NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046404

Metagenome / Metatranscriptome Family F046404

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046404
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 44 residues
Representative Sequence MNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Number of Associated Samples 135
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 50.34 %
% of genes near scaffold ends (potentially truncated) 50.99 %
% of genes from short scaffolds (< 2000 bps) 91.39 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.377 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(21.192 % of family members)
Environment Ontology (ENVO) Unclassified
(44.371 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.497 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.34%    β-sheet: 0.00%    Coil/Unstructured: 43.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF00510COX3 4.64
PF00115COX1 4.64
PF00033Cytochrome_B 3.97
PF00032Cytochrom_B_C 2.65
PF13631Cytochrom_B_N_2 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 6.62
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 4.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.04 %
UnclassifiedrootN/A5.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10104439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae920Open in IMG/M
3300000203|TB18AUG2009E_c035789Not Available513Open in IMG/M
3300000371|P_1C_Liq_3_UnCtyDRAFT_1018951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae517Open in IMG/M
3300001353|JGI20159J14440_10195448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae559Open in IMG/M
3300001820|ACM5_105940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae905Open in IMG/M
3300002370|B570J29631_107080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae583Open in IMG/M
3300003311|LKpool_1006110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2401Open in IMG/M
3300003539|FS891DNA_10274534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae617Open in IMG/M
3300003540|FS896DNA_10401696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae557Open in IMG/M
3300003754|Ga0005853_1025693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae720Open in IMG/M
3300004786|Ga0007753_1496805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae511Open in IMG/M
3300004794|Ga0007751_10170287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1439Open in IMG/M
3300006103|Ga0007813_1109338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae527Open in IMG/M
3300006357|Ga0075502_1173921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae665Open in IMG/M
3300006384|Ga0075516_1040886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae806Open in IMG/M
3300006393|Ga0075517_1045058All Organisms → cellular organisms → Eukaryota → Sar1721Open in IMG/M
3300006396|Ga0075493_1065139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae701Open in IMG/M
3300006405|Ga0075510_11105966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae567Open in IMG/M
3300006803|Ga0075467_10337791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae794Open in IMG/M
3300007304|Ga0102689_1118533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1325Open in IMG/M
3300007513|Ga0105019_1152138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1201Open in IMG/M
3300007519|Ga0105055_10115355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2779Open in IMG/M
3300007555|Ga0102817_1061568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae819Open in IMG/M
3300007692|Ga0102823_1168980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae582Open in IMG/M
3300007958|Ga0105743_1038512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae544Open in IMG/M
3300007972|Ga0105745_1211762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae613Open in IMG/M
3300009023|Ga0103928_10372816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae550Open in IMG/M
3300009028|Ga0103708_100039810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae990Open in IMG/M
3300009071|Ga0115566_10606615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum612Open in IMG/M
3300009149|Ga0114918_10251392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1005Open in IMG/M
3300009165|Ga0105102_10923831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae505Open in IMG/M
3300009221|Ga0103849_1058367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae551Open in IMG/M
3300009279|Ga0103880_10005459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1042Open in IMG/M
3300009425|Ga0114997_10158784All Organisms → Viruses → Predicted Viral1330Open in IMG/M
3300009432|Ga0115005_10515304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae954Open in IMG/M
3300009432|Ga0115005_10940453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae698Open in IMG/M
3300009432|Ga0115005_11558286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae542Open in IMG/M
3300009436|Ga0115008_10152534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1680Open in IMG/M
3300009436|Ga0115008_10424613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae945Open in IMG/M
3300009441|Ga0115007_11352028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae500Open in IMG/M
3300009512|Ga0115003_10217862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1143Open in IMG/M
3300009529|Ga0114919_10497250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae841Open in IMG/M
3300009544|Ga0115006_11049202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae724Open in IMG/M
3300009550|Ga0115013_10718791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae680Open in IMG/M
3300009550|Ga0115013_10728823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae676Open in IMG/M
3300009550|Ga0115013_10958717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae605Open in IMG/M
3300009563|Ga0130030_1031838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae811Open in IMG/M
3300009593|Ga0115011_11710498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae564Open in IMG/M
3300009606|Ga0115102_10233726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae529Open in IMG/M
3300009606|Ga0115102_10991078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1677Open in IMG/M
3300009608|Ga0115100_10102343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae3940Open in IMG/M
3300009608|Ga0115100_10578028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae674Open in IMG/M
3300009705|Ga0115000_10522154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae745Open in IMG/M
3300009747|Ga0123363_1041509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae599Open in IMG/M
3300009756|Ga0123366_1123080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae561Open in IMG/M
3300009790|Ga0115012_11182859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae642Open in IMG/M
3300009908|Ga0132233_104289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae501Open in IMG/M
3300010031|Ga0126337_10539337Not Available595Open in IMG/M
3300010160|Ga0114967_10158821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1249Open in IMG/M
3300010306|Ga0129322_1103472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae511Open in IMG/M
3300010316|Ga0136655_1102550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae864Open in IMG/M
3300010394|Ga0126341_1002313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2563Open in IMG/M
3300012524|Ga0129331_1422098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae700Open in IMG/M
3300012732|Ga0157549_1237053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae672Open in IMG/M
3300012920|Ga0160423_11145987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae519Open in IMG/M
3300012953|Ga0163179_10695570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum862Open in IMG/M
3300012954|Ga0163111_10237310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1593Open in IMG/M
3300013948|Ga0116699_1000001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae20094Open in IMG/M
3300017311|Ga0186119_1031374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae744Open in IMG/M
3300017481|Ga0186654_1041303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae608Open in IMG/M
3300017949|Ga0181584_10255174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1135Open in IMG/M
3300017990|Ga0180436_10166117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1598Open in IMG/M
3300018526|Ga0193100_100954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae925Open in IMG/M
3300018599|Ga0188834_1012731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae871Open in IMG/M
3300018711|Ga0193069_1038166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae576Open in IMG/M
3300018723|Ga0193038_1033457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae787Open in IMG/M
3300018791|Ga0192950_1027169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae792Open in IMG/M
3300018844|Ga0193312_1011236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae987Open in IMG/M
3300018844|Ga0193312_1028356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae748Open in IMG/M
3300018951|Ga0193128_10135565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae595Open in IMG/M
3300018969|Ga0193143_10168385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae642Open in IMG/M
3300019000|Ga0192953_10121490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae643Open in IMG/M
3300019007|Ga0193196_10306701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae681Open in IMG/M
3300019011|Ga0192926_10498824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae501Open in IMG/M
3300019012|Ga0193043_10212934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae760Open in IMG/M
3300019022|Ga0192951_10265934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae643Open in IMG/M
3300019037|Ga0192886_10183421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae665Open in IMG/M
3300019045|Ga0193336_10187944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae815Open in IMG/M
3300019048|Ga0192981_10268235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae647Open in IMG/M
3300019049|Ga0193082_10694201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae574Open in IMG/M
3300019049|Ga0193082_10818654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae524Open in IMG/M
3300019055|Ga0193208_10150453Not Available1118Open in IMG/M
3300019100|Ga0193045_1059387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae603Open in IMG/M
3300019150|Ga0194244_10022745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae855Open in IMG/M
3300019738|Ga0193994_1017363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae870Open in IMG/M
3300020165|Ga0206125_10173573All Organisms → cellular organisms → Eukaryota → Sar853Open in IMG/M
3300020175|Ga0206124_10380325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae527Open in IMG/M
3300020503|Ga0208363_1040663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae513Open in IMG/M
3300021089|Ga0206679_10564058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae586Open in IMG/M
3300021169|Ga0206687_1563613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae511Open in IMG/M
3300021305|Ga0210296_1080418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae575Open in IMG/M
3300021359|Ga0206689_10551328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales879Open in IMG/M
3300021379|Ga0213864_10517034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae597Open in IMG/M
3300021962|Ga0222713_10055196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae3011Open in IMG/M
3300022827|Ga0222647_1007773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1811Open in IMG/M
3300023184|Ga0214919_10308600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1085Open in IMG/M
3300023549|Ga0232116_103259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae500Open in IMG/M
3300024228|Ga0228633_1152234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae512Open in IMG/M
(restricted) 3300024264|Ga0233444_10113933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1382Open in IMG/M
3300024296|Ga0228629_1079209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae881Open in IMG/M
3300024320|Ga0233398_1058342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae980Open in IMG/M
3300024326|Ga0228652_1044313All Organisms → cellular organisms → Eukaryota → Sar1176Open in IMG/M
3300024334|Ga0228671_1122692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae609Open in IMG/M
3300024343|Ga0244777_10592508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae672Open in IMG/M
3300024420|Ga0228632_1172408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae500Open in IMG/M
3300025375|Ga0208259_1058496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae517Open in IMG/M
3300025378|Ga0207960_1000305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae10841Open in IMG/M
3300025701|Ga0209771_1154841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae702Open in IMG/M
3300025810|Ga0208543_1030809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1349Open in IMG/M
3300025887|Ga0208544_10133595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1082Open in IMG/M
3300026186|Ga0208128_1138087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae520Open in IMG/M
3300026202|Ga0207984_1024740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1763Open in IMG/M
3300026453|Ga0228644_1035913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae973Open in IMG/M
3300026453|Ga0228644_1097057Not Available509Open in IMG/M
3300026471|Ga0247602_1131960Not Available604Open in IMG/M
3300026500|Ga0247592_1124109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae618Open in IMG/M
3300027752|Ga0209192_10056130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a1749Open in IMG/M
3300027788|Ga0209711_10344157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Durinskia → Durinskia baltica630Open in IMG/M
3300027788|Ga0209711_10348958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae623Open in IMG/M
3300027833|Ga0209092_10215779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum1073Open in IMG/M
3300027833|Ga0209092_10246036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae987Open in IMG/M
3300027833|Ga0209092_10538832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae592Open in IMG/M
3300027849|Ga0209712_10811256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae510Open in IMG/M
3300027883|Ga0209713_10037787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae3278Open in IMG/M
3300027883|Ga0209713_10342319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae992Open in IMG/M
3300028106|Ga0247596_1149148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae534Open in IMG/M
3300028109|Ga0247582_1048841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1102Open in IMG/M
3300028134|Ga0256411_1127827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae850Open in IMG/M
3300028396|Ga0228643_1134158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae564Open in IMG/M
3300030547|Ga0247656_1008601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1034Open in IMG/M
3300030670|Ga0307401_10129182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum1113Open in IMG/M
3300030752|Ga0073953_11438422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae652Open in IMG/M
3300030868|Ga0073940_1000463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae596Open in IMG/M
3300031569|Ga0307489_10355698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae963Open in IMG/M
3300031688|Ga0308011_10125417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae782Open in IMG/M
3300031689|Ga0308017_1006548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2859Open in IMG/M
3300034107|Ga0335037_0482277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae664Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.22%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.60%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.28%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.99%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.99%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond1.32%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.32%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.32%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.32%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.32%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.32%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.32%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent1.32%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.32%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral1.32%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.66%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.66%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.66%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.66%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.66%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.66%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.66%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.66%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.66%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.66%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.66%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.66%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.66%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.66%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.66%
CnidariaHost-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria0.66%
Coral TissueHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue0.66%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.66%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.66%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.66%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000203Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300000371Marine microbial community from Union City, CA, USA - Pond 1C Liquid 3EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001820Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM5, ROCA_DNA135_2.0um_27fEnvironmentalOpen in IMG/M
3300002370Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003311Looe Key poolHost-AssociatedOpen in IMG/M
3300003539Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNAEnvironmentalOpen in IMG/M
3300003540Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNAEnvironmentalOpen in IMG/M
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004786Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009221Microbial communities of water from Amazon river, Brazil - RCM2EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009563Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300009908Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010031Coral microbial communities from La Bocana,Puerto Morelos, Mexico - Diploria C A metagenomeHost-AssociatedOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010394Coral microbial communities from Florida Keys, Florida, USA - Orbicella T D metagenomeHost-AssociatedOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012732Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013948Coral microbial communities from a home aquarium in Belgium - AM-T0-control AHost-AssociatedOpen in IMG/M
3300017311Metatranscriptome of marine eukaryotic communities from unknown location in HESNW medium w/o silica, at 18 C, 30 psu salinity and 654 ?mol photons light - Protoceratium reticulatum CCCM 535 (MMETSP0228)Host-AssociatedOpen in IMG/M
3300017481Metatranscriptome of coastal eukaryotic communities from South Pacific Ocean in L1 medium, 22 C, 20 psu salinity and 674 ?mol photons light - Karlodinium veneficum CCMP 2283 (MMETSP1017)Host-AssociatedOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300018526Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019738Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MGEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020503Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022827Saline water microbial communities from Ace Lake, Antarctica - #333EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023549Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 63R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025378Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026186Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF51B (SPAdes)EnvironmentalOpen in IMG/M
3300026202Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030752Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030868Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1010443933300000115MarineMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
TB18AUG2009E_03578923300000203FreshwaterMNEKMSKRRIQIIDFQKQEIEEKEETTLLIRLHIFYKILTINLCFKK*
P_1C_Liq_3_UnCtyDRAFT_101895123300000371EnviromentalMNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL*
JGI20159J14440_1019544823300001353Pelagic MarineMNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
ACM5_10594033300001820Marine PlanktonMNEKMSKRRIQIRDLQKQEIEEKQETRLLIRLHIFYKILLINL*
B570J29631_10708013300002370FreshwaterTKSLKLEQIMNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL*
LKpool_100611033300003311CnidariaLEKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRLHIF*
FS891DNA_1027453413300003539Diffuse Hydrothermal Flow Volcanic VentMNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
FS896DNA_1040169623300003540Diffuse Hydrothermal Flow Volcanic VentMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLRNL*TKNEN*
Ga0005853_102569323300003754Freshwater And SedimentMNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL*
Ga0007753_149680513300004786Freshwater LakeMNEKMSKRRIQIIDLQKQEIEEKEETTLLIRLHIFYKILLINLCTKN*
Ga0007751_1017028713300004794Freshwater LakeMNEKMSKRRIQIKELQKLKMYEKEERRLLIRLHIFYLILLINLYTKNEN*
Ga0007813_110933813300006103FreshwaterSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0075502_117392113300006357AqueousMEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL*
Ga0075516_104088623300006384AqueousMEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRLQISSVILLINL*
Ga0075517_104505833300006393AqueousMEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRFQISSVILLINL*
Ga0075493_106513913300006396AqueousMNEKMSKRRIQIRELQKQEIEEKEERRLLIMFIWILA
Ga0075510_1110596623300006405AqueousMEKMMNEKMSKRRIQIRELQKQEIEEKQERGLLIRLQISSVILLINL*
Ga0075467_1033779133300006803AqueousMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN*
Ga0102689_111853313300007304Freshwater LakeEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIF*
Ga0105019_115213823300007513MarineMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL*
Ga0105055_1011535513300007519FreshwaterMLEQIMNERMSKRRIQIIVLQKQEIEEKEERRLLITLHIFYLILLINL*
Ga0102817_106156823300007555EstuarineMNEKMSKRRIQITDLQKQEIEEKHERRLLIRLHIFDLILLINL*
Ga0102823_116898013300007692EstuarineKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0105743_103851223300007958Estuary WaterMNEKISKRRIEIRDLQKQEIEEKEERRLLINIFSFICLGMA*
Ga0105745_121176213300007972Estuary WaterSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYQILLINL*
Ga0103928_1037281613300009023Coastal WaterMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0103708_10003981043300009028Ocean WaterMNEKMPKRRIQITDLQKQEKEEKQERRLIIRLHIFYQILLINL*
Ga0115566_1060661523300009071Pelagic MarineLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLINL*
Ga0114918_1025139213300009149Deep SubsurfaceRRIEIRDLQKEEIEEKRERRLLIKVHIFYKILLINL*
Ga0105102_1092383123300009165Freshwater SedimentSLKVKKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0103849_105836713300009221River WaterMNEKMSKRRIQIIDFQKQEIEEKEETALLIRLHVFYKILTINLCFKK*
Ga0103880_1000545933300009279Surface Ocean WaterMNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFSGILLINL*
Ga0114997_1015878413300009425MarineMEKIMNEKMSKRRIQIRDLQKQEIEEKEERRLLIRLHIFYLILLINL*
Ga0115005_1051530423300009432MarineMNEKMSKRRIKITELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE*
Ga0115005_1094045323300009432MarineEKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL*
Ga0115005_1155828613300009432MarineKSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0115008_1015253413300009436MarineLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYKILLINL*
Ga0115008_1042461323300009436MarineMNEKISKRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINLCVKNEK*
Ga0115007_1135202813300009441MarineMNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE*
Ga0115003_1021786223300009512MarineMNEKMSKRRIQITDLQKQEIEESQGIRLLISGIERR*
Ga0114919_1049725023300009529Deep SubsurfaceMNEKMSKRRIEIRDLQKEEIEEKRERRLLIKVHIFYKILLINL*
Ga0115006_1104920213300009544MarineNLEKIMNEKMSKRRIQITDLHSQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0115013_1071879113300009550MarineKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL*
Ga0115013_1072882313300009550MarineKPLNLERIMNEKMSKRRIQITDLQKQEIEESQGIRLLIRFHISLVFLLINL*
Ga0115013_1095871713300009550MarineLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0130030_103183813300009563Meromictic PondMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLL
Ga0115011_1171049823300009593MarineMEKIMNEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL*
Ga0115102_1023372613300009606MarineMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0115102_1069812313300009606MarineLADKFLNLEKIMNEKMSKRRIQIRDLQKREIEEKQERRLL
Ga0115102_1099107813300009606MarineMNEKMSKKRIQIRDLQKQEIEEKQETRLLIRLHIFYKILLINL*
Ga0115100_1010234333300009608MarineKSLNLEKIMNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0115100_1057802813300009608MarineLKLKKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL*
Ga0115000_1052215413300009705MarineNLEKIMNEKMSKRRIQIIDLQKQEIEEKEETRLLITLHIFYKILLINLCTKS*
Ga0123363_104150933300009747MarineMKKIMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN*
Ga0123366_112308023300009756MarineMNEMMSKRRIQITDLQKQEIEEKEERRLLIRFQNLRKQKD*
Ga0115012_1118285923300009790MarineMEKIMNEKMSKRRIKIKDLQKQEIEEKEERRLLIRLHIIYFILLINI*
Ga0132233_10428923300009908Meromictic PondMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLLIAAHIK*
Ga0126337_1053933713300010031CoralEKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRLHIF*
Ga0114967_1015882113300010160Freshwater LakeIQIIDLQKQEIEEKEETTLLIRLHIFYLILLINL*
Ga0129322_110347223300010306AqueousMNEKMSKRRIQIIDLQKQEIEKKEERTPLIRLHIFDKILLINLCTKN*
Ga0136655_110255023300010316Freshwater To Marine Saline GradientDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN*
Ga0126341_100231313300010394CoralLEKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRL
Ga0129331_142209813300012524AqueousMNEKMSKRRIQIRDLQKQEIEEKQERRPLIRLHIFYKILLINL*
Ga0157549_123705313300012732FreshwaterMNEKMSKRRLEIRDLQKQEKEEKQERRLLIRLHIFYLILLINL*
Ga0160423_1114598713300012920Surface SeawaterMNEKMSKRRIQKTDLQKQEIEESQGIRLLIRFHISLVFLLINL*
Ga0163179_1069557013300012953SeawaterKIMNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYFILLINL*
Ga0163111_1023731033300012954Surface SeawaterEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0129327_1008770333300013010Freshwater To Marine Saline GradientMNEKMSKRRIQIRELQKQEIEEKEERRLLIMFIWILAIFFHNL*
Ga0116699_100000113300013948Coral TissueLEKIINEKMSKRRIQIIELQKQENPQKEEKRLLIRLHIF*
Ga0186119_103137413300017311Host-AssociatedMSKRRIQITDLQKEEIEEKEETNKLIRLHIFYQILLINL
Ga0186654_104130333300017481Host-AssociatedMNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRFHIF
Ga0181584_1025517413300017949Salt MarshMEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL
Ga0180436_1016611723300017990Hypersaline Lake SedimentMNEKISKRRIQITDLQKQEIEEKEETNKLIRFHIFYLILLINL
Ga0193100_10095413300018526MarineKSLKLEKIMNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFYLILLINL
Ga0188834_101273113300018599Freshwater LakeIMNEKMSKRRIQITDLQKEEIEEKEETNKLIRLHIFYQILLINL
Ga0193069_103816613300018711MarineKSLKLEKIMNEKMPKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0193038_103345713300018723MarineMNEKIPKRRIEIRELQKQEIEKKEERGALIRFHIFYLILLINLLSKNEN
Ga0192950_102716913300018791MarineMNEKLSKRRIQIIDLQKKEIEEKQEIRLLIRLHIF
Ga0193312_101123623300018844MarineMLEKKMNEKIPKRRIQIIELQKKEIEKKQEIRPLIRFHIFYLILLINL
Ga0193312_102835623300018844MarineMEKIMNEKNPKRKIEIRELQKQEIEKKEERGALIRFHIFYLILLINL
Ga0193128_1013556513300018951MarineLKLEKIMNEKMPKRRIQITELQKQEIEKTKERGPLIRFHIFSQILLINL
Ga0193143_1016838523300018969MarineSKRRIQITDLQKQEIEEKRERRLLIRLHIFYKILLINL
Ga0192953_1012149013300019000MarineMNEKISKRRIQITDLQKQEIEEKEETNKLIRIYLVFGNM
Ga0193196_1030670123300019007MarineLKLEKIMNEKMPKRRIQIIELQKQEIKKKQEIGPLIRFHIFYLILLINL
Ga0192926_1049882413300019011MarineKPLKLEKIMNEKMPKRRIQITDLQKQEKEETKERRLLIRLHIFYQILLINL
Ga0193043_1021293413300019012MarineRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINL
Ga0192951_1026593423300019022MarineLEKIMNEKMPKRRIQITDLQKQEIEEKEERRLLIRLHIFSFILLINL
Ga0192886_1018342113300019037MarineLEKIMNEKMSKRRIQITDLQKQEIEETKERRPLIRLHIFYQILLINL
Ga0193336_1018794423300019045MarineMNEKMSKRRIEIRELQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0192981_1026823523300019048MarineLEKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0193082_1069420113300019049MarineLNLEKIMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINL
Ga0193082_1081865413300019049MarineLKLEKIMNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFSLILLINL
Ga0193208_1015045313300019055MarineMSPEMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINF
Ga0193045_105938723300019100MarineMNEKLSKRRIQIIDLQKKEIEEKQEIRLLIRLHIFYQLFYHSLLEVI
Ga0194244_1002274513300019150MarineKSLKLEKIMNEKMPKRRIQITELQKQEIEKKQEIRPLIRLHIFYLILLINL
Ga0193994_101736323300019738SedimentMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN
Ga0206125_1017357313300020165SeawaterRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0206124_1038032513300020175SeawaterMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLIN
Ga0208363_104066313300020503FreshwaterMNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL
Ga0206679_1056405813300021089SeawaterKRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0206687_156361313300021169SeawaterSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYIILLINL
Ga0210296_108041813300021305EstuarineMNEKMSKRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINLCVKNEK
Ga0206689_1055132823300021359SeawaterQAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0213864_1051703423300021379SeawaterMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0222713_1005519643300021962Estuarine WaterMNEKISKRRIQIRELQKLELPQKVERILLIRLHIFYLILLINLYTKNEN
Ga0222647_100777333300022827Saline WaterMNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE
Ga0214919_1030860013300023184FreshwaterMNEKMSKRRIQIKELQKLKMYEKEERRLLIRLHIFYLILLINLYTKNEN
Ga0232116_10325923300023549SeawaterMEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRFQISSVILLINL
Ga0228633_115223423300024228SeawaterMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIF
(restricted) Ga0233444_1011393313300024264SeawaterMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLIL
Ga0228629_107920913300024296SeawaterQSKSLKLEKIMNENMSKRRIQITDLQKQEIEEKQKRRLLIRLHIFYLILLINL
Ga0233398_105834223300024320SeawaterMKGLYVQIRDLQKQEIEDKRERRLLLRLHIFYRILLIN
Ga0228652_104431323300024326SeawaterKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0228671_112269213300024334SeawaterIMNEKMSKRRIQITDLQKQEIEEKQEMRLLIRLHIFYLILLINL
Ga0244777_1059250823300024343EstuarineMNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL
Ga0228632_117240823300024420SeawaterMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0208259_105849613300025375FreshwaterMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLPKDFIF
Ga0207960_100030523300025378FreshwaterMNEKMSKRRIQIRDLQKQEIEEKQERILLIRLHIFYLILLINL
Ga0208660_106182423300025570AqueousMNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNERRDEER
Ga0209771_115484113300025701MarineMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLSF
Ga0208543_103080953300025810AqueousWKQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0208544_1013359513300025887AqueousMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKNSR
Ga0208128_113808713300026186MarineKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL
Ga0207984_102474043300026202MarineMNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0228644_103591313300026453SeawaterMNEKMSKRRIQITDLQKQEIEEKQEMRLLIRLHIFYLILLINL
Ga0228644_109705723300026453SeawaterMNEKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYNLLLINLSNKDEN
Ga0247602_113196023300026471SeawaterMNEKISKRRIQITDLQKQEIEKKQEIRPLIRLHIFYKLLLINLSNKDEN
Ga0247592_112410913300026500SeawaterMNEKIPKRRIQITELQKQEIEKKQEIRPLIRFHIFYKLLLINPSNKDED
Ga0209192_1005613013300027752MarineEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0209711_1034415723300027788MarineIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLI
Ga0209711_1034895823300027788MarineMNEKMSKRRIQITDLQKQEIEESQGIRLLISGIERR
Ga0209092_1021577913300027833MarineEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL
Ga0209092_1024603613300027833MarineSLKLEKIMNEKMSKRRIQITDLQKQEIEGKQERRLLIRLHIFYLILLINL
Ga0209092_1053883213300027833MarineMEKIMNEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL
Ga0209712_1073860213300027849MarineKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRCFFVLLVKALVMH
Ga0209712_1081125623300027849MarineMSKRRIQIRDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0209713_1003778743300027883MarineIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0209713_1034231943300027883MarineMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLI
Ga0247596_114914813300028106SeawaterMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVI
Ga0247582_104884133300028109SeawaterMNEKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYKLLLINPSNKDEN
Ga0256411_112782713300028134SeawaterMNEKISKRRIQITDLQKQEIEEKQEIRPLIRLHIFYNLL
Ga0228643_113415813300028396SeawaterEKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYNLLLINLSNKDEN
Ga0247656_100860113300030547SoilMIMNEKIPKRRIQIIELQKEEIEKKEERRPLIRFHIFYKILLINLCTKN
Ga0307401_1012918213300030670MarineNLKKIMNEMMSKRRIQITDLQKQEIEETKERRLLIRLHIFSQILLINL
Ga0073953_1143842213300030752MarineLEKIMNEKMSKRRIQITDLQKEEIEEKQERRLLIRLHIFYLILLINL
Ga0073940_100046313300030868MarineMNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFY
Ga0307489_1035569823300031569Sackhole BrineMEKIMNEKMSKRKIQITELQKQEIEEKEERRLLIRLHIFCKLLLINLCTKNE
Ga0308011_1012541723300031688MarineQMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0308017_100654833300031689MarineMNEKMSKRRIQIRDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0335037_0482277_125_2563300034107FreshwaterMNEKMSKRRIQTIVLQRQGIEGKEEKGLLITLHIFYLILLINL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.