Metagenome / Metatranscriptome Family F045899

Basic Information
Family ID	F045899
Family Type	Metagenome / Metatranscriptome
Number of Sequences	152
Average Sequence Length	43 residues
Representative Sequence	ALLDGRLAIGWGDAVAVVVAVALFAGGRWVFLRLSPHFEDFV
Number of Associated Samples	140
Number of Associated Scaffolds	152

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.34 %
% of genes from short scaffolds (< 2000 bps)	93.42 %
Associated GOLD sequencing projects	131
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Most Common Taxonomy
Group	Bacteria (98.684 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (5.263 % of family members)
Environment Ontology (ENVO)	Unclassified (42.105 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (43.421 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 152 Family Scaffolds
PF00005	ABC_tran	78.29
PF14524	Wzt_C	5.26
PF08241	Methyltransf_11	1.32
PF13186	SPASM	0.66
PF01061	ABC2_membrane	0.66
PF00535	Glycos_transf_2	0.66
PF13180	PDZ_2	0.66
PF13091	PLDc_2	0.66
PF13432	TPR_16	0.66
PF00296	Bac_luciferase	0.66
PF13489	Methyltransf_23	0.66
PF03062	MBOAT	0.66
PF13353	Fer4_12	0.66
PF13649	Methyltransf_25	0.66

COG ID	Name	Functional Category	% Frequency in 152 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.66

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.68 %
Unclassified	root	N/A	1.32 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.68 %
Unclassified	root	N/A	1.32 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.68 %
Unclassified	root	N/A	1.32 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	88.16 %
Unclassified	root	N/A	1.32 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.66 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	73.03 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.95 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.32 %
Unclassified	root	N/A	1.32 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.66 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	69.08 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.32 %
Unclassified	root	N/A	1.32 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.66 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.66 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	68.42 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.32 %
Unclassified	root	N/A	1.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.66 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.66 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.66 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	68.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.32 %
Unclassified	root	N/A	1.32 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.66 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.66 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.66 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352024\|deeps__Contig_143590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	594	Open in IMG/M
3300000506\|Soeholt_1058388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1089	Open in IMG/M
3300001593\|JGI12635J15846_10391984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	840	Open in IMG/M
3300004091\|Ga0062387_101620543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	523	Open in IMG/M
3300004156\|Ga0062589_102526143	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300005179\|Ga0066684_10331363	All Organisms → cellular organisms → Bacteria	1016	Open in IMG/M
3300005328\|Ga0070676_11524022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300005329\|Ga0070683_101952585	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300005366\|Ga0070659_100374868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1198	Open in IMG/M
3300005367\|Ga0070667_101929258	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005451\|Ga0066681_10200348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1194	Open in IMG/M
3300005459\|Ga0068867_101742715	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300005518\|Ga0070699_100147716	All Organisms → cellular organisms → Bacteria	2077	Open in IMG/M
3300005544\|Ga0070686_101264367	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005544\|Ga0070686_101665470	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300005548\|Ga0070665_101924751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	597	Open in IMG/M
3300005553\|Ga0066695_10071794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2093	Open in IMG/M
3300005578\|Ga0068854_100969572	All Organisms → cellular organisms → Bacteria → Proteobacteria	751	Open in IMG/M
3300005598\|Ga0066706_10654630	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300005614\|Ga0068856_101960961	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300005616\|Ga0068852_100176416	All Organisms → cellular organisms → Bacteria → Proteobacteria	2007	Open in IMG/M
3300005617\|Ga0068859_101817597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	673	Open in IMG/M
3300005618\|Ga0068864_102175639	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300005764\|Ga0066903_102933594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	925	Open in IMG/M
3300005842\|Ga0068858_101713658	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300005844\|Ga0068862_100382111	All Organisms → cellular organisms → Bacteria → Proteobacteria	1314	Open in IMG/M
3300006175\|Ga0070712_101611826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	568	Open in IMG/M
3300006578\|Ga0074059_10548364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	662	Open in IMG/M
3300006755\|Ga0079222_11792260	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300006844\|Ga0075428_101016949	All Organisms → cellular organisms → Bacteria → Proteobacteria	877	Open in IMG/M
3300006904\|Ga0075424_102603635	All Organisms → cellular organisms → Bacteria → Proteobacteria	529	Open in IMG/M
3300006950\|Ga0075524_10375908	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300006954\|Ga0079219_10396425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	912	Open in IMG/M
3300009091\|Ga0102851_10057693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3159	Open in IMG/M
3300009101\|Ga0105247_10306056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1104	Open in IMG/M
3300009148\|Ga0105243_11162975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	783	Open in IMG/M
3300009177\|Ga0105248_13402399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	505	Open in IMG/M
3300009870\|Ga0131092_10249914	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1783	Open in IMG/M
3300010046\|Ga0126384_12074313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	545	Open in IMG/M
3300010301\|Ga0134070_10358728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	567	Open in IMG/M
3300010329\|Ga0134111_10555485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	510	Open in IMG/M
3300010343\|Ga0074044_10625553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	703	Open in IMG/M
3300010357\|Ga0116249_11179667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	688	Open in IMG/M
3300010361\|Ga0126378_10701520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1124	Open in IMG/M
3300010366\|Ga0126379_11053357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	919	Open in IMG/M
3300010376\|Ga0126381_100943680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1243	Open in IMG/M
3300010398\|Ga0126383_11308943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	815	Open in IMG/M
3300010399\|Ga0134127_12750122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	572	Open in IMG/M
3300012039\|Ga0137421_1252918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	510	Open in IMG/M
3300012045\|Ga0136623_10149557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1012	Open in IMG/M
3300012187\|Ga0136622_10268553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	716	Open in IMG/M
3300012208\|Ga0137376_10427212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1151	Open in IMG/M
3300012210\|Ga0137378_11372960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	621	Open in IMG/M
3300012285\|Ga0137370_10540329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	716	Open in IMG/M
3300012351\|Ga0137386_10733416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	710	Open in IMG/M
3300012353\|Ga0137367_11073181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	545	Open in IMG/M
3300012903\|Ga0157289_10431041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	503	Open in IMG/M
3300012929\|Ga0137404_12203968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300012930\|Ga0137407_11326025	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	684	Open in IMG/M
3300012957\|Ga0164303_10621458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	715	Open in IMG/M
3300012957\|Ga0164303_11229893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	550	Open in IMG/M
3300012972\|Ga0134077_10341258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	637	Open in IMG/M
3300012976\|Ga0134076_10581166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	521	Open in IMG/M
3300012988\|Ga0164306_10474143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	957	Open in IMG/M
3300013104\|Ga0157370_10239137	All Organisms → cellular organisms → Bacteria → Proteobacteria	1680	Open in IMG/M
3300013104\|Ga0157370_10857380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	825	Open in IMG/M
3300013105\|Ga0157369_10547241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1196	Open in IMG/M
3300013307\|Ga0157372_10733200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1149	Open in IMG/M
3300013308\|Ga0157375_12353205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	635	Open in IMG/M
3300013308\|Ga0157375_13159306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	549	Open in IMG/M
3300014056\|Ga0120125_1190290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	508	Open in IMG/M
3300014321\|Ga0075353_1192048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	540	Open in IMG/M
3300014326\|Ga0157380_11933973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	651	Open in IMG/M
3300015193\|Ga0167668_1088821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	588	Open in IMG/M
3300015371\|Ga0132258_10239898	All Organisms → cellular organisms → Bacteria → Proteobacteria	4423	Open in IMG/M
3300015372\|Ga0132256_101258029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	853	Open in IMG/M
3300015373\|Ga0132257_101789635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	789	Open in IMG/M
3300015373\|Ga0132257_102336327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	693	Open in IMG/M
3300015374\|Ga0132255_100926351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1304	Open in IMG/M
3300015374\|Ga0132255_103898940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	634	Open in IMG/M
3300016404\|Ga0182037_10992976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	731	Open in IMG/M
3300016445\|Ga0182038_10457548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1081	Open in IMG/M
3300017930\|Ga0187825_10427360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	512	Open in IMG/M
3300017959\|Ga0187779_10431616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	863	Open in IMG/M
3300017973\|Ga0187780_11068256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	589	Open in IMG/M
3300018060\|Ga0187765_11089866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	553	Open in IMG/M
3300018064\|Ga0187773_11087463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	530	Open in IMG/M
3300018076\|Ga0184609_10527857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	535	Open in IMG/M
3300018081\|Ga0184625_10097513	All Organisms → cellular organisms → Bacteria → Proteobacteria	1516	Open in IMG/M
3300020061\|Ga0193716_1200665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	759	Open in IMG/M
3300021080\|Ga0210382_10030029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2037	Open in IMG/M
3300021478\|Ga0210402_11221466	Not Available	679	Open in IMG/M
3300021560\|Ga0126371_10685160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1173	Open in IMG/M
3300024177\|Ga0247686_1010000	All Organisms → cellular organisms → Bacteria → Proteobacteria	1006	Open in IMG/M
3300025321\|Ga0207656_10288974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	810	Open in IMG/M
3300025898\|Ga0207692_10468252	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	796	Open in IMG/M
3300025899\|Ga0207642_10988773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	541	Open in IMG/M
3300025906\|Ga0207699_11160101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	572	Open in IMG/M
3300025913\|Ga0207695_11595440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	533	Open in IMG/M
3300025921\|Ga0207652_10019808	All Organisms → cellular organisms → Bacteria → Proteobacteria	5538	Open in IMG/M
3300025924\|Ga0207694_10754135	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300025924\|Ga0207694_11747240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	523	Open in IMG/M
3300025931\|Ga0207644_10108667	All Organisms → cellular organisms → Bacteria → Proteobacteria	2094	Open in IMG/M
3300025931\|Ga0207644_10849062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	764	Open in IMG/M
3300025938\|Ga0207704_11662887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	549	Open in IMG/M
3300025944\|Ga0207661_10440491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1186	Open in IMG/M
3300025972\|Ga0207668_10521529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1025	Open in IMG/M
3300025981\|Ga0207640_11651122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	578	Open in IMG/M
3300026023\|Ga0207677_10555137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1002	Open in IMG/M
3300026023\|Ga0207677_10792767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	848	Open in IMG/M
3300026035\|Ga0207703_11608005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	625	Open in IMG/M
3300026088\|Ga0207641_10730837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	976	Open in IMG/M
3300026089\|Ga0207648_11559659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	621	Open in IMG/M
3300026095\|Ga0207676_10033799	All Organisms → cellular organisms → Bacteria → Proteobacteria	3867	Open in IMG/M
3300026116\|Ga0207674_12220017	All Organisms → cellular organisms → Bacteria → Acidobacteria	512	Open in IMG/M
3300026142\|Ga0207698_11773040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	633	Open in IMG/M
3300026310\|Ga0209239_1311578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	545	Open in IMG/M
3300026330\|Ga0209473_1103605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1188	Open in IMG/M
3300026548\|Ga0209161_10270774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	860	Open in IMG/M
3300027614\|Ga0209970_1024953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1023	Open in IMG/M
3300027979\|Ga0209705_10047217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	2380	Open in IMG/M
3300028381\|Ga0268264_11875838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	609	Open in IMG/M
3300028743\|Ga0302262_10124448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	884	Open in IMG/M
3300030002\|Ga0311350_11332571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	639	Open in IMG/M
3300031231\|Ga0170824_111385232	All Organisms → cellular organisms → Bacteria → Proteobacteria	870	Open in IMG/M
3300031713\|Ga0318496_10417501	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	742	Open in IMG/M
3300031824\|Ga0307413_11330794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	629	Open in IMG/M
3300031834\|Ga0315290_10787756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	814	Open in IMG/M
3300031834\|Ga0315290_10833341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	787	Open in IMG/M
3300031894\|Ga0318522_10118367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	989	Open in IMG/M
3300031912\|Ga0306921_11929200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	631	Open in IMG/M
3300031938\|Ga0308175_102060579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	640	Open in IMG/M
3300031939\|Ga0308174_11191981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	649	Open in IMG/M
3300032005\|Ga0307411_11915435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	552	Open in IMG/M
3300032143\|Ga0315292_10267520	All Organisms → cellular organisms → Bacteria → Proteobacteria	1417	Open in IMG/M
3300032173\|Ga0315268_12324092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	550	Open in IMG/M
3300032180\|Ga0307471_104053805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	517	Open in IMG/M
3300032205\|Ga0307472_102363151	Not Available	539	Open in IMG/M
3300032256\|Ga0315271_10602562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	939	Open in IMG/M
3300032256\|Ga0315271_11639383	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	553	Open in IMG/M
3300032401\|Ga0315275_12180880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	580	Open in IMG/M
3300032421\|Ga0310812_10258722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	767	Open in IMG/M
3300033412\|Ga0310810_11240123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	597	Open in IMG/M
3300033418\|Ga0316625_100957936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	756	Open in IMG/M
3300033418\|Ga0316625_102254972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	544	Open in IMG/M
3300033419\|Ga0316601_100665105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1019	Open in IMG/M
3300033475\|Ga0310811_11400776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	538	Open in IMG/M
3300033487\|Ga0316630_11554325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	598	Open in IMG/M
3300033513\|Ga0316628_102978826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	620	Open in IMG/M
3300033803\|Ga0314862_0014822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1454	Open in IMG/M
3300034129\|Ga0370493_0068267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1114	Open in IMG/M
3300034177\|Ga0364932_0333277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	573	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.82%
Host-Associated	Host-Associated	34.21%
Engineered	Engineered	1.97%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.63%
Plants	Host-Associated → Plants	34.21%
Aquatic	Environmental → Aquatic	11.18%
Wastewater	Engineered → Wastewater	1.97%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.45%
Freshwater	Environmental → Aquatic → Freshwater	9.21%
Sediment	Environmental → Aquatic → Sediment	1.97%
Peat	Environmental → Terrestrial → Peat	1.32%
Floodplain	Environmental → Terrestrial → Floodplain	0.66%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.66%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.66%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.66%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.87%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.18%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.55%
Loam	Environmental → Terrestrial → Soil → Loam	7.24%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.26%
Lake	Environmental → Aquatic → Freshwater → Lake	4.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.29%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.97%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.97%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.32%
Ice	Environmental → Aquatic → Freshwater → Ice	1.32%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.66%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.66%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.66%
Dissolved Organics (Anaerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic)	0.66%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.18%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.55%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.26%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.97%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.97%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.32%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.32%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.32%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.32%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.32%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.66%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.66%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.66%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.66%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.66%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.66%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge	0.66%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.26%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.26%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.61%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.95%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.29%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.29%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.63%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.63%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.63%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.97%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.97%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.32%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.32%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.32%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.32%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.32%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.32%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.66%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.66%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.66%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.66%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.66%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.66%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.66%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.66%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.66%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.66%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.66%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.66%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.66%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.66%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.66%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.66%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.66%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.66%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.66%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.66%
Anaerobic Digester	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester	0.66%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352024	Bare-fallow DEEP SOIL	Environmental	Open in IMG/M
3300000506	Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge	Engineered	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006950	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010357	AD_USSTca	Engineered	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300012039	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2	Environmental	Open in IMG/M
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental	Open in IMG/M
3300012187	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental	Open in IMG/M
3300014321	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015193	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300020061	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024177	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental	Open in IMG/M
3300034177	Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F045899

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_02627030	2199352024	Soil	LTPTWNDAAAAVTAVLLLLAGRWLFRRLSPHFEDFI
Soeholt_10583881	3300000506	Anaerobic Digester	IAPEAGDLAALVVALALFAAGRWTFRRLSPHFEDFV*
JGI12635J15846_103919841	3300001593	Forest Soil	SLALHWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV*
Ga0062387_1016205432	3300004091	Bog Forest Soil	ALLDGRLGLEWGDAVAAGVAVALFAAGRWMFRRLSPHFEDFV*
Ga0062589_1025261431	3300004156	Soil	VGRLREGFLEGRMAPQWSDAVALVVAVLLFLGGRWVFRRLSPHFEDFV*
Ga0066684_103313632	3300005179	Soil	GRLRDALLDGRLELYWGDGLALAVAIAVFCAGRWIFRRLSPHFEDFV*
Ga0070676_115240221	3300005328	Miscanthus Rhizosphere	RMRDALLEGHLALQWGDALAAMVALALFAAGRALFVRLSPHFEDFVG*
Ga0070683_1019525851	3300005329	Corn Rhizosphere	ARLREALLEGRIAFHASDAVALVVALLLLAGGHWVFRRLSPHFEDFV*
Ga0070659_1003748681	3300005366	Corn Rhizosphere	DGRLALEPSDAIALVVAVLIFLAGRWMFRRLSPYFEDFL*
Ga0070667_1019292582	3300005367	Switchgrass Rhizosphere	EGRLALQWGDAIAVAVAVALYFGGLWVFRRLSPHFEDFV*
Ga0066681_102003482	3300005451	Soil	WIVGRLRDALLDGRLAIDWTDGIALGVALLLFFAGRAVFRRLSPHFEDFV*
Ga0068867_1017427152	3300005459	Miscanthus Rhizosphere	REALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV*
Ga0070699_1001477161	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	RLREALLDGRIVFRWSDLLALIVALALFAGGRWVFRRLSPHFEDFV*
Ga0070686_1012643671	3300005544	Switchgrass Rhizosphere	ALLDGRLALHWGDAVALVAALLLFFAGRWVFRRLSPHFEDFL*
Ga0070686_1016654702	3300005544	Switchgrass Rhizosphere	LDGRLALEWGDAVAVVVALAIFAGGQWVFRRLSPQFEDFV*
Ga0070665_1019247511	3300005548	Switchgrass Rhizosphere	ALLDGKIAFEWQDAVALAVSLALFALGRAVFQRLSPHFEDFV*
Ga0066695_100717943	3300005553	Soil	DGKLTLDWGDAVAVVVAVAIFALGRWVFLRLSPYFEDFV*
Ga0068854_1009695721	3300005578	Corn Rhizosphere	PFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV*
Ga0066706_106546301	3300005598	Soil	LRDALLDGSLALHWGDAVAVIVALALFVGGRWVFLRLSPHFEDFV*
Ga0068856_1019609611	3300005614	Corn Rhizosphere	ARLRESLLDGQLRLHASDAVALAVALLLFAGGRWVFRRLSPHFEDFV*
Ga0068852_1001764161	3300005616	Corn Rhizosphere	LIDGRLGFEWGDAIAAIGAIALYLAGRWVFRRLSPHFEDFV*
Ga0068859_1018175972	3300005617	Switchgrass Rhizosphere	RLAPEPGDFVALAVAVALFVAGRWMFRRLSPYFEDFV*
Ga0068864_1021756391	3300005618	Switchgrass Rhizosphere	GRLALEWGDAVAAIVAVALYLGGLWVFRRLSPHFEDFV*
Ga0066903_1029335941	3300005764	Tropical Forest Soil	RDALLEGRLELMPGDAIAVLAALALFFAGRVVFRRLSPSFEDFV*
Ga0068858_1017136581	3300005842	Switchgrass Rhizosphere	GRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV*
Ga0068862_1003821111	3300005844	Switchgrass Rhizosphere	LEGNLAARPGDAVALAVAIALFFGGRWVFRRLSPHFEDFL*
Ga0070712_1016118262	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VVARLREALLDGQLGVHPSDVVAVAVALLLFAGGRWVFRRLSPHFEDFV*
Ga0074059_105483641	3300006578	Soil	CLLDGHLALEWEDAIALAVALAVFAAGCWVFRRLTPQFEDFV*
Ga0079222_117922602	3300006755	Agricultural Soil	VSRLRDAFIEGRLAPSASDAVALIIAVIVFLVGRWVFRRLSPHFEDFV*
Ga0075428_1010169492	3300006844	Populus Rhizosphere	ALQWSDALAALVAVALFVAGLTVFRRLSPHFEDFVG*
Ga0075424_1026036352	3300006904	Populus Rhizosphere	LVGRLRDALLDGQLALRWSDAVATLVALAVFFAGRAVFQRLSPHFEDFVG*
Ga0075524_103759082	3300006950	Arctic Peat Soil	VLEWSDGLALLVAIIVFVGGRWMFRRLSPHFEDFI*
Ga0079219_103964251	3300006954	Agricultural Soil	LALDWSDAAALAIALLLLVAGRAVFRRLSPHFEDFV*
Ga0102851_100576931	3300009091	Freshwater Wetlands	LEGRIAPQWSDAVAVAVALALFAGGLWMFRRLSPYFEDFV*
Ga0105247_103060561	3300009101	Switchgrass Rhizosphere	VAAIPFGWLVGRLRDALLDGHLALQPGDAVAALIAAAIFAAGLTVFRRLSPHFEDFVG*
Ga0105243_111629753	3300009148	Miscanthus Rhizosphere	EGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV*
Ga0105248_134023992	3300009177	Switchgrass Rhizosphere	PWVAFNPFGWLVTRMRDALLDGHLALQGGDALAALVAVAIFAAGRALFLRLSPHFEDLVG
Ga0131092_102499143	3300009870	Activated Sludge	LAFDWSDAVALAVALALYFGGRWVFRRLSPHFEDFI*
Ga0126384_120743132	3300010046	Tropical Forest Soil	MRDALLEGRLALSWGDGVAVLVAAALFAGGRWVFLRLSPHFEDFV*
Ga0134070_103587282	3300010301	Grasslands Soil	RLAIAWGDVVAVVVAVALFAGGRWVFLRLSPHFEDFV*
Ga0134111_105554852	3300010329	Grasslands Soil	ERLRDALLEGRLAIGWGDAVAVVVAVALFAGGRGVCLRLSPHFEEFV*
Ga0074044_106255532	3300010343	Bog Forest Soil	GRLRDALLDGRLALHWADAVAVVVALGLLAGGRWIFLRLSPHFEDFV*
Ga0116249_111796671	3300010357	Anaerobic Digestor Sludge	LEGRISFEVGDLAALAVALALFAAGRWMFVRLSPHFEDFV*
Ga0126378_107015202	3300010361	Tropical Forest Soil	AANPFGWLVERLRDALLEGRLELMRGDAIAVLAALALFFAGRVVFRRLSPSFEDFV*
Ga0126379_110533572	3300010366	Tropical Forest Soil	DGRLDVGAGDALAVIVALALFAGGRWIFLRLSPHFEDFV*
Ga0126381_1009436802	3300010376	Tropical Forest Soil	DGRVAARVGDAVALAVALALFFAGRWVFRRLSPYFEDFV*
Ga0126383_113089432	3300010398	Tropical Forest Soil	LSIGASDAVAVALAVALFFGGRWVFRRLSPTFEDFL*
Ga0134127_127501221	3300010399	Terrestrial Soil	LIDGRLAFTAGDALALAIALVLFVAGRWVFRRLSPHFEDFV*
Ga0137421_12529182	3300012039	Soil	LREALLEGRLAPRWGDAVALAAALALYFAGRWVFRRLSPHFEDFL*
Ga0136623_101495572	3300012045	Polar Desert Sand	LIGRLRDALLEGKLALAWSDAVAVIAAAAIFFAGRWVFRRLSPQFEDFV*
Ga0136622_102685532	3300012187	Polar Desert Sand	LRDALLDGKLALVWSDAVAVIAAVAIFFAGRWVFRRLSPQFEDFV*
Ga0137376_104272122	3300012208	Vadose Zone Soil	LVDRLRDALLDGSLALHWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV*
Ga0137378_113729601	3300012210	Vadose Zone Soil	LAIGWGDAVAVGAAVALFVGGRWVFLRLSPHFEDFV*
Ga0137370_105403292	3300012285	Vadose Zone Soil	GYLVDRLRDALLDGSLALHWGDAVAVIVALALFVGGRWVFLRLSPHFEDFV*
Ga0137386_107334161	3300012351	Vadose Zone Soil	GRLAVHWGDAVAVVVALALFAGGRWIFLRLSPHFEDFV*
Ga0137367_110731812	3300012353	Vadose Zone Soil	ALHWGDAVALTAALAIFFAGRWVFRRLSPHFEDFV*
Ga0157289_104310411	3300012903	Soil	RDALIDGRIALQWSDAVALGVALALFFGGRWVFARLSPHFEDFL*
Ga0137404_122039681	3300012929	Vadose Zone Soil	NPFSWLVDRLREALLDGRMTFEWTDGVALLAALAVFAAGRAMFVRLSPHFEDFV*
Ga0137407_113260252	3300012930	Vadose Zone Soil	AGLLDGRLAFELGDLAAALVAVALFFGGRWVFRRLSPTFEDFL*
Ga0164303_106214583	3300012957	Soil	DGLLEGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV*
Ga0164303_112298932	3300012957	Soil	LDGRLGLVWGDALAVVVALALFAAGRWVFLRLSPHFEDFV*
Ga0134077_103412582	3300012972	Grasslands Soil	ALLDGRLAIGWGDAVAVVVAVALFAGGRWVFLRLSPHFEDFV*
Ga0134076_105811661	3300012976	Grasslands Soil	RLRDSLLDGKLALQWSDAIALIVALLIFAAGRAVFRRLSPHFEDFI*
Ga0164306_104741432	3300012988	Soil	GRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV*
Ga0157370_102391373	3300013104	Corn Rhizosphere	APHWTDVIAMAVALLLFAGGRFVFRRLSPHFEDFV*
Ga0157370_108573801	3300013104	Corn Rhizosphere	AANPFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV*
Ga0157369_105472412	3300013105	Corn Rhizosphere	AFVAANPFGWIVARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV*
Ga0157372_107332001	3300013307	Corn Rhizosphere	LEWSDALALAVALALFAGGRWVFRRLSPHFEDFV*
Ga0157375_123532052	3300013308	Miscanthus Rhizosphere	LVGRLRDALLEGKLLVQWDDALAVVVALVLFHAGRWVFRRLSPHFEDFV*
Ga0157375_131593061	3300013308	Miscanthus Rhizosphere	LLEGRLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV*
Ga0120125_11902902	3300014056	Permafrost	RAVSAFVVALVVALALFVGGRWLFRRLSPHFEDFV*
Ga0075353_11920481	3300014321	Natural And Restored Wetlands	NPFSWLVDRLRDALIDGRVALHWGDALALVVALALFGAGRWMFRRLSRHFEDFV*
Ga0157380_119339732	3300014326	Switchgrass Rhizosphere	DGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV*
Ga0167668_10888211	3300015193	Glacier Forefield Soil	RLRDALLDGRLALQWGDAMAVIVALALFVAGRWVFLRLSPHFEDFV*
Ga0132258_102398984	3300015371	Arabidopsis Rhizosphere	RLSLQPSDALAVAISIALFVAGRWVFRRLSPHFEDFV*
Ga0132256_1012580291	3300015372	Arabidopsis Rhizosphere	RLRDALLDGRLGLAWSDALAVVVALAMFAAGRWVFLRLSPHFEDFV*
Ga0132257_1017896352	3300015373	Arabidopsis Rhizosphere	VTRLREALLDGNLTLRSGDVLALFIACAIFVAGRWVFMRLSPHFEDFV*
Ga0132257_1023363272	3300015373	Arabidopsis Rhizosphere	FGWLVGRLRDGLLDGNVALQGSDAVALLAAVALFVAGRAFFRRLSPHFEDFV*
Ga0132255_1009263512	3300015374	Arabidopsis Rhizosphere	RDALLEGRLALGWGDAVAVVVAAGLFLGGRWVFLRLSPHFEDFV*
Ga0132255_1038989401	3300015374	Arabidopsis Rhizosphere	GNVAPRAGDAVALAVALAVFFGGRWVFRRLSPHFEDFL*
Ga0182037_109929762	3300016404	Soil	LSIGVGDLAAAVVVVALFFGGRWVFRRLSPTFEDFL
Ga0182038_104575482	3300016445	Soil	GRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV
Ga0187825_104273601	3300017930	Freshwater Sediment	RLREALLEGRLAVHPTDAIALAVALLLFAGGRWVFRRLSPHFEDFV
Ga0187779_104316162	3300017959	Tropical Peatland	LLDGRLAVSWRDAVALAVALAIFAGGRWMFLRLSPHFEDFV
Ga0187780_110682562	3300017973	Tropical Peatland	ALLEGRLALGWGDAVALAVALAVFAAGRWMFLRLSPHFEDFA
Ga0187765_110898661	3300018060	Tropical Peatland	GRLAVHGSDALAVLAAVLIFAGGRWIFLRLSPHFEDFV
Ga0187773_110874632	3300018064	Tropical Peatland	ANPFGYLVDRLRDALLDGRLAIHGSDAVAVLAAVLIFAGGRWVFLRLSPHFDDFV
Ga0184609_105278572	3300018076	Groundwater Sediment	AVYWGDAIAVVVAIALFAGGRWIFLRLSPHFEDFV
Ga0184625_100975133	3300018081	Groundwater Sediment	RDALLDGRLAVHWGDAVAVVVAIALFAGGRWIFLRLSPHFEDFV
Ga0193716_12006652	3300020061	Soil	RDALLDGRLGFTGGDLVALLVALLLFAGGRWVFRRLSPHFEDFV
Ga0210382_100300294	3300021080	Groundwater Sediment	ALQWGDAVAVIVALALFVAGRWVFLRLSPHFEDFV
Ga0210402_112214662	3300021478	Soil	VDRLRDALLNGSLALHWGDAVALIVALALFVAGRWVFLRLSPHFEDFV
Ga0126371_106851601	3300021560	Tropical Forest Soil	FGYLVDRLRDALLEGRLAVEWGDAVAVVVALSIFAAGRWMFLRLSPHFEDFV
Ga0247686_10100002	3300024177	Soil	PLVPGDALAALGCVAVFAGGLWVFQRLSPHFEDFL
Ga0207656_102889742	3300025321	Corn Rhizosphere	RLRDGLLEGRVALRWSDAVALVVAVLLFFGGRWVFRRLSPHFEDFV
Ga0207692_104682522	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	NPFNWVVARLREALLDGQLGVHPSDVVAVAVALLLFAGGRWVFRRLSPHFEDFV
Ga0207642_109887732	3300025899	Miscanthus Rhizosphere	IALQWSDAVALCVALALFFGGRWVFARLSPHFEDFL
Ga0207699_111601012	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	GRLGLVQGDAAAIVVALALFAAGRWVFLRLSPHFEDFV
Ga0207695_115954401	3300025913	Corn Rhizosphere	LEGRIAFHASDAVALVVALLLLAGGHWVFRRLSPHFEDFV
Ga0207652_100198081	3300025921	Corn Rhizosphere	DGRLALEPADAVALAGALVAFVGGRWMFRRLSPHFEDFL
Ga0207694_107541352	3300025924	Corn Rhizosphere	ARLREALLDGRLAVHASDAIALVVALLLFTGGRWVFRRLSPHFEDFV
Ga0207694_117472402	3300025924	Corn Rhizosphere	LVGRLRDALLDGRLGLAWSDALAVVVALAMFAAGRWVFLRLSPHFEDFV
Ga0207644_101086671	3300025931	Switchgrass Rhizosphere	LGLAWSDALAVIVALSMFAAGRWVFLRLSPHFEDFV
Ga0207644_108490621	3300025931	Switchgrass Rhizosphere	LREALLDGGLALHWGDAVALVAALLLFFAGRWVFRRLSPHFEDFL
Ga0207704_116628872	3300025938	Miscanthus Rhizosphere	ALEWGDAIALVVAVAVYFGGRWVFRRLSPHFEDFV
Ga0207661_104404912	3300025944	Corn Rhizosphere	GRLRDALLEGRLELRPSDALATAIAVLLFIAGRWVFRRLSPHFEDFV
Ga0207668_105215291	3300025972	Switchgrass Rhizosphere	GRLALEWGDAVAVVVALAIFAGGQWVFRRLSPQFEDFV
Ga0207640_116511221	3300025981	Corn Rhizosphere	DGKLALDWSDAAALAIALLVLVAGRAVFRRLSPHFEDFV
Ga0207677_105551371	3300026023	Miscanthus Rhizosphere	LEGRLELRPSDALATAIAVLLFIAGRWVFRRLSPHFEDFV
Ga0207677_107927672	3300026023	Miscanthus Rhizosphere	VGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV
Ga0207703_116080051	3300026035	Switchgrass Rhizosphere	LVGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV
Ga0207641_107308371	3300026088	Switchgrass Rhizosphere	RLGLEWGDAIAVAVAVALYFGGRWVFRRLSPHFEDFV
Ga0207648_115596591	3300026089	Miscanthus Rhizosphere	FSWLVGRLREALIDGRLALEWGDGVAAVVAIALYLGGRWVFRRLSPHFEDFV
Ga0207676_100337991	3300026095	Switchgrass Rhizosphere	EALLEGRLAVHLSDGIAVVVAVALLLAGLAIFRRLSPHFEDFV
Ga0207674_122200171	3300026116	Corn Rhizosphere	GFEAGDLLALLVVAALFFGGRWVFRRLSPTFEDFL
Ga0207698_117730402	3300026142	Corn Rhizosphere	LVGRLRDALLDGRLAVHLDDAIAVVVAALMLAGGRWMFRRLSPHFEDFL
Ga0209239_13115781	3300026310	Grasslands Soil	SLAVHWGDAVAVVVALALFVAGRWVFLRLSPHFEDFV
Ga0209473_11036052	3300026330	Soil	RLRDALLDGRLALAWGDAIAVLAAFALFTGGRWVFLRLSPHFEDFV
Ga0209161_102707741	3300026548	Soil	GWLVDRLRSALLDGNLTLEWSDGVAVIVAVMLFVTGRAVFARLSPHFEDFV
Ga0209970_10249532	3300027614	Arabidopsis Thaliana Rhizosphere	FLEGRIAPRWSDAVALVVAVLLFFGGRWVFRRLSPHFEDFV
Ga0209705_100472171	3300027979	Freshwater Sediment	PFGWLVERMRDALIAGRPALEWGDAVAVLVAAALFAAGLAVFRRLSPHFEDFV
Ga0268264_118758381	3300028381	Switchgrass Rhizosphere	ANPFGWLVSRMRDALLEGRLALQWGDALAALVALALFAAGRALFLRLSPHFEDFVG
Ga0302262_101244482	3300028743	Fen	DGRLALQWGDAVALAVAAAMFLAGRWIFRRLSPNFEDFV
Ga0311350_113325711	3300030002	Fen	GRLAPHWGDAVAVAAALALFFAGRWVFRRLSPHFEDFL
Ga0170824_1113852322	3300031231	Forest Soil	VRMRDALLDGNLEPRWQDFAALVAALALWAAGRWIFLRLSPHFEDFI
Ga0318496_104175011	3300031713	Soil	ALLEGRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV
Ga0307413_113307941	3300031824	Rhizosphere	GMLAFRWSDVVALLCAGVLFFAGRWVFRRLSPHFEDFV
Ga0315290_107877562	3300031834	Sediment	APQWGDVVALAAVLALFFAGRWVFRRLSPHFEDFL
Ga0315290_108333411	3300031834	Sediment	LLDGKLALQWGDAVALGVALALFLGGRWVFRRLSPHFEDFL
Ga0318522_101183672	3300031894	Soil	FGWLVERLRDALLEGRLELMPGDGIAVLVALALFFAGRVVFRRLSPHFEDFV
Ga0306921_119292001	3300031912	Soil	LVERMRDALLDGHLALSWGDGVAVLVAAALFAGGRWIFMRLSPHFEDFV
Ga0308175_1020605791	3300031938	Soil	RLAVQLDDLVAVVVAALLLAGGRWMFRRLSPHFEDFL
Ga0308174_111919811	3300031939	Soil	GRLRDALLDGRLSLQPSDAIALVVAVALFFIGRWVFRRLSPHFEDFV
Ga0307411_119154352	3300032005	Rhizosphere	GLLEGRLALRVSDAVALGVALLLLVGGRWVFRRLSPYFEDFV
Ga0315292_102675201	3300032143	Sediment	EGVLVPRWSDAVALVVALALYFAGRWVFRRLAPHFEDFL
Ga0315268_123240921	3300032173	Sediment	VERMRDSLLDGSLALQWGDALALAVALALFAGGRWVFRRLSRHFEDFV
Ga0307471_1040538051	3300032180	Hardwood Forest Soil	GRLAVGWEDAVAVLVAVALFAGGRWMFLRLSPHFEDFV
Ga0307472_1023631511	3300032205	Hardwood Forest Soil	GRLRDALLDGKVGLHWDDGVAVIVAVALFIAGGAVFRRLSPHFEDFV
Ga0315271_106025622	3300032256	Sediment	RMRDALLDGSVAPQWGDAAAVLVAAALFGAGLWVFRRLSPNFEDFV
Ga0315271_116393832	3300032256	Sediment	DGKLAPQWGDAVALAAALALFFAGRWVFRRLSPQFEDFV
Ga0315275_121808801	3300032401	Sediment	LAPRAGDALALAVALALFFAGRWVFRRLSPQFEDFV
Ga0310812_102587222	3300032421	Soil	MRDALLDGHLALVPADALALVVALLVFLAGRWMFRRLSPHFEDFL
Ga0310810_112401232	3300033412	Soil	WAVTRLRDALLEGRLAPHWTDVIAMAVALLLFAGGRFVFRRLSPHFEDFV
Ga0316625_1009579362	3300033418	Soil	DRLRAGLLDGRLALGWGDALVCAVAAALFFGGRWVFRRLSPHFEDFL
Ga0316625_1022549721	3300033418	Soil	ALLDGQVLPRWSDAVALGVAVVLFVAGRWVFRRLSPHFEDFV
Ga0316601_1006651052	3300033419	Soil	DGKLALEWTDAVAVAVALALFMAGRWVFRRLSPHFEDFV
Ga0310811_114007761	3300033475	Soil	VVGRLRDALLDGRLTLQPTDALALAVAIALFVGGRWVFRRLSPHFEDFV
Ga0316630_115543252	3300033487	Soil	GRLGLHWDDAAAAAVAIAVFAAGRAVFRRLSPHFEDFV
Ga0316628_1029788261	3300033513	Soil	RMREALIEGRLGLQWSDAAAVLVAVAMFAAGRAVFLRLSPHFEDFV
Ga0314862_0014822_1315_1452	3300033803	Peatland	LRDALLDGKLAVGWGDALAVAAALALFAGGRWVFLRLSPHFEDFV
Ga0370493_0068267_1001_1114	3300034129	Untreated Peat Soil	KLAVHAGDALAIVVALALYAGGRWVFLRLSPHFEDFV
Ga0364932_0333277_445_573	3300034177	Sediment	ALLDGRLAVYWGDAIAVVVAIALFAGGRWIFLRLSPHFEDFV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign