NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045399

Metagenome / Metatranscriptome Family F045399

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045399
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 44 residues
Representative Sequence LFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Number of Associated Samples 125
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.39 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.353 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.379 % of family members)
Environment Ontology (ENVO) Unclassified
(40.523 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.477 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.63%    β-sheet: 0.00%    Coil/Unstructured: 94.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF07519Tannase 2.61
PF00756Esterase 1.96
PF01979Amidohydro_1 1.96
PF13360PQQ_2 1.96
PF05935Arylsulfotrans 1.96
PF00753Lactamase_B 1.96
PF13577SnoaL_4 1.96
PF02627CMD 1.31
PF03544TonB_C 1.31
PF02687FtsX 1.31
PF00069Pkinase 1.31
PF02604PhdYeFM_antitox 0.65
PF06224HTH_42 0.65
PF13847Methyltransf_31 0.65
PF12732YtxH 0.65
PF00486Trans_reg_C 0.65
PF13620CarboxypepD_reg 0.65
PF08450SGL 0.65
PF12706Lactamase_B_2 0.65
PF08031BBE 0.65
PF17158MASE4 0.65
PF00691OmpA 0.65
PF13709DUF4159 0.65
PF13683rve_3 0.65
PF05448AXE1 0.65
PF07470Glyco_hydro_88 0.65
PF07883Cupin_2 0.65
PF07730HisKA_3 0.65
PF01432Peptidase_M3 0.65
PF03315SDH_beta 0.65
PF13442Cytochrome_CBB3 0.65
PF04734Ceramidase_alk 0.65
PF01170UPF0020 0.65
PF08282Hydrolase_3 0.65
PF07586HXXSHH 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 5.23
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.31
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.31
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.31
COG011623S rRNA G2445 N2-methylase RlmLTranslation, ribosomal structure and biogenesis [J] 0.65
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.65
COG0286Type I restriction-modification system, DNA methylase subunitDefense mechanisms [V] 0.65
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.65
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.65
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.65
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.65
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.65
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.65
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.65
COG1760L-serine deaminaseAmino acid transport and metabolism [E] 0.65
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.65
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.65
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.65
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.65
COG2263Predicted RNA methylaseGeneral function prediction only [R] 0.65
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.65
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.65
COG281316S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmGTranslation, ribosomal structure and biogenesis [J] 0.65
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.65
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.65
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.65
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.65
COG3458Cephalosporin-C deacetylase or related acetyl esteraseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.65
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.65
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.65
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.65
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.65
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.65
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.35 %
UnclassifiedrootN/A17.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_724119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium921Open in IMG/M
2199352025|deepsgr__Contig_149759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300000559|F14TC_100243836All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300000559|F14TC_101455648Not Available1229Open in IMG/M
3300001661|JGI12053J15887_10163326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1160Open in IMG/M
3300003152|Ga0052254_1143606All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300004463|Ga0063356_105483072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300005331|Ga0070670_100988456All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005331|Ga0070670_101271995All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005331|Ga0070670_102067160All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005345|Ga0070692_10418616Not Available850Open in IMG/M
3300005354|Ga0070675_101847965All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005355|Ga0070671_101311085Not Available639Open in IMG/M
3300005364|Ga0070673_101943585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300005367|Ga0070667_102252377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae513Open in IMG/M
3300005438|Ga0070701_10555466Not Available754Open in IMG/M
3300005444|Ga0070694_101381175Not Available594Open in IMG/M
3300005456|Ga0070678_101695788Not Available594Open in IMG/M
3300005457|Ga0070662_100233914All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300005458|Ga0070681_11565365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300005459|Ga0068867_100113143All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300005543|Ga0070672_101512291All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales601Open in IMG/M
3300005545|Ga0070695_101708305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300005548|Ga0070665_100950761All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300005615|Ga0070702_100580518Not Available837Open in IMG/M
3300005617|Ga0068859_102069123Not Available629Open in IMG/M
3300005719|Ga0068861_100775646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium898Open in IMG/M
3300005719|Ga0068861_101066767All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300005764|Ga0066903_100671677All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300005842|Ga0068858_100972851All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005844|Ga0068862_102720230All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005937|Ga0081455_10588805All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300006163|Ga0070715_10438304All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300006163|Ga0070715_10824754All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales565Open in IMG/M
3300006196|Ga0075422_10471962All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300006237|Ga0097621_100276320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1477Open in IMG/M
3300006358|Ga0068871_101301474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales684Open in IMG/M
3300006358|Ga0068871_102164307All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006845|Ga0075421_102244746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300006852|Ga0075433_11483308Not Available586Open in IMG/M
3300006876|Ga0079217_11725326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300006880|Ga0075429_100072592All Organisms → cellular organisms → Bacteria2997Open in IMG/M
3300006881|Ga0068865_102220705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300006894|Ga0079215_11536123All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300006918|Ga0079216_10044876All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300009012|Ga0066710_103813773Not Available565Open in IMG/M
3300009036|Ga0105244_10602523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300009098|Ga0105245_13246166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae504Open in IMG/M
3300009100|Ga0075418_10560221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1229Open in IMG/M
3300009100|Ga0075418_11775589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300009137|Ga0066709_101224258All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300009137|Ga0066709_101281233All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300009147|Ga0114129_11933683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium715Open in IMG/M
3300009148|Ga0105243_11075127All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300009148|Ga0105243_11560194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae686Open in IMG/M
3300009148|Ga0105243_12182715All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300009156|Ga0111538_13194571Not Available571Open in IMG/M
3300009174|Ga0105241_11601215All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300009551|Ga0105238_11426234Not Available720Open in IMG/M
3300009553|Ga0105249_10776804Not Available1021Open in IMG/M
3300010337|Ga0134062_10694554Not Available534Open in IMG/M
3300010366|Ga0126379_12130510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia662Open in IMG/M
3300010366|Ga0126379_13177616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300010400|Ga0134122_11006533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300010401|Ga0134121_10684074All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300010403|Ga0134123_12411599All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300011430|Ga0137423_1099080All Organisms → cellular organisms → Bacteria → Acidobacteria869Open in IMG/M
3300012212|Ga0150985_108502528All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012212|Ga0150985_112234841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300012212|Ga0150985_118524257All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012486|Ga0157331_1031172All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012903|Ga0157289_10003705All Organisms → cellular organisms → Bacteria2463Open in IMG/M
3300012907|Ga0157283_10355624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012955|Ga0164298_10627076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300012988|Ga0164306_10872315All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300013297|Ga0157378_12753904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300014326|Ga0157380_10103143All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300014745|Ga0157377_10170693All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300015201|Ga0173478_10012378All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300015371|Ga0132258_10013539All Organisms → cellular organisms → Bacteria17286Open in IMG/M
3300015372|Ga0132256_103313339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300015374|Ga0132255_100837359Not Available1373Open in IMG/M
3300015374|Ga0132255_103598712All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300016270|Ga0182036_10323592All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300017792|Ga0163161_10403542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181096Open in IMG/M
3300018060|Ga0187765_10595973All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300018429|Ga0190272_11871370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio metschnikovii → Vibrio metschnikovii CIP 69.14629Open in IMG/M
3300018466|Ga0190268_10455313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300018466|Ga0190268_12413081Not Available500Open in IMG/M
3300018469|Ga0190270_12311879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300018476|Ga0190274_13749175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae514Open in IMG/M
3300018476|Ga0190274_13795090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018481|Ga0190271_10165058All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300018481|Ga0190271_10422754All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300019228|Ga0180119_1269399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300019356|Ga0173481_10322625All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300019362|Ga0173479_10116263All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300021329|Ga0210362_1402962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021384|Ga0213876_10355153All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300022724|Ga0242665_10233592All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300023168|Ga0247748_1037281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae716Open in IMG/M
(restricted) 3300023208|Ga0233424_10334687Not Available578Open in IMG/M
3300024317|Ga0247660_1081656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300025907|Ga0207645_10093943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1930Open in IMG/M
3300025924|Ga0207694_10823004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300025930|Ga0207701_10150843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2060Open in IMG/M
3300025933|Ga0207706_10226848Not Available1635Open in IMG/M
3300025937|Ga0207669_10636106All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium871Open in IMG/M
3300025937|Ga0207669_11275128All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025937|Ga0207669_11935471Not Available504Open in IMG/M
3300025940|Ga0207691_10789172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales798Open in IMG/M
3300025942|Ga0207689_11035200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300025945|Ga0207679_12155483All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025960|Ga0207651_11414174Not Available626Open in IMG/M
3300025960|Ga0207651_11734019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300025961|Ga0207712_10741111All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300026075|Ga0207708_11130569All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300026095|Ga0207676_11196665All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300026118|Ga0207675_100821557All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300026118|Ga0207675_102714098Not Available504Open in IMG/M
3300026121|Ga0207683_11426381All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027682|Ga0209971_1008304All Organisms → cellular organisms → Bacteria2461Open in IMG/M
3300027691|Ga0209485_1217931All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300027886|Ga0209486_10761127All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300028379|Ga0268266_10267528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1586Open in IMG/M
3300028380|Ga0268265_10459384All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1191Open in IMG/M
3300028380|Ga0268265_11303402All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300028380|Ga0268265_12294025All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300028878|Ga0307278_10271397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300031058|Ga0308189_10117886All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300031226|Ga0307497_10066528All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300031226|Ga0307497_10174381All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300031446|Ga0170820_17348237Not Available709Open in IMG/M
3300031538|Ga0310888_10135722All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300031547|Ga0310887_11106104All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031768|Ga0318509_10581473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis624Open in IMG/M
3300031847|Ga0310907_10493236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300031854|Ga0310904_11279874All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031858|Ga0310892_10695548Not Available697Open in IMG/M
3300031908|Ga0310900_10086245All Organisms → cellular organisms → Bacteria1971Open in IMG/M
3300031908|Ga0310900_10370672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1078Open in IMG/M
3300031908|Ga0310900_11909427Not Available507Open in IMG/M
3300031911|Ga0307412_11607450All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031943|Ga0310885_10228154Not Available933Open in IMG/M
3300031943|Ga0310885_10565452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300032004|Ga0307414_11297389Not Available675Open in IMG/M
3300032122|Ga0310895_10397904Not Available674Open in IMG/M
3300032157|Ga0315912_10288279All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300032157|Ga0315912_11423791All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032174|Ga0307470_11814269All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300033433|Ga0326726_11337512All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300034148|Ga0364927_0174000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300034659|Ga0314780_071549All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.31%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.65%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003152Freshwater sediment microbial communities from Loktak Lake, IndiaEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0177.000028002162886011Miscanthus RhizosphereTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
deepsgr_024583902199352025SoilVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQFDF
F14TC_10024383613300000559SoilTNVGLDVYNLFNRNTGTTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF*
F14TC_10145564823300000559SoilFNANPGTTFESVYDPATNGARWMQPTAVLNPRAARLNAQFDF*
JGI12053J15887_1016332633300001661Forest SoilNLFNSNTATTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQFDF*
Ga0052254_114360613300003152SedimentFNSNTPTTYESVYDPATNGARWLQPTAVLLPRFMRFNVQVDF*
Ga0063356_10548307213300004463Arabidopsis Thaliana RhizosphereTNANTGTTFEASYDPATNGARWMRPTAVLQPRFVRFNVQFDF*
Ga0070670_10098845623300005331Switchgrass RhizosphereVGFDLYNLLNANTPTAYETVYDPATNGARWLQPTSVLNARAARFNVQFDF*
Ga0070670_10127199513300005331Switchgrass RhizosphereYNLFNSNTPTAYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070670_10206716013300005331Switchgrass RhizosphereNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF*
Ga0070692_1041861623300005345Corn, Switchgrass And Miscanthus RhizosphereNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070675_10184796513300005354Miscanthus RhizosphereLFNANTPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF*
Ga0070671_10131108513300005355Switchgrass RhizosphereNLFNANPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0070673_10194358513300005364Switchgrass RhizosphereYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0070667_10225237713300005367Switchgrass RhizosphereLYNLFNANSPTVYETVYDVATNGARWLQPTTVLTGRATRFNAQFEF*
Ga0070701_1055546613300005438Corn, Switchgrass And Miscanthus RhizosphereNPPTTFETVFDVATVGARWLQPTAVLNPRAARLNVQFEF*
Ga0070694_10138117523300005444Corn, Switchgrass And Miscanthus RhizosphereNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070678_10169578813300005456Miscanthus RhizosphereIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070662_10023391413300005457Corn RhizosphereRFFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0070681_1156536523300005458Corn RhizosphereNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0068867_10011314313300005459Miscanthus RhizosphereNLFNSNAGTAFETVYDPVTNGARWMQPTAVLNPRAARFNAQFEF*
Ga0070672_10151229113300005543Miscanthus RhizosphereTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF*
Ga0070695_10170830523300005545Corn, Switchgrass And Miscanthus RhizosphereVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0070665_10095076113300005548Switchgrass RhizosphereTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0070702_10058051813300005615Corn, Switchgrass And Miscanthus RhizosphereGKYRANVGLDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068859_10206912313300005617Switchgrass RhizosphereNPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF*
Ga0068861_10077564633300005719Switchgrass RhizosphereYNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068861_10106676713300005719Switchgrass RhizosphereYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0066903_10067167743300005764Tropical Forest SoilYETVYDPATNGARWMQPTAVLLPRFTRVNVQVDF*
Ga0068858_10097285113300005842Switchgrass RhizosphereTTYETVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF*
Ga0068862_10272023023300005844Switchgrass RhizosphereGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0081455_1058880513300005937Tabebuia Heterophylla RhizosphereYNLFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0070715_1043830423300006163Corn, Switchgrass And Miscanthus RhizosphereDLYNLFNSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF*
Ga0070715_1082475423300006163Corn, Switchgrass And Miscanthus RhizosphereLDLYNLFNANTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF*
Ga0075422_1047196223300006196Populus RhizospherePTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF*
Ga0097621_10027632013300006237Miscanthus RhizosphereNSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF*
Ga0068871_10130147423300006358Miscanthus RhizosphereAYETVFDPATAGARWLQPTAVLTARATRFNAQFEF*
Ga0068871_10216430723300006358Miscanthus RhizospherePTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075421_10224474613300006845Populus RhizosphereTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075433_1148330823300006852Populus RhizosphereGRYKANVGMDVYNVLNSNTPTTYENVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF*
Ga0079217_1172532623300006876Agricultural SoilVDMRIAKVVRLGKYKANVGLDVYNLANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0075429_10007259213300006880Populus RhizosphereDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0068865_10222070523300006881Miscanthus RhizosphereTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0079215_1153612313300006894Agricultural SoilTTVAMDGYNLFNANTPTAYETVYDVTTNGARWMSPTAVLNARAARFNVQFEF*
Ga0079216_1004487623300006918Agricultural SoilANVGLDLYNMFNANTPTNYESVYDPATNGARWMQPTGVLSPRFLRVNMQLDF*
Ga0066710_10381377313300009012Grasslands SoilTTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQVDF
Ga0105244_1060252323300009036Miscanthus RhizosphereAYETVFDFATVGARWMQPTTVLNPRALRFNAQFEF*
Ga0105245_1324616623300009098Miscanthus RhizosphereYNLFNANTATTYETVFDVATSGARWMQPTAVLTPRATRFNVQFDF*
Ga0075418_1056022133300009100Populus RhizosphereGRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFARFNVQVDF*
Ga0075418_1177558923300009100Populus RhizosphereGRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0066709_10122425813300009137Grasslands SoilNTATTYETVYEFVTNGAKWMQPTAVLLPRFIRLNVQFDF*
Ga0066709_10128123323300009137Grasslands SoilYNLFNSNTATTYESVYDPGTNGARWLQPTAVLLPRFMRLNVQVDF*
Ga0114129_1193368323300009147Populus RhizosphereFNANTPAEYEQVFDPATDGARWMQPTSVLLPRFARLNIQFDF*
Ga0105243_1107512713300009148Miscanthus RhizosphereVDLYNLFNANPPTAYETVFDVATVGARWLQPTAVLNARAARFNVQFDF*
Ga0105243_1156019413300009148Miscanthus RhizosphereTYETVYDVATNGARWLQPTAVLTGRATRFNAQFEF*
Ga0105243_1218271513300009148Miscanthus RhizosphereMDLYNVLNANTPTAYETVYDPATNGAKWMQPTAVLLPRFARFNVQVDF*
Ga0111538_1319457113300009156Populus RhizosphereYENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0105241_1160121523300009174Corn RhizosphereMDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0105238_1142623413300009551Corn RhizosphereFEATYDPASAGARWLLPTAVVQPRFMRFNVQVDF*
Ga0105249_1077680413300009553Switchgrass RhizosphereDIYHLMNANTATTYETVYDPATNGARWMKTTAVLLPRFMRFNVQVDF*
Ga0134062_1069455423300010337Grasslands SoilFNANTPTTYETVYDPEKNGAKWMTPTAVLLSRFMRFNVQVDF*
Ga0126379_1213051013300010366Tropical Forest SoilTAFETVYDPATNGSRWMNPTAVLNPRAARFNAQFDF*
Ga0126379_1317761613300010366Tropical Forest SoilLFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0134122_1100653323300010400Terrestrial SoilDVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF*
Ga0134121_1068407413300010401Terrestrial SoilNSNTPTTYESVYDPATNGARWMQPTAVLLPRFIRFNVQVDF*
Ga0134123_1241159923300010403Terrestrial SoilLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0137423_109908023300011430SoilPTTYETVYDPATNGARWMQPTAVLPPRFMRVNVQFDF*
Ga0150985_10850252823300012212Avena Fatua RhizosphereDLYNLFNANNATTYETVFDPATVGAKWMQPTAVLTARATRFNAQFDF*
Ga0150985_11223484113300012212Avena Fatua RhizosphereTYETVYDPATNGARWLQPTAVLLPRFMRFNVQFDF*
Ga0150985_11852425723300012212Avena Fatua RhizosphereTPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF*
Ga0157331_103117223300012486SoilLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF*
Ga0157289_1000370543300012903SoilYNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF*
Ga0157283_1035562423300012907SoilTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0164298_1062707613300012955SoilTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF*
Ga0164306_1087231513300012988SoilPTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF*
Ga0157378_1275390413300013297Miscanthus RhizosphereNVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVPFDF*
Ga0157380_1010314313300014326Switchgrass RhizosphereLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0157377_1017069333300014745Miscanthus RhizosphereFNANTPTTYETVYDPATNGAKWMQPTAVLLPRFMRFNVQVDF*
Ga0173478_1001237813300015201SoilTPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF*
Ga0132258_1001353913300015371Arabidopsis RhizosphereTAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF*
Ga0132256_10331333923300015372Arabidopsis RhizosphereLFNSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF*
Ga0132255_10083735913300015374Arabidopsis RhizosphereGLDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF*
Ga0132255_10359871213300015374Arabidopsis RhizosphereNLFNANPATAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF*
Ga0182036_1032359223300016270SoilLDLYNLFSSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF
Ga0163161_1040354213300017792Switchgrass RhizosphereLFNSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0187765_1059597313300018060Tropical PeatlandNLFNANTATTYETVYDPATNGARWMQPTAVLLPRFTRLNVQVDF
Ga0190272_1187137023300018429SoilSKRATAGLDLYNMFNANTPTGYESVYDPATNGARWMQPTGVLSPRFVRVNMQLDF
Ga0190268_1045531323300018466SoilLNVNTPTTYETVYDPATNGARWMQPTAVLLPRFVRVNVQFDF
Ga0190268_1241308123300018466SoilFGKYRTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTTVLLPRFMRFNVQVDF
Ga0190270_1231187913300018469SoilGTTFEAAYDPATQGGRWLRPTAVLQPRFVRFNVQFDF
Ga0190274_1374917523300018476SoilYNLFNANPPTAYETVFDVATVGARWLQPTAVLSPRATRFNVQFEF
Ga0190274_1379509013300018476SoilNANAPTTFETVYDPATNGARWMQPTAVLNPRAARFNVQLDF
Ga0190271_1016505833300018481SoilDLYNLLNANTPTTYEAVFDPASNGARWMQPTAVLTPRAARFNVQFEF
Ga0190271_1042275433300018481SoilNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0180119_126939913300019228Groundwater SedimentTPTTYETVYDPATNGARWMQPTAVLLPRFMRINVQLDF
Ga0173481_1032262513300019356SoilTYETVYDPATNGAKWMQPTAVLLPRFMRFNIQVDF
Ga0173479_1011626323300019362SoilSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNIQVDF
Ga0210362_140296213300021329EstuarineLDVYNLFNRNTPTTYETVYDPATNGARWLQPTAVLLPRFMRVNVQLDF
Ga0213876_1035515323300021384Plant RootsSNAPSLFETVYDVATNGARWLQPSAVISPRALRLNVDLTF
Ga0242665_1023359213300022724SoilSNVPTTYETVYDPATNGAKWLTPTAVLQSRFMRFNVQVDF
Ga0247748_103728113300023168SoilTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
(restricted) Ga0233424_1033468713300023208FreshwaterYNLFNVNTPTTYETVYDPATNGARWLQPTAVLLPRFMRFNIQLDF
Ga0247660_108165613300024317SoilNSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF
Ga0207645_1009394333300025907Miscanthus RhizosphereNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207694_1082300423300025924Corn RhizosphereGKTKTNVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF
Ga0207701_1015084333300025930Corn, Switchgrass And Miscanthus RhizosphereAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
Ga0207706_1022684823300025933Corn RhizosphereAYETVFDVATAGARWLQPTAVLQPRASRFNVQFDF
Ga0207669_1063610613300025937Miscanthus RhizosphereFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207669_1127512813300025937Miscanthus RhizosphereYNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF
Ga0207669_1193547113300025937Miscanthus RhizosphereLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207691_1078917213300025940Miscanthus RhizosphereNTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF
Ga0207689_1103520013300025942Miscanthus RhizosphereLFNSNTATTYETVYDPATNGAKWLQPTAVLLPRFMRFNVQFDF
Ga0207679_1215548323300025945Corn RhizosphereVRFGKYRTNVGMDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207651_1141417423300025960Switchgrass RhizosphereLNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF
Ga0207651_1173401923300025960Switchgrass RhizosphereDVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF
Ga0207712_1074111123300025961Switchgrass RhizosphereNSNAGTAFETVYDPATNGARWMQPTAVLNPRAARFNAQFEF
Ga0207708_1113056923300026075Corn, Switchgrass And Miscanthus RhizosphereNPATAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF
Ga0207676_1119666513300026095Switchgrass RhizosphereRFGRYRTNVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0207675_10082155723300026118Switchgrass RhizospherePTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0207675_10271409823300026118Switchgrass RhizosphereKYRANVGLDVYNLMNSNTPTAYENVYDPNPAVQKWMQPTTVLLPRFMRFNVQVDF
Ga0207683_1142638123300026121Miscanthus RhizosphereTFEATYDPASNGERWMRPTAVVQPRFLRFNVQFDF
Ga0209971_100830453300027682Arabidopsis Thaliana RhizosphereAYETVYDPATNGARWLQPTAVLLPRFMRFNVQVDF
Ga0209485_121793123300027691Agricultural SoilVGLDLYNMFNANTPTNYESVYDPATNGARWMQPTSVLSPRFLRVNMQLDF
Ga0209486_1076112713300027886Agricultural SoilMFNANTPTGYESVYDPATNGERWMQPTGVLAPRFVRVNMQLDF
Ga0268266_1026752813300028379Switchgrass RhizosphereTTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF
Ga0268265_1045938423300028380Switchgrass RhizosphereLYNLFNANTPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF
Ga0268265_1130340213300028380Switchgrass RhizosphereANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF
Ga0268265_1229402523300028380Switchgrass RhizosphereFFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF
Ga0307278_1027139723300028878SoilTPTTFESTYDPASRGERWMQPTALLQPRFVRFNVQFDF
Ga0308189_1011788623300031058SoilSNTPTNYESVYDPATSGARWMQPTSVLLPRFARVNVQLDF
Ga0307497_1006652813300031226SoilNPPTAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF
Ga0307497_1017438123300031226SoilVAAATLFETVYDPATNGARWMNPTAILNPRAARFNVQFDF
Ga0170820_1734823723300031446Forest SoilGLDIYNLFNVNTPTTYESVYDPATNGAKWLTPTAVLASRFMRFNVQVDF
Ga0310888_1013572213300031538SoilVLRFGRYRANVGMDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLARFMRFNVQVDF
Ga0310887_1110610413300031547SoilNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0318509_1058147313300031768SoilYNLFNSNTPTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF
Ga0310907_1049323613300031847SoilNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310904_1127987413300031854SoilNVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310892_1069554823300031858SoilTPTAYENVYDPNPAVQKWMQPTAVLLPRFMRFNVQVDFQLSR
Ga0310900_1008624543300031908SoilNLLNANAPTTFETVYDPATNGARWMQPTAVLNTRAARFNVQLDF
Ga0310900_1037067223300031908SoilVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF
Ga0310900_1190942723300031908SoilRTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF
Ga0307412_1160745013300031911RhizosphereNLLSANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0310885_1022815423300031943SoilGRYRTNVGMDVYNLLNVNTPTTYETVYDPDPTRQKWMQPTAVLLPRFMRFNVQVDF
Ga0310885_1056545213300031943SoilFGRSKVNVGLDIYNLLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQLDF
Ga0307414_1129738913300032004RhizosphereNTPTNYETVFDPATSGARWMRPTGVLAPRFARVNMQLDF
Ga0310895_1039790423300032122SoilLRFGKYRTNIGMDVYNLANSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0315912_1028827933300032157SoilTYENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0315912_1142379123300032157SoilSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF
Ga0307470_1181426913300032174Hardwood Forest SoilKTRTNVGLDMYNMFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRINVQVDF
Ga0326726_1133751223300033433Peat SoilNLFNSNTATVYNEVFDVATAGAKWMQPTAVLTARATRFNAQFDF
Ga0364927_0174000_1_1203300034148SedimentNTPTTYEAVFDPATNGARWMQPTAVLTPRAARFNVQFEF
Ga0314780_071549_583_7293300034659SoilMDIYNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.