187893_1050131413300019487Microbial Mat On RocksISIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0187893_1092891513300019487Microbial Mat On RocksMISIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0190267_1149000023300019767SoilINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK
Ga0182031_111143423300019787BogPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0206352_1135475123300020078Corn, Switchgrass And Miscanthus RhizosphereMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRA
Ga0210403_1061569313300020580SoilMINIMSVFLMSTQPLVMAPRPNVGPKLETVGPCQTLA
Ga0210399_1004542843300020581SoilPMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTLAWFSI
Ga0210395_1122376623300020582SoilMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0210401_1062725233300020583SoilNIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSI
Ga0210400_1113661913300021170SoilPMINIMSVFLMSIQPLVMAPLPNVGPKLETVGPCQTLA
Ga0210405_1073878323300021171SoilFPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0210388_1108112513300021181SoilNIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0210387_1006601013300021405SoilMISIMSVFFISTQPFVIAPRPNVGPKLETVGPCQT
Ga0210387_1028639643300021405SoilISIMSVFLISTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0210384_1109416023300021432SoilMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0210391_1008573443300021433SoilMMSIMSVFFMSTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0210391_1063810313300021433SoilPMINIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLA
Ga0210410_1094095023300021479SoilNIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0210409_1008051063300021559SoilINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRA
Ga0222728_102088713300022508SoilINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0242649_107266613300022509SoilINIMSVFLMSIQPFVMAPLPNVGPKLETVGPCQTLA
Ga0242655_1009530613300022532SoilPIINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0242677_108598723300022713SoilPMMSIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA
Ga0242654_1017290113300022726SoilINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTRAWFSK
Ga0247747_103580123300022737SoilMSVFLMSIHPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0208935_102478323300025414PeatlandINIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLAWFSI
Ga0207647_1033691923300025904Corn RhizosphereIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0207662_1112563413300025918Switchgrass RhizosphereMINITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTR
Ga0207650_1074020623300025925Switchgrass RhizospherePMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0207690_1004556443300025932Corn RhizosphereNITSLFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0207690_1071591423300025932Corn RhizosphereINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0207706_1076259813300025933Corn RhizospherePPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK
Ga0207686_1044738113300025934Miscanthus RhizosphereMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK
Ga0207676_1079150913300026095Switchgrass RhizosphereMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK
Ga0207675_10096014923300026118Switchgrass RhizosphereNIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM
Ga0209236_106725543300026298Grasslands SoilNIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM
Ga0209027_119635923300026300Grasslands SoilINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK
Ga0209803_118291013300026332SoilLPPMTRTTSAFRTSTHPLVIAPRPNVAARLATVGPCQTLA
Ga0209523_103040113300027548Forest SoilIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0209060_1016765713300027826Surface SoilAGFPPMINIMSVFLMSTQPFVMAPRPNVGPKLETVGPCQTLA
Ga0209180_1048438623300027846Vadose Zone SoilPPMMSIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0209274_1021602923300027853SoilPPMMSIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA
Ga0209167_1017116833300027867Surface SoilIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSR
Ga0209814_1027782523300027873Populus RhizosphereMINITSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0209169_1007153133300027879SoilMSVFLVSTQPLVMAPRPKVGPKLETVGPCQTLAWFSM
Ga0209590_1015947613300027882Vadose Zone SoilPMINIMSVFFMSIQPLVIAPRPKVGPKLETVGACQTRACVSK
Ga0209698_1024762713300027911WatershedsNIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0268264_1063466733300028381Switchgrass RhizospherePMINITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0257175_101911723300028673SoilPPMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTLAWFSR
Ga0302303_1017884613300028776PalsaPMINIMSVFLMSTQPLVMAPLPNVGPKLETVGPCQTLA
Ga0311369_1104746823300029910PalsaINIMSVFLMSTQPFVMAPLPNVGPKLETVGPCQTLA
Ga0311352_1112014013300029944PalsaMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTRA
Ga0311355_1145204223300030580PalsaPMINIMSVFFMSIQPLVIAPRPNVGPKLETVGPCQTLA
Ga0307482_112582413300030730Hardwood Forest SoilPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSK
Ga0308190_107738713300030993SoilPMARMTSAFLMSTQPLVIAPRPNVAAKLATVGPCQTLA
Ga0308201_1018988913300031091SoilVFLMSRQWFVMAPRPNEAAKLATVGPCQTLACCSR
Ga0302324_10000638913300031236PalsaMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSK
Ga0302140_1073421013300031261BogMISIMSVLPMSTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0308194_1017025913300031421SoilPPMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0170818_10303910233300031474Forest SoilPMTIIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLAWFSK
Ga0302326_1011371883300031525PalsaPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA
Ga0318560_1003588353300031682SoilINIKSVFLRSIQPFVIAPRPNVGPKLETVGACQVRA
Ga0310686_10462371113300031708SoilSIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA
Ga0307468_10231269113300031740Hardwood Forest SoilPIINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK
Ga0318543_1044056023300031777SoilMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0310892_1052731233300031858SoilVFLISIQPLVIAPRPKVGPKLETVGPCQTRAWFSR
Ga0310892_1094080023300031858SoilMINIMSVFLMSIQPLVIAPRPNVGPRLETVGPCQTRAWFSR
Ga0318536_1027490513300031893SoilINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0310900_1032708833300031908SoilMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0310900_1073259523300031908SoilPPMINIMSVFLMSIQPLVIAPRPNVGPRLETVGPCQTRAWFSR
Ga0308175_10290772413300031938SoilNIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM
Ga0318556_1007989033300032043SoilINIISVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0311301_1129820513300032160Peatlands SoilSVFFMSTQPLVIAPRPNDGPKLETVGPCQTLAWFSR
Ga0307471_10119322513300032180Hardwood Forest SoilMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0315271_1087030413300032256SedimentRTTSAFLMSTHPFVIAPRPNVAAKLATVGACQTRAWESL
Ga0335079_1026922543300032783SoilSIMSVFFMSIQPLVMAPRPNVGPKLETVGPCQTLA
Ga0335078_1087337213300032805SoilPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0335081_1011416313300032892SoilMTNAMSVFRMSVQPLVIAPRPNVGPKLETVGPCQTLA
Ga0335071_1041872433300032897SoilLPPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR
Ga0335072_1115292423300032898SoilPITKIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLA
Ga0335076_1156566113300032955SoilMTKAMSVFRMSVQPLVIAPRPNVGPKLETVGPCQTLA
Ga0364934_0268839_2_1393300034178SedimentGFPPMQRMTSAFLMSTHPFVIAPRPNVAARLATVGACQTRAWESR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.