Metagenome Family F045832

Basic Information
Family ID	F045832
Family Type	Metagenome
Number of Sequences	152
Average Sequence Length	36 residues
Representative Sequence	MVLKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Number of Associated Samples	25
Number of Associated Scaffolds	152

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	60.96 %
% of genes near scaffold ends (potentially truncated)	40.13 %
% of genes from short scaffolds (< 2000 bps)	73.03 %
Associated GOLD sequencing projects	21
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Eukaryota (79.605 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut (98.684 % of family members)
Environment Ontology (ENVO)	Unclassified (99.342 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (99.342 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 152 Family Scaffolds
PF00078	RVT_1	3.95
PF12796	Ank_2	0.66
PF04990	RNA_pol_Rpb1_7	0.66
PF03221	HTH_Tnp_Tc5	0.66
PF05380	Peptidase_A17	0.66
PF13857	Ank_5	0.66
PF01359	Transposase_1	0.66
PF10408	Ufd2P_core	0.66

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	79.61 %
Unclassified	root	N/A	20.39 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.61 %
Unclassified	root	N/A	20.39 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	79.61 %
Unclassified	root	N/A	20.39 %

Name	Rank	Taxonomy	Distribution
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	76.32 %
Unclassified	root	N/A	20.39 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	17.76 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	17.76 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	17.76 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	17.76 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	17.76 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	17.76 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	17.76 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	15.79 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.66 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	15.79 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	0.66 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	15.79 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.66 %
Araneae	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	15.79 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.66 %
Araneomorphae	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	15.13 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.66 %
Entelegynae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	15.13 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.66 %
Orbiculariae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	15.13 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	12.50 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	11.18 %
Sterculioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae	0.66 %
Phasmatodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	11.18 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Timematodea	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	9.87 %
Timematoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea	0.66 %
Blaberoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	9.21 %
Timematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae	0.66 %
Ectobiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	9.21 %
Blattellinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae	0.66 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	9.21 %
Blattella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella	0.66 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	9.21 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.66 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.39 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	9.21 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.66 %
Timema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	0.66 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	0.66 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.66 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2209111004\|2212091370	All Organisms → cellular organisms → Eukaryota → Opisthokonta	650	Open in IMG/M
3300001544\|JGI20163J15578_10095118	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1814	Open in IMG/M
3300001544\|JGI20163J15578_10192161	Not Available	1309	Open in IMG/M
3300001544\|JGI20163J15578_10229929	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1196	Open in IMG/M
3300001544\|JGI20163J15578_10300428	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1036	Open in IMG/M
3300001544\|JGI20163J15578_10369354	All Organisms → cellular organisms → Eukaryota → Opisthokonta	918	Open in IMG/M
3300001544\|JGI20163J15578_10466742	Not Available	794	Open in IMG/M
3300001544\|JGI20163J15578_10517141	All Organisms → cellular organisms → Eukaryota → Opisthokonta	742	Open in IMG/M
3300001544\|JGI20163J15578_10552860	All Organisms → cellular organisms → Eukaryota → Opisthokonta	709	Open in IMG/M
3300001544\|JGI20163J15578_10628385	All Organisms → cellular organisms → Eukaryota → Opisthokonta	648	Open in IMG/M
3300001544\|JGI20163J15578_10631160	All Organisms → cellular organisms → Eukaryota → Opisthokonta	646	Open in IMG/M
3300001544\|JGI20163J15578_10661265	Not Available	624	Open in IMG/M
3300001544\|JGI20163J15578_10776728	Not Available	552	Open in IMG/M
3300002125\|JGI20165J26630_10199768	All Organisms → cellular organisms → Eukaryota → Opisthokonta	932	Open in IMG/M
3300002125\|JGI20165J26630_10228030	All Organisms → cellular organisms → Eukaryota → Opisthokonta	885	Open in IMG/M
3300002125\|JGI20165J26630_10315247	Not Available	777	Open in IMG/M
3300002125\|JGI20165J26630_10652888	All Organisms → cellular organisms → Eukaryota → Opisthokonta	559	Open in IMG/M
3300002175\|JGI20166J26741_10024228	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2823	Open in IMG/M
3300002175\|JGI20166J26741_10053409	All Organisms → cellular organisms → Eukaryota → Opisthokonta	549	Open in IMG/M
3300002175\|JGI20166J26741_10057839	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2779	Open in IMG/M
3300002175\|JGI20166J26741_10061301	All Organisms → cellular organisms → Eukaryota → Opisthokonta	545	Open in IMG/M
3300002175\|JGI20166J26741_10431382	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2389	Open in IMG/M
3300002175\|JGI20166J26741_10610559	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	6837	Open in IMG/M
3300002175\|JGI20166J26741_10803671	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6539	Open in IMG/M
3300002175\|JGI20166J26741_11116572	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1935	Open in IMG/M
3300002175\|JGI20166J26741_11473427	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1627	Open in IMG/M
3300002175\|JGI20166J26741_11515629	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1492	Open in IMG/M
3300002175\|JGI20166J26741_11557753	Not Available	1379	Open in IMG/M
3300002175\|JGI20166J26741_11566087	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1359	Open in IMG/M
3300002175\|JGI20166J26741_11609128	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1263	Open in IMG/M
3300002175\|JGI20166J26741_11665817	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1158	Open in IMG/M
3300002175\|JGI20166J26741_11691630	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4206	Open in IMG/M
3300002175\|JGI20166J26741_11716114	Not Available	1078	Open in IMG/M
3300002175\|JGI20166J26741_11732472	Not Available	1054	Open in IMG/M
3300002175\|JGI20166J26741_11769517	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1003	Open in IMG/M
3300002175\|JGI20166J26741_11779337	All Organisms → cellular organisms → Eukaryota → Opisthokonta	990	Open in IMG/M
3300002175\|JGI20166J26741_11823544	All Organisms → cellular organisms → Eukaryota → Opisthokonta	936	Open in IMG/M
3300002175\|JGI20166J26741_11928361	Not Available	826	Open in IMG/M
3300002175\|JGI20166J26741_12021120	All Organisms → cellular organisms → Eukaryota → Opisthokonta	746	Open in IMG/M
3300002175\|JGI20166J26741_12036209	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	734	Open in IMG/M
3300002175\|JGI20166J26741_12104963	Not Available	3137	Open in IMG/M
3300002175\|JGI20166J26741_12113874	All Organisms → cellular organisms → Eukaryota	3122	Open in IMG/M
3300002175\|JGI20166J26741_12136576	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	663	Open in IMG/M
3300002175\|JGI20166J26741_12147063	All Organisms → cellular organisms → Eukaryota	3066	Open in IMG/M
3300002175\|JGI20166J26741_12184950	All Organisms → cellular organisms → Eukaryota → Opisthokonta	633	Open in IMG/M
3300002175\|JGI20166J26741_12272915	All Organisms → cellular organisms → Eukaryota → Opisthokonta	584	Open in IMG/M
3300002185\|JGI20163J26743_10756522	All Organisms → cellular organisms → Eukaryota	667	Open in IMG/M
3300002185\|JGI20163J26743_10971083	All Organisms → cellular organisms → Eukaryota → Opisthokonta	803	Open in IMG/M
3300002185\|JGI20163J26743_11047611	All Organisms → cellular organisms → Eukaryota → Opisthokonta	867	Open in IMG/M
3300002185\|JGI20163J26743_11210342	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1056	Open in IMG/M
3300002185\|JGI20163J26743_11251890	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1123	Open in IMG/M
3300002185\|JGI20163J26743_11317609	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1260	Open in IMG/M
3300002185\|JGI20163J26743_11497507	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2360	Open in IMG/M
3300002185\|JGI20163J26743_11498531	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2381	Open in IMG/M
3300002238\|JGI20169J29049_10615741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	556	Open in IMG/M
3300002238\|JGI20169J29049_10822739	All Organisms → cellular organisms → Eukaryota → Opisthokonta	691	Open in IMG/M
3300002238\|JGI20169J29049_10932058	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	782	Open in IMG/M
3300002238\|JGI20169J29049_11167025	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1078	Open in IMG/M
3300002238\|JGI20169J29049_11237976	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1232	Open in IMG/M
3300002238\|JGI20169J29049_11293922	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	1407	Open in IMG/M
3300002238\|JGI20169J29049_11324118	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1541	Open in IMG/M
3300002238\|JGI20169J29049_11432840	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	3424	Open in IMG/M
3300002501\|JGI24703J35330_11538476	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	1197	Open in IMG/M
3300002508\|JGI24700J35501_10188210	All Organisms → cellular organisms → Eukaryota → Opisthokonta	534	Open in IMG/M
3300002508\|JGI24700J35501_10283038	All Organisms → cellular organisms → Eukaryota → Opisthokonta	593	Open in IMG/M
3300002508\|JGI24700J35501_10372084	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	663	Open in IMG/M
3300002508\|JGI24700J35501_10894045	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2782	Open in IMG/M
3300002508\|JGI24700J35501_10912183	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3664	Open in IMG/M
3300002509\|JGI24699J35502_10412718	All Organisms → cellular organisms → Eukaryota → Opisthokonta	569	Open in IMG/M
3300006045\|Ga0082212_10307764	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1448	Open in IMG/M
3300006045\|Ga0082212_10353378	Not Available	1332	Open in IMG/M
3300006045\|Ga0082212_10358300	Not Available	1321	Open in IMG/M
3300006045\|Ga0082212_11302302	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	560	Open in IMG/M
3300006226\|Ga0099364_10032537	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6284	Open in IMG/M
3300006226\|Ga0099364_10242175	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1989	Open in IMG/M
3300006226\|Ga0099364_10328950	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1648	Open in IMG/M
3300006226\|Ga0099364_10550458	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1172	Open in IMG/M
3300006226\|Ga0099364_10586473	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1121	Open in IMG/M
3300006226\|Ga0099364_10671557	Not Available	1017	Open in IMG/M
3300006226\|Ga0099364_10740779	All Organisms → cellular organisms → Eukaryota → Opisthokonta	946	Open in IMG/M
3300006226\|Ga0099364_10789551	Not Available	900	Open in IMG/M
3300006226\|Ga0099364_10797781	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	893	Open in IMG/M
3300006226\|Ga0099364_10845881	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	851	Open in IMG/M
3300006226\|Ga0099364_10933607	All Organisms → cellular organisms → Eukaryota → Opisthokonta	779	Open in IMG/M
3300006226\|Ga0099364_11160507	All Organisms → cellular organisms → Eukaryota → Opisthokonta	638	Open in IMG/M
3300009784\|Ga0123357_10083974	All Organisms → cellular organisms → Eukaryota	4177	Open in IMG/M
3300009784\|Ga0123357_10100527	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3731	Open in IMG/M
3300009784\|Ga0123357_10164545	Not Available	2647	Open in IMG/M
3300009784\|Ga0123357_10590138	All Organisms → cellular organisms → Eukaryota → Opisthokonta	860	Open in IMG/M
3300009826\|Ga0123355_10182643	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3110	Open in IMG/M
3300010162\|Ga0131853_10005685	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	22509	Open in IMG/M
3300010162\|Ga0131853_10009855	All Organisms → cellular organisms → Eukaryota → Opisthokonta	17483	Open in IMG/M
3300010162\|Ga0131853_10101690	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4246	Open in IMG/M
3300010162\|Ga0131853_10242631	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2036	Open in IMG/M
3300010369\|Ga0136643_10054911	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5702	Open in IMG/M
3300010882\|Ga0123354_10333205	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1380	Open in IMG/M
3300012971\|Ga0126369_11204878	All Organisms → cellular organisms → Eukaryota → Opisthokonta	847	Open in IMG/M
3300027539\|Ga0209424_1065846	All Organisms → cellular organisms → Eukaryota → Opisthokonta	998	Open in IMG/M
3300027558\|Ga0209531_10003798	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2053	Open in IMG/M
3300027558\|Ga0209531_10016537	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1459	Open in IMG/M
3300027558\|Ga0209531_10064830	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1006	Open in IMG/M
3300027558\|Ga0209531_10064985	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1006	Open in IMG/M
3300027558\|Ga0209531_10080458	All Organisms → cellular organisms → Eukaryota → Opisthokonta	941	Open in IMG/M
3300027670\|Ga0209423_10382537	Not Available	702	Open in IMG/M
3300027670\|Ga0209423_10397007	All Organisms → cellular organisms → Eukaryota → Opisthokonta	687	Open in IMG/M
3300027670\|Ga0209423_10542516	All Organisms → cellular organisms → Eukaryota → Opisthokonta	552	Open in IMG/M
3300027670\|Ga0209423_10593221	Not Available	508	Open in IMG/M
3300027864\|Ga0209755_10010106	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	9922	Open in IMG/M
3300027891\|Ga0209628_10272786	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1786	Open in IMG/M
3300027891\|Ga0209628_10283415	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1748	Open in IMG/M
3300027891\|Ga0209628_10299822	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1693	Open in IMG/M
3300027891\|Ga0209628_10362100	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1511	Open in IMG/M
3300027891\|Ga0209628_10383743	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1457	Open in IMG/M
3300027891\|Ga0209628_10450823	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1314	Open in IMG/M
3300027891\|Ga0209628_10483396	Not Available	1256	Open in IMG/M
3300027891\|Ga0209628_10699585	All Organisms → cellular organisms → Eukaryota → Opisthokonta	976	Open in IMG/M
3300027891\|Ga0209628_10924624	All Organisms → cellular organisms → Eukaryota → Opisthokonta	792	Open in IMG/M
3300027891\|Ga0209628_11014812	All Organisms → cellular organisms → Eukaryota → Opisthokonta	735	Open in IMG/M
3300027904\|Ga0209737_10034906	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4329	Open in IMG/M
3300027904\|Ga0209737_10057158	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3550	Open in IMG/M
3300027904\|Ga0209737_10081626	Not Available	3057	Open in IMG/M
3300027904\|Ga0209737_10094982	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2867	Open in IMG/M
3300027904\|Ga0209737_10116226	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema	2626	Open in IMG/M
3300027904\|Ga0209737_10128531	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2511	Open in IMG/M
3300027904\|Ga0209737_10139902	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2416	Open in IMG/M
3300027904\|Ga0209737_10166181	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2232	Open in IMG/M
3300027904\|Ga0209737_10277897	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1741	Open in IMG/M
3300027904\|Ga0209737_10293161	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1693	Open in IMG/M
3300027904\|Ga0209737_10332785	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	1582	Open in IMG/M
3300027904\|Ga0209737_10362645	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1508	Open in IMG/M
3300027904\|Ga0209737_10422421	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1383	Open in IMG/M
3300027904\|Ga0209737_10520466	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1222	Open in IMG/M
3300027904\|Ga0209737_10793734	Not Available	939	Open in IMG/M
3300027904\|Ga0209737_11160347	Not Available	722	Open in IMG/M
3300027904\|Ga0209737_11353253	All Organisms → cellular organisms → Eukaryota → Opisthokonta	644	Open in IMG/M
3300027904\|Ga0209737_11471882	All Organisms → cellular organisms → Eukaryota → Opisthokonta	604	Open in IMG/M
3300027904\|Ga0209737_11590087	All Organisms → cellular organisms → Eukaryota → Opisthokonta	568	Open in IMG/M
3300027966\|Ga0209738_10420865	Not Available	678	Open in IMG/M
3300027966\|Ga0209738_10503716	All Organisms → cellular organisms → Eukaryota → Opisthokonta	605	Open in IMG/M
3300027984\|Ga0209629_10087843	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	3113	Open in IMG/M
3300027984\|Ga0209629_10326537	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1465	Open in IMG/M
3300027984\|Ga0209629_10530400	Not Available	1012	Open in IMG/M
3300027984\|Ga0209629_10614864	Not Available	892	Open in IMG/M
3300027984\|Ga0209629_10760161	Not Available	725	Open in IMG/M
3300027984\|Ga0209629_10777252	All Organisms → cellular organisms → Eukaryota → Opisthokonta	708	Open in IMG/M
3300027984\|Ga0209629_10799184	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	688	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.34%
Environmental	Environmental	0.66%

Habitat	Taxonomy	Distribution
Arthropoda	Host-Associated → Arthropoda	99.34%
Terrestrial	Environmental → Terrestrial	0.66%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Arthropoda → Digestive System	99.34%
Soil	Environmental → Terrestrial → Soil	0.66%

Habitat	Taxonomy	Distribution
Gut	Host-Associated → Arthropoda → Digestive System → Gut	99.34%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.66%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	99.34%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	0.66%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2212115621	2209111004	Macrotermes Natalensis Queen Gut	MLMVLKLGHFRQWIRNTWKILKRDAGEGWGRSVGQICVK
JGI20163J15578_100951181	3300001544	Termite Gut	MVPKLGRFGQQIRNTWKVLKCGTGEGWRRSVGPIMSE
JGI20163J15578_101921614	3300001544	Termite Gut	MVLKLGHFDKYIRNSWEVLKYSAGEGWRRSFGPIVSEMKR*
JGI20163J15578_102299291	3300001544	Termite Gut	MVLKLGRFGQWIRNTWKVLERDAGEGWRKSVGPIM*
JGI20163J15578_103004284	3300001544	Termite Gut	CMVLKLGRFGQQIRNIWKVLKFGGVEGWRRSVGPIM*
JGI20163J15578_103460902	3300001544	Termite Gut	MVPKLGHFRKYIRNTMKVLKCGTEEGWRRSIVPTV*
JGI20163J15578_103693542	3300001544	Termite Gut	MMTYIIELGRFGQYIRNTWKVLKCGAGEEWRRSVGRIM*
JGI20163J15578_104667421	3300001544	Termite Gut	MVLNVEHFGKWIRNTWDVLKCGAGEGWRSVGPIV*
JGI20163J15578_105171411	3300001544	Termite Gut	MVLKLGHFGKEIRNTWKILKCGAGEGWRRSGGTIAREMK
JGI20163J15578_105528601	3300001544	Termite Gut	MVLKLERFGQQIGNTWKVLKCGAGEGWRRSVGPIM*
JGI20163J15578_106283852	3300001544	Termite Gut	MVLKLGRFGQQIRNNWKVLKCGAGEGWKRSLGPIM*
JGI20163J15578_106311603	3300001544	Termite Gut	WLCMVLKLGHFGQQIRNIWKVLECGAGEGWRRSFEPIM*
JGI20163J15578_106612651	3300001544	Termite Gut	MVLKLGRFGQQIRNTWKVLKCDAGEGWRRSVGPIM
JGI20163J15578_107167042	3300001544	Termite Gut	SMKLGRFGRQIRNTWKVLKCGAGEGWRRLVGPIM*
JGI20163J15578_107767281	3300001544	Termite Gut	MVPKLGHLGQLNRNNWKVLKYGAGEGWRSVGPNM*
JGI20165J26630_101315561	3300002125	Termite Gut	MMLKLGSFEMLIRNTGEVSKRGAGEGWRRLVGPIM*
JGI20165J26630_101997682	3300002125	Termite Gut	MVLKLGHFGKEXXNTWKILKCXAGEGWRRSGGTIAREMKY*
JGI20165J26630_102280301	3300002125	Termite Gut	MVLKLGHFGQQIKNTWKVLKCGAGEGWKRSVGLIM*
JGI20165J26630_103152473	3300002125	Termite Gut	MVLKLGRSGSRSDIPGKFLKCGAGEGWRRSVGPIM*
JGI20165J26630_106528882	3300002125	Termite Gut	MVLKLGRFGQKIRNTWKVLKCGVGEGWKRSVELIM
JGI20166J26741_100242282	3300002175	Termite Gut	MVLKLGRFGQQIRNTWKDLKCGVGEGWRRSVGPIM*
JGI20166J26741_100534092	3300002175	Termite Gut	LYIIVPNYSVQLGRFRQQIRNTWKVLKCGAGEGWRRSVGPIM*
JGI20166J26741_100578396	3300002175	Termite Gut	MVLKLERFGKYIRNTWQVLKCGAGEGLRSVGPIV*
JGI20166J26741_100613011	3300002175	Termite Gut	MVLKLERFGQQIRNSWEVLKCSAGEGWRRCVGPII
JGI20166J26741_104313821	3300002175	Termite Gut	LCMVLKFGRFGQQIRNTWKVLKCGAGEGWRRSVAPIT*
JGI20166J26741_106105594	3300002175	Termite Gut	MVLKLGQFEKEIRNTWKVSKCVAGEGWRRSVGPIE*
JGI20166J26741_108036714	3300002175	Termite Gut	MKVGHSRKQIRNTWKDLKCGAGEGQRRSATPICEK*
JGI20166J26741_111165723	3300002175	Termite Gut	MYVYIHMLKLGHFGQQIRNTWKVLKCGAGEGWRRSVGPI
JGI20166J26741_114734275	3300002175	Termite Gut	WLFMVLKLGRFGQQIRNTWEVSKCGAGEGWRRSAGPIT*
JGI20166J26741_115156293	3300002175	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGVGEGWRRSVGPIT
JGI20166J26741_115577532	3300002175	Termite Gut	MIFCELRKFVQYLIRNTWKVLKCGAGEGWRRSVGPIM*
JGI20166J26741_115660872	3300002175	Termite Gut	MLVLKFGRFGQQIRNIWKVLKYGAGEGRRRSVGPIM*
JGI20166J26741_116091282	3300002175	Termite Gut	MVLKLGRFGQQIRNTWKALKCDAGEGWRRSVGPIM
JGI20166J26741_116658173	3300002175	Termite Gut	VLKLGRFGQQIRNTWEILKCGAGEGWRRSAGPIMGE
JGI20166J26741_116916309	3300002175	Termite Gut	MVLKLGHFGKEIRNTWKILKCGAGEGWRRSGGTIAREMKY*
JGI20166J26741_117161143	3300002175	Termite Gut	MVLKLGRFGQQIRNTWNVLKCGAGEGWRRSVGPIM
JGI20166J26741_117324721	3300002175	Termite Gut	MVLKLERFGQQIRNTWKVLKCGAGEGWRRSVGPIM
JGI20166J26741_117695171	3300002175	Termite Gut	MALKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM
JGI20166J26741_117793372	3300002175	Termite Gut	MVLKLGHFGQQIRNTWKVLKCGAGEGWKRSVGLIM*
JGI20166J26741_118235442	3300002175	Termite Gut	MVLKLGHFRQQIRNTWKVLKCGAGEGWRRSVGPIM
JGI20166J26741_119283612	3300002175	Termite Gut	VLKLGHFGQQIRNTWKVLKCDAGEGWRRSVGPIT*
JGI20166J26741_120211201	3300002175	Termite Gut	MVLKRGLFGQQIRNTWEVLKCGVGEGWRRSVGPIMWEMRSVT*
JGI20166J26741_120362093	3300002175	Termite Gut	MVLELRHFGQQIRNTWKVLKCGAGEGWRRSVGPIT*
JGI20166J26741_121049638	3300002175	Termite Gut	MFGAWLCMVLKLGCFGQQIRNTWKVLKCGAGEGWRRS
JGI20166J26741_121138747	3300002175	Termite Gut	KLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIMFNICTIN*
JGI20166J26741_121365761	3300002175	Termite Gut	MGRYFFVDVLKLGRFGQQIRNTWKVSKCGAGEGWRRSVGPI
JGI20166J26741_121470631	3300002175	Termite Gut	MQVCMVLKLGRFGQQIRNTWKVLKCGAGDGWRRSV
JGI20166J26741_121849502	3300002175	Termite Gut	MVLKLLKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM
JGI20166J26741_122729151	3300002175	Termite Gut	MVLKLGHFGQQIRNAWKVLKCGAGEGWRRSVGPIT
JGI20163J26743_107565221	3300002185	Termite Gut	LKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIMFNICTIN*
JGI20163J26743_109710831	3300002185	Termite Gut	MLLKLGRFGQQIRNTWKVLKRGAGEGWRRSVGPIM
JGI20163J26743_110476113	3300002185	Termite Gut	MLHLELKLGHFGQQIRNTWKVLNCGAGEGWRRSVGPIM*
JGI20163J26743_112103421	3300002185	Termite Gut	MALYGAEKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM*
JGI20163J26743_112518901	3300002185	Termite Gut	CMVLKLGHFAQQFRNTWKVLKCGAGEGWRRSVGPIM*
JGI20163J26743_113176093	3300002185	Termite Gut	MAFMVLKLGRFGQKIRNTWKVLKCGAGEGWRRSVGP
JGI20163J26743_114975071	3300002185	Termite Gut	MFSKLGHCGQKIRNTWKVLKCGAGEGWRRLVGPNM*
JGI20163J26743_114985314	3300002185	Termite Gut	MVPELGHFGKQIGNTWEVLKCRAGEGWRRSVGQIV*
JGI20169J29049_106157412	3300002238	Termite Gut	MVLKLGRFGQWITNTRKVLKCGAGEGWKRSVGLIM*
JGI20169J29049_108227391	3300002238	Termite Gut	MVLKLGRFGQEIRNTWKVLKCGAGGGWKRSVGLIM*
JGI20169J29049_109320581	3300002238	Termite Gut	MMPKIGHFGKQIRNTSEVLKCGAGDVWRRSVGPIV*
JGI20169J29049_111670253	3300002238	Termite Gut	MVLKLGRFGQIRNTWKVLKCGAGGGWKRSVGLIM*
JGI20169J29049_112379763	3300002238	Termite Gut	MQKLGLFGQQIRNTWKVLKCGAGGGWKRSVGLNM*
JGI20169J29049_112939222	3300002238	Termite Gut	MVLKIGHFTKHIRNTLKCSKCGAGEAWKIPLGPIV*
JGI20169J29049_113241183	3300002238	Termite Gut	VVLKLGHFGKYIRNTLKIVKCGAGEGWQRSVGSIV*
JGI20169J29049_114328403	3300002238	Termite Gut	VIELGHSRKQIRNTWKVLKCGAGEGWRRSAAPIHEK*
JGI24703J35330_115384762	3300002501	Termite Gut	MALKLGHFKEQSRKTWKVLKCGAGEGWRRSVGLIMREMKR*
JGI24700J35501_101882101	3300002508	Termite Gut	LLWAYYLKVLKLGRFRQQIRNTWKVLKCGAGEGWRRSVEPIM*
JGI24700J35501_102694762	3300002508	Termite Gut	FGAWLCMVLKLGRFGQQIRNTGKVFKCGAGEGWRRSVGPNM*
JGI24700J35501_102830382	3300002508	Termite Gut	GAWLCMVLKLGRFGQQIRNTWKDLKCGAGEGCRRSVGPNM*
JGI24700J35501_103720841	3300002508	Termite Gut	AWLCMVLKLGRFGQQIRNTWKVLKCGAEEGWRISVGPIM*
JGI24700J35501_108940451	3300002508	Termite Gut	GAWLCMVLKLGRFGQQIRNTWKVLKCGAGEGCRRTVGPIM*
JGI24700J35501_109121836	3300002508	Termite Gut	TFGAWLCMVLKLGRFGQQIRNNWKVLKCGAGEEWRRSVGLIM*
JGI24699J35502_104127181	3300002509	Termite Gut	MLRLKHGCMELKLGRSGQQIRNAWEVLKCGAGEGWRRSVGPI
Ga0082212_103077644	3300006045	Termite Gut	MLNLGYYGRQSRNTWEVFKCGFGEGWRRSVEPIM*
Ga0082212_103533782	3300006045	Termite Gut	MEPKFGPYGMQIRNTWKVLKCGAKEGCRRLVGLIK*
Ga0082212_103583002	3300006045	Termite Gut	VLKRGHFEKMVSNTSKVIKCGTVEGWRRSVGPIE*
Ga0082212_113023021	3300006045	Termite Gut	VVLKIGHFGKHIRNTLKVFKCGAGEGWRRSGGPIE*
Ga0099364_1003253712	3300006226	Termite Gut	MVLKLGRFGQQIRNAWKISKCGAGEGWRRSVGPIM
Ga0099364_102421751	3300006226	Termite Gut	MVLKLRRFGQQIRNTWKVLKCGAGEGWRRSVGPIM*
Ga0099364_103289505	3300006226	Termite Gut	MVLTRGHFGKQIRNTSEVLKFGAGEGWIRSAGPIA*
Ga0099364_105504581	3300006226	Termite Gut	MARWLSMVLKLGRFGQQIRNTWKVLKCGAGEGWKRSVGPIM*
Ga0099364_105864731	3300006226	Termite Gut	MELKLGRFGQQIRNTWKVLKCGAGEGWRRSPGLIM*
Ga0099364_106715573	3300006226	Termite Gut	MALKFGNFGKWIRNSWKVLKCGAGELWRSVGPIVREIKNY*
Ga0099364_107407792	3300006226	Termite Gut	MVLKLGHFGKYIRNNRKFLKCGAGDGYRKSAGPIV*
Ga0099364_107895511	3300006226	Termite Gut	MVLKLEHFGQQIRNTWKVFKCGAGEGWKRSVGPIM
Ga0099364_107977812	3300006226	Termite Gut	MFIFNALIKFLVLGRFGQQIRNTWKVLKCGAGEGWKRSVGP
Ga0099364_108458814	3300006226	Termite Gut	MMLKLGHFGKQIGNTWNVLKYGAGEGWRSVGPIM*
Ga0099364_109336072	3300006226	Termite Gut	MVLKLGRFGQQIRNIWKVLKYGAGEGWRRSVGPIM
Ga0099364_111605072	3300006226	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGEGWKRSVGPISE
Ga0123357_100839742	3300009784	Termite Gut	MVLQLGHFGKYIKNKWKILKCGAGKGWRRTVGPIV*
Ga0123357_101005272	3300009784	Termite Gut	MVLALEHFGKWIRNTWKVLKCGTGEEWRRLTGTIV*
Ga0123357_101645452	3300009784	Termite Gut	MVIKLGHSRKQIRNTWKVLKCDVGEGWRRSAAPIREK*
Ga0123357_105901381	3300009784	Termite Gut	MMLELGSFEMFIRNTREVSKCGAGGGWRSLVGPIV*
Ga0123355_101826434	3300009826	Termite Gut	MILKLGHFGEQKRSTWRVLKCGAGEVGRRSVGPTL*
Ga0131853_100056859	3300010162	Termite Gut	MLIKLGHSRKQIRNTWKVLKCGAGEGWRRSAAPICEK*
Ga0131853_1000985512	3300010162	Termite Gut	VLELEHFGKKVRNTWKVLKCGAGKGRRRSFGPTA*
Ga0131853_101016901	3300010162	Termite Gut	MVLRLGHFGQQMTNNLKVSKCGVEEGWKKSVGPIG*
Ga0131853_102426313	3300010162	Termite Gut	MILKLGHFGEQKRSTWKVLKCGAGEGGRRSVGPTL*
Ga0136643_100549118	3300010369	Termite Gut	MVLKLARFGQQMRNTWKVSNFGTGEGWKRSVGPIA*
Ga0123354_103332051	3300010882	Termite Gut	GAQLYMVLKLGGFGQQIRNMWKVLKCGAGAGEGWQRSVGPIM*
Ga0126369_112048782	3300012971	Tropical Forest Soil	MVLKLGHFGQQIRNSWKVLKCGAGEGWRRSVGPIM*
Ga0209424_10658461	3300027539	Termite Gut	MVPELGHFGKQVRNTWEVLKCGAGDGRRRSVGQIV
Ga0209531_100037981	3300027558	Termite Gut	MKVGHSRKQIRNTWKDLKCGAGEGQRRSATPICEK
Ga0209531_100165372	3300027558	Termite Gut	MFSKLGHCGQKIRNTWKVLKCGAGEGWRRLVGPNM
Ga0209531_100648302	3300027558	Termite Gut	MVLKLGHFGQQIRNTWKVLKCGAGEGWRRSVGLIM
Ga0209531_100649853	3300027558	Termite Gut	MVLKLGQFEKEIRNTWKVPKCVAGEGWRRSVGPIE
Ga0209531_100804582	3300027558	Termite Gut	MVLLLGHFGKQIRNAWKVLKYGAGEGWRRSVGPVV
Ga0209423_103825371	3300027670	Termite Gut	MILKLGHFAEQNRNAWIVLKCGAGEGARRSVGTTL
Ga0209423_103970071	3300027670	Termite Gut	MVLKLGRFGQEIRNTWKVLKCGAGGGWKRSVGLIM
Ga0209423_105425161	3300027670	Termite Gut	MVLKLGRFGQWIRNTYKVLKCGAGGGWKRSVGLIM
Ga0209423_105932211	3300027670	Termite Gut	VIELGHSRKQIRNTWKVLKCGAGEGWRRSAAPIHEK
Ga0209755_100101065	3300027864	Termite Gut	MVIKLGHSRKQIRNTWKVLKCGAGEGWRRSGAPIHEK
Ga0209628_100232442	3300027891	Termite Gut	MMLKLGSFEMLIRNTGEVSKRGAGEGWRRLVGPIM
Ga0209628_102727864	3300027891	Termite Gut	MVLKLGSFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209628_102834152	3300027891	Termite Gut	MVLKLGHFGQQIRNTWKFLKCGAGEGWRRLVESIM
Ga0209628_102998223	3300027891	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209628_103621001	3300027891	Termite Gut	VVLKLGHFGKKVRNTWRVLECGAGEGSRRSVVPIG
Ga0209628_103837432	3300027891	Termite Gut	MVLKLGRFGQEIRNTWKVLKCGAGEGWRRSVEPIM
Ga0209628_104508232	3300027891	Termite Gut	MVLKLGHFGKEIRNTWKILKCGAGEGWRRSGGTIAREMKY
Ga0209628_104833961	3300027891	Termite Gut	MVLKLGRFGQQIRNTWKVFKCGAGEGWRRSAGPIIGEMRKC
Ga0209628_106995851	3300027891	Termite Gut	MVLKLGHFGQQIRNTWKVLKCCAGEGWRRSVGQIM
Ga0209628_109246241	3300027891	Termite Gut	MVLKLGHFGQQIRNTWKVLKCGAGEGWRRSVAPNT
Ga0209628_110148123	3300027891	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGEGWRRSVESIM
Ga0209737_100349062	3300027904	Termite Gut	MVLKLGLFGQQIRNTWKVWKCGAGEGCRRPVGPIM
Ga0209737_100571584	3300027904	Termite Gut	CMVLKLGRFGQQIRNTWKVLKCGAGEGWRRSFGTIV
Ga0209737_100816261	3300027904	Termite Gut	MVLKLGRFGQQIKNNWKVLKCGAGEGWRRSVGPIM
Ga0209737_100949822	3300027904	Termite Gut	MVLKLENFGQQIKNTWKVLKYGAGEGWRRSVGPIM
Ga0209737_101162262	3300027904	Termite Gut	MVLKLGNFGQQIRNTWKVLKCGVEEGWRRSVGPIM
Ga0209737_101285311	3300027904	Termite Gut	MVLKLGQFEKEIRNTWKVSKCVAGEGWRRSVGPIE
Ga0209737_101399021	3300027904	Termite Gut	MVLKLERFGQQIGNTWKVLKCGAGEGWRRSVGPIM
Ga0209737_101661811	3300027904	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGDGWRRSVGPIM
Ga0209737_102778971	3300027904	Termite Gut	MVLKRGRFGQQIRNTWKVLKYGAGEGCRRSVGPIMREIK
Ga0209737_102931613	3300027904	Termite Gut	MVLKVGHFGKRFRNTWKVLKCVAGEERRRSLGPIM
Ga0209737_103327851	3300027904	Termite Gut	MVLKLEHFGQQIRNTWKVVKSGAEEGWRRSVGPIM
Ga0209737_103626453	3300027904	Termite Gut	MVLKLGYFGKQIRNTWKALKCGAGEGWRRSAGPIV
Ga0209737_104224211	3300027904	Termite Gut	MVLKLGHFGKEIKNTWKILKCSAGEGWRRSGGTIAREMKY
Ga0209737_105204661	3300027904	Termite Gut	MALYGAEKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209737_107937341	3300027904	Termite Gut	MVLKLGHFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209737_111603471	3300027904	Termite Gut	MVLELRHFGQQIRNTWKVLKCGAGEGWRRSVGPIT
Ga0209737_113532532	3300027904	Termite Gut	MVLKLGHFGQQIRNTWKVLKCGAGGGWRRSVEPIM
Ga0209737_114718821	3300027904	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGEGWKRSVEPIM
Ga0209737_115900871	3300027904	Termite Gut	MVLKLGRFGQQIRNTWKVSKCGAGGGWRRSVGPIM
Ga0209738_104208652	3300027966	Termite Gut	VVLKLRHFGKEVRNNWRVLKCGAGEGWRTSLEPIM
Ga0209738_105037161	3300027966	Termite Gut	MVMKLGRFGQQIRNTWKVLKCGAGEGWKRSVGLIM
Ga0209629_100878436	3300027984	Termite Gut	MVLKLGHFREQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209629_102835141	3300027984	Termite Gut	FGAWLCMVLKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIMFNICTIN
Ga0209629_103265372	3300027984	Termite Gut	LCMVLKLGRFGQQIRNTWKVFKCGAGEGWRRSVGPIM
Ga0209629_105304001	3300027984	Termite Gut	MPMLCMVLKLGRFGQQIRNTWKVLKCGAGEGWRRS
Ga0209629_106148641	3300027984	Termite Gut	MVLKLGCFGQQIGNNWKVLKCGAGERWRRSVGLIM
Ga0209629_107601611	3300027984	Termite Gut	MVLKLGRFGQQIRNTWKVLKCGAGEGWRRSVGPIA
Ga0209629_107772522	3300027984	Termite Gut	MALYGAELGLFGQQIRNTWKVLKCGAGEGWRRSVGPIM
Ga0209629_107991841	3300027984	Termite Gut	MGRYFFVDVLKLGRFGQQIRNTWKVSKCGAGEGWRRSVGP

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F045832

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2209111004	Macrotermes natalensis queen gut microbiome	Host-Associated	Open in IMG/M
3300001544	Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1	Host-Associated	Open in IMG/M
3300002125	Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4	Host-Associated	Open in IMG/M
3300002175	Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5	Host-Associated	Open in IMG/M
3300002185	Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1	Host-Associated	Open in IMG/M
3300002238	Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1	Host-Associated	Open in IMG/M
3300002501	Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1	Host-Associated	Open in IMG/M
3300002508	Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1	Host-Associated	Open in IMG/M
3300002509	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4	Host-Associated	Open in IMG/M
3300006045	Neocapritermes taracua P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P3	Host-Associated	Open in IMG/M
3300006226	Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3	Host-Associated	Open in IMG/M
3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010369	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)	Host-Associated	Open in IMG/M
3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Host-Associated	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300027539	Nasutitermes corniger midgut segment microbial community from laboratory colony in Florida, USA - Nc150M (SPAdes)	Host-Associated	Open in IMG/M
3300027558	Cubitermes ugandensis crop segment gut microbial communities from Kakamega Forest, Kenya - Cu122C (SPAdes)	Host-Associated	Open in IMG/M
3300027670	Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes)	Host-Associated	Open in IMG/M
3300027864	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes)	Host-Associated	Open in IMG/M
3300027891	Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes)	Host-Associated	Open in IMG/M
3300027904	Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes)	Host-Associated	Open in IMG/M
3300027966	Nasutitermes corniger P5 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P5 (SPAdes)	Host-Associated	Open in IMG/M
3300027984	Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign