NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046407

Metagenome / Metatranscriptome Family F046407

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046407
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 55 residues
Representative Sequence MEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKV
Number of Associated Samples 121
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 66.23 %
% of genes near scaffold ends (potentially truncated) 21.19 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (72.848 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.828 % of family members)
Environment Ontology (ENVO) Unclassified
(54.967 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.444 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.82%    β-sheet: 9.09%    Coil/Unstructured: 69.09%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.51 %
UnclassifiedrootN/A26.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10115237Not Available851Open in IMG/M
3300001589|JGI24005J15628_10205592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300001822|ACM39_111487Not Available614Open in IMG/M
3300002835|B570J40625_100809739Not Available822Open in IMG/M
3300003216|JGI26079J46598_1033770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300004097|Ga0055584_100573412Not Available1177Open in IMG/M
3300004765|Ga0007745_1000963Not Available587Open in IMG/M
3300004784|Ga0007744_1315967Not Available612Open in IMG/M
3300005043|Ga0071100_1085340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300005516|Ga0066831_10022714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1708Open in IMG/M
3300005516|Ga0066831_10067861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300005516|Ga0066831_10085813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300005516|Ga0066831_10228884Not Available505Open in IMG/M
3300006356|Ga0075487_1424074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300006382|Ga0075494_1332383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300007513|Ga0105019_1158102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1169Open in IMG/M
3300007513|Ga0105019_1233052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum868Open in IMG/M
3300007516|Ga0105050_10559507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300007718|Ga0102852_1133384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300007722|Ga0105051_10463252Not Available942Open in IMG/M
3300007954|Ga0105739_1141973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300008931|Ga0103734_1027118Not Available848Open in IMG/M
3300008952|Ga0115651_1440517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300008958|Ga0104259_1021481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300008958|Ga0104259_1029378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300009001|Ga0102963_1336770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300009001|Ga0102963_1379517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300009002|Ga0102810_1204830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300009022|Ga0103706_10158239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300009130|Ga0118729_1214416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300009420|Ga0114994_10475048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300009422|Ga0114998_10492269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300009434|Ga0115562_1121639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300009436|Ga0115008_10286944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1168Open in IMG/M
3300009436|Ga0115008_11378430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300009442|Ga0115563_1356635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300009592|Ga0115101_1697490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009593|Ga0115011_11771023Not Available556Open in IMG/M
3300009593|Ga0115011_12118433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300009599|Ga0115103_1578874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300009677|Ga0115104_10675226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300009679|Ga0115105_10229144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300010883|Ga0133547_11776588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1141Open in IMG/M
3300010981|Ga0138316_10067668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300010981|Ga0138316_10424489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300010985|Ga0138326_10563963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300010987|Ga0138324_10515231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300012414|Ga0138264_1220209Not Available652Open in IMG/M
3300012416|Ga0138259_1021687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300012504|Ga0129347_1007212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium662Open in IMG/M
3300012952|Ga0163180_10413740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum989Open in IMG/M
3300012952|Ga0163180_11353747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300012952|Ga0163180_11650444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300012952|Ga0163180_11797568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300012953|Ga0163179_10369507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1155Open in IMG/M
3300012953|Ga0163179_11111349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300012953|Ga0163179_11331430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300012954|Ga0163111_12755792Not Available502Open in IMG/M
3300016726|Ga0182045_1165725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300016727|Ga0182051_1014025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300016746|Ga0182055_1105706Not Available532Open in IMG/M
3300016762|Ga0182084_1547192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300017779|Ga0181395_1140021Not Available765Open in IMG/M
3300017967|Ga0181590_11135966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300018622|Ga0188862_1023319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018628|Ga0193355_1023473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018628|Ga0193355_1029356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018692|Ga0192944_1046744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018725|Ga0193517_1061169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018725|Ga0193517_1062152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300018725|Ga0193517_1067392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018730|Ga0192967_1049929Not Available700Open in IMG/M
3300018745|Ga0193000_1050773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018765|Ga0193031_1057718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300018766|Ga0193181_1064640Not Available533Open in IMG/M
3300018855|Ga0193475_1057300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300018874|Ga0192977_1051585Not Available836Open in IMG/M
3300018899|Ga0193090_1127953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300018955|Ga0193379_10231533Not Available500Open in IMG/M
3300018968|Ga0192894_10288117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300018980|Ga0192961_10241509Not Available532Open in IMG/M
3300018989|Ga0193030_10218302Not Available627Open in IMG/M
3300018989|Ga0193030_10305011Not Available514Open in IMG/M
3300019031|Ga0193516_10262721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019031|Ga0193516_10267406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300019033|Ga0193037_10291494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300019036|Ga0192945_10162537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300019048|Ga0192981_10236565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300019051|Ga0192826_10285771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300019146|Ga0188881_10026012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300020013|Ga0182086_1243297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300020166|Ga0206128_1296274Not Available577Open in IMG/M
3300020505|Ga0208088_1027358Not Available723Open in IMG/M
3300021169|Ga0206687_1671471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300021334|Ga0206696_1411647Not Available616Open in IMG/M
3300021342|Ga0206691_1060234Not Available536Open in IMG/M
3300021342|Ga0206691_1224380Not Available617Open in IMG/M
3300021342|Ga0206691_1376112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300021342|Ga0206691_1377099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300021345|Ga0206688_10183573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300021345|Ga0206688_10328411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300021348|Ga0206695_1142170Not Available623Open in IMG/M
3300021350|Ga0206692_1631129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300021353|Ga0206693_1877410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300021355|Ga0206690_10127596Not Available518Open in IMG/M
3300021355|Ga0206690_10296411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300021355|Ga0206690_10818744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300021359|Ga0206689_10116098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300021872|Ga0063132_106867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021885|Ga0063125_1016786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300021893|Ga0063142_1137833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300021950|Ga0063101_1094380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300023179|Ga0214923_10471470Not Available624Open in IMG/M
3300023679|Ga0232113_1040330Not Available513Open in IMG/M
3300025138|Ga0209634_1271374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300025570|Ga0208660_1135065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300025620|Ga0209405_1078997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300025849|Ga0209603_1113345Not Available1177Open in IMG/M
3300026136|Ga0208763_1028520Not Available846Open in IMG/M
3300026182|Ga0208275_1014062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1738Open in IMG/M
3300026182|Ga0208275_1040535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum945Open in IMG/M
3300026182|Ga0208275_1075533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300026434|Ga0247591_1041759Not Available879Open in IMG/M
3300026458|Ga0247578_1092192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300026465|Ga0247588_1114156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300026468|Ga0247603_1119978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300026495|Ga0247571_1169544Not Available518Open in IMG/M
3300026500|Ga0247592_1147093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300027753|Ga0208305_10301571Not Available561Open in IMG/M
3300027833|Ga0209092_10178738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1207Open in IMG/M
3300027833|Ga0209092_10505598Not Available617Open in IMG/M
3300027849|Ga0209712_10756109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300027899|Ga0209668_10444021Not Available854Open in IMG/M
3300027899|Ga0209668_10542015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300027976|Ga0209702_10281070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300028137|Ga0256412_1253343Not Available649Open in IMG/M
3300028575|Ga0304731_10800054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300028575|Ga0304731_11178069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300030780|Ga0073988_12329482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300031062|Ga0073989_13593395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300031569|Ga0307489_10329527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum996Open in IMG/M
3300031580|Ga0308132_1104685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300031622|Ga0302126_10284120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300031626|Ga0302121_10212292Not Available548Open in IMG/M
3300031709|Ga0307385_10380207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300031729|Ga0307391_10669185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300031739|Ga0307383_10623196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300031742|Ga0307395_10399354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300032492|Ga0314679_10490535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300032651|Ga0314685_10538941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300034068|Ga0334990_0284232Not Available900Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.83%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine18.54%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater14.57%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.30%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.97%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.99%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.99%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.99%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.32%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.32%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.32%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.66%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.66%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.66%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.66%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.66%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.66%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.66%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.66%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.66%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.66%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001822Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23aEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016762Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020505Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1011523723300000115MarineMEAYMAEFFPRTWAKFDLNNSGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV*
JGI24005J15628_1020559213300001589MarineKQVSEAKMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
ACM39_11148723300001822Marine PlanktonFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV*
B570J40625_10080973913300002835FreshwaterMEAYMAEFFPRTWAKFDVNASGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKV*
JGI26079J46598_103377023300003216MarineMESYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLKV*
Ga0055584_10057341223300004097Pelagic MarineMAEFFPRTWAKFDLNNSGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV*
Ga0007745_100096313300004765Freshwater LakeMEAYMAEFFPRTWAKFDVNSAGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKA*
Ga0007744_131596723300004784Freshwater LakeMAEFFPRTWAKFDVNSAGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKA*
Ga0071100_108534013300005043Marine Subseafloor AquiferAKMEQYMAEFFPRTWAKFDLNNAGEIDITEAHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0066831_1002271443300005516MarineMAEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV*
Ga0066831_1006786123300005516MarineMEAYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV*
Ga0066831_1008581313300005516MarineMEAYMGEFFPRTWAKFDLNNAGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDIAV*
Ga0066831_1022888413300005516MarineMEAYMAEFFPRTWAKFDMNNAGEIDITESHTFFRSLLGRLNQFVLAPGSLTDIKV*
Ga0075487_142407423300006356AqueousMEAYMGEFFPRTWAKFDINNSGEVDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0075494_133238313300006382AqueousMESYMNEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0105019_115810223300007513MarineMESYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV*
Ga0105019_123305223300007513MarineVSEAKMESYMAEFFPRTWAKFDMNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0105050_1055950713300007516FreshwaterMESYMAEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0102852_113338413300007718EstuarineKIDSYMSEFFPRTCAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0105051_1046325213300007722FreshwaterMESYMAEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTNIKVE*
Ga0105739_114197313300007954Estuary WaterEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0103734_102711823300008931Ice Edge, Mcmurdo Sound, AntarcticaMEAYMAEFFPRTWAKFDLNNAGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV*
Ga0115651_144051713300008952MarineFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE*
Ga0104259_102148123300008958Ocean WaterMEAYMAEFFPRTWAKFDMNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV*
Ga0104259_102937813300008958Ocean WaterMEAYMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE*
Ga0102963_133677013300009001Pond WaterMEQYMAEFFPRAWAKFDMNNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0102963_137951713300009001Pond WaterKQLGESKMEAYMAEFFPRTWAKYDINNTGEIDVTESHTFMRALMGGLNQFVLAPGSLTDIKVE*
Ga0102810_120483013300009002EstuarineKQVSEAKMESYMSEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE*
Ga0103706_1015823923300009022Ocean WaterMESYMGEFFPRTWAKYDLNNQGEIDLSESHTFMRSLMGRLNQFVLAPGSLTDLKL*
Ga0118729_121441613300009130MarineLLVTKQVSEAKMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0114994_1047504823300009420MarineMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV*
Ga0114998_1049226913300009422MarineEAKMESYMGEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKV*
Ga0115562_112163913300009434Pelagic MarineMETYMAEFFPRTWAKFDINNSGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDISV*
Ga0115008_1028694413300009436MarineMEAYLGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0115008_1137843013300009436MarineEILLVSKQVSETKMESYMAEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0115563_135663513300009442Pelagic MarineMETYMAEFFPRTWAKFDINNAGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDLKV*
Ga0115101_169749013300009592MarineQVSEAKMESYMAEFFPRTWAKFDVNNQGEIDVTESHTFMRSLMGRLNQFVLAPGSLTDIKVE*
Ga0115011_1177102323300009593MarineMEAYMVEFFPRTWAKFDINNSGEIDITESLTFIRSLMGRLNQFVLA
Ga0115011_1211843313300009593MarineKMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV*
Ga0115103_157887423300009599MarineMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0115104_1067522623300009677MarineVSEAKMEAYMGEFFPRTWAKFDINNSGEVDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0115105_1022914423300009679MarineVTKQVSEAKMEAYMGEFFPRTWAKFDLNNAGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDIAV*
Ga0133547_1177658813300010883MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0138316_1006766823300010981MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKV*
Ga0138316_1042448913300010981MarineMEAYMAEFFPRTWAKFDLNNTGEVDITESHTFMRSLLGRLNQFVLAPGSLTDIKV*
Ga0138326_1056396313300010985MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIAV*
Ga0138324_1051523123300010987MarineMESYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE*
Ga0138264_122020913300012414Polar MarineMEAYMAEFFPRTWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDITV*
Ga0138259_102168723300012416Polar MarineMEAYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE*
Ga0129347_100721213300012504AqueousMESYMAEMFPRTWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDLKV*
Ga0163180_1041374013300012952SeawaterMESYMAEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE*
Ga0163180_1135374723300012952SeawaterFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV*
Ga0163180_1165044433300012952SeawaterMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFV
Ga0163180_1179756813300012952SeawaterFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0163179_1036950723300012953SeawaterMESYMAEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAVE*
Ga0163179_1111134913300012953SeawaterMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV*
Ga0163179_1133143023300012953SeawaterMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV*
Ga0163111_1275579213300012954Surface SeawaterAYMAEFFPRTWAKFDLNNAGEIDITESHTFFRSLLGRLNQFVLAPGSLTDISV*
Ga0182045_116572513300016726Salt MarshMEQFMAEFFPRTWAKFDVNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0182051_101402513300016727Salt MarshMEQFMAEFYPRTWAKFDVNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0182055_110570623300016746Salt MarshMAEFFPRTWAKFDMNNTGEIDITESHTFFRSLLGRLNQFVLAPGSLTDISV
Ga0182084_154719213300016762Salt MarshMLVTKQLSEAKMETYMGEFFPRTWAKFDLNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0181395_114002113300017779SeawaterQVSEAKMESYMGEFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIK
Ga0181590_1113596613300017967Salt MarshLLVTKQVNEAKMEAYMAEFFPRTWAKFDINSAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0188862_102331913300018622Freshwater LakeMEAYMGEFFPRTWAKFDINNSGEVDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0193355_102347323300018628MarineMESYMGEFFPRTWAKYDLNNEGEIALTESHTFMRSLMGRLNQFVLAPGSLTDLKL
Ga0193355_102935623300018628MarineMESYMAEFFPRTWAKFDSNNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIDV
Ga0192944_104674413300018692MarineMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE
Ga0193517_106116923300018725MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0193517_106215223300018725MarineMEAYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0193517_106739223300018725MarineMESYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE
Ga0192967_104992923300018730MarineMAEFFPRTWAKFDLNNAGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0193000_105077323300018745MarineMESYMGEFFPRTWAKYDLNNQGEIDLTESHTFMRSLMGRLNQFVLAPGSLTDLKL
Ga0193031_105771813300018765MarineMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV
Ga0193181_106464013300018766MarineMESYMAEFFPRTWAKFDLNNSGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0193475_105730013300018855MarineMESYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAVE
Ga0192977_105158523300018874MarineMEAYMAEFFPRTWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDITV
Ga0193090_112795323300018899MarineMEAYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0193379_1023153313300018955MarineMESYMGEFFPRTWAKYDLNNQGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDLKL
Ga0192894_1028811723300018968MarineMEAYMGEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0192961_1024150913300018980MarineMEAYMAEFFPRTWAKFDMNNSGEIDITESHTFFRSLLGRLNQFVLAPGSLTDISV
Ga0193030_1021830213300018989MarinePRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0193030_1030501113300018989MarineMGEFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0193516_1026272123300019031MarineMAEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE
Ga0193516_1026740623300019031MarineMESYMAEFFPRTWAKFDLNNAGEVDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0193037_1029149413300019033MarineMGEFFPRTWAKFDLNNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAVEK
Ga0192945_1016253713300019036MarineMEAYMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE
Ga0192981_1023656523300019048MarineMEAYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0192826_1028577123300019051MarineMEAYTGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0188881_1002601213300019146Freshwater LakeMAEFYPRTWAKFDVNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0182086_124329713300020013Salt MarshMEQFMAEFFPRTWAKYDVNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0206128_129627423300020166SeawaterMEAYMAEFFPRTWAKFDLNNSGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0208088_102735813300020505FreshwaterMEAYMAEFFPRTWAKFDVNASGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKV
Ga0206687_167147113300021169SeawaterMEAYMAEFFPRTWAKFDLNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0206696_141164723300021334SeawaterMEAYMAEFFPRTWAKFDMNNAGEIDITESHTFFRSLLGRLNQFVLAPGSLTDIAV
Ga0206691_106023413300021342SeawaterMEAYMAEFFPRTWAKFDMNNAGEIDITESHTFFRSLLGRLNQFVLAPGSLTDIKV
Ga0206691_122438013300021342SeawaterMESYVSEFFPRTWAKFDINNAGEIDITESHTFMRSMLGRLNQFVLAPGSLTDIKVE
Ga0206691_137611223300021342SeawaterMGAYMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0206691_137709913300021342SeawaterMEAYMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0206688_1018357323300021345SeawaterVSEAKMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0206688_1032841123300021345SeawaterMESYMASFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISVE
Ga0206695_114217023300021348SeawaterMESYMAEFFPRTWAKFDINNTGEIDITESQTFMRSLLGRLNQFVLAPGSLTDISVE
Ga0206692_163112923300021350SeawaterMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0206693_187741013300021353SeawaterMESYMAEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAVE
Ga0206690_1012759623300021355SeawaterMEAYMAEFFPRTWAKFDMNNTGEIDITESHTFFRSLLGRLNQFVLAPGSLTDISV
Ga0206690_1029641113300021355SeawaterMEAYMAEFFPRTWAKFDINNAGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0206690_1081874423300021355SeawaterMESYMASFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAVE
Ga0206689_1011609823300021359SeawaterMESYMSEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0063132_10686723300021872MarineMEAYMAEFFPRTWAKFDLNNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE
Ga0063125_101678623300021885MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIAV
Ga0063142_113783323300021893MarineMEAYMAEFFPRTWAKFDLNNTGEVDITESHTFMRSLLGRLNQFVLAPGSLTDIKV
Ga0063101_109438023300021950MarineMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0214923_1047147013300023179FreshwaterVNEAKMESYMAEFFPRAWAKFDVNNQGEIDLTEGHTFMRSLLGRLNQFVLAPGSLTDI
Ga0232113_104033023300023679SeawaterMEAYMGEFFPRTWAKFDVNNSGEIDITEGHTFIRSLLGRLNQFVLAPGSLTDIKV
Ga0209634_127137423300025138MarineMEAYMGEFFPRTWAKFDINNSGEVDITESHTFMRSLMGRLNQFVLAPG
Ga0208660_113506513300025570AqueousKQVSESKMEAYMAEFFPRTWAKFDINNAGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDLKV
Ga0209405_107899713300025620Pelagic MarineMETYMAEFFPRTWAKFDINNSGEIDVTESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0209603_111334533300025849Pelagic MarineMAEFFPRTWAKFDLNNSGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0208763_102852033300026136MarineMEAYMGEFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0208275_101406223300026182MarineMAEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0208275_104053513300026182MarineMAEFFPRTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDINV
Ga0208275_107553313300026182MarineTWAKFDINNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0247591_104175923300026434SeawaterMEAYMAEFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0247578_109219223300026458SeawaterMEAYMGEFFPRTWAKFDINNSGEIDITESHTFIRSLMGRLNQFVLAPGSLTDISV
Ga0247588_111415623300026465SeawaterMEAYMGEFFPRTWAKFDINNSGEIVITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0247603_111997813300026468SeawaterMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0247571_116954413300026495SeawaterMEAYMGEFFPRTWAKFDMNNTGEIDITESHTFFRSLLGRLNQFVLAPGSLTDISV
Ga0247592_114709323300026500SeawaterMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIKVE
Ga0208305_1030157133300027753EstuarineMESYMAEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAP
Ga0209092_1017873813300027833MarineMEAYLGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0209092_1050559823300027833MarineMETFMAEMFPRSWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDLKV
Ga0209712_1075610913300027849MarineAKMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0209668_1044402113300027899Freshwater Lake SedimentMEAYMAEFFPRTWAKFDVNSAGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKA
Ga0209668_1054201513300027899Freshwater Lake SedimentMAEFFPRTWAKFDVNNQGEIDITEGHTFMRSLLGRLNQFVLAPGSLTDI
Ga0209702_1028107013300027976FreshwaterMESYMAEFFPRTWAKFDLNNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0256412_125334313300028137SeawaterEAKMEAYMAEFFPRTWAKFDLNNTGEIDITESHTFMRALLGRLNQFVLAPGSLTDIKV
Ga0304731_1080005423300028575MarineMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKV
Ga0304731_1117806923300028575MarineVSEAKMEAYMGEFFPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDISV
Ga0073988_1232948213300030780MarineMESYMGEFFPRTWAKYDLNNQGEIDITESHTFMRSLMGRLNQFVLAPGSLTDLKL
Ga0073989_1359339523300031062MarineMESYMAEFFPRTWAKYDLNNEGEIALTESHTFMRSLMGRLNQFVLAPGSLTDLKL
Ga0307489_1032952723300031569Sackhole BrineMEAYMSEFFPRTWAKFDLNNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0308132_110468513300031580MarineMESYMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV
Ga0302126_1028412013300031622MarineMEAYMGEFYPRTWAKFDINNSGEIDITESHTFMRSLMGRLNQFVLAPGSLTDIAV
Ga0302121_1021229213300031626MarineMEAYMAEFFPRTWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLT
Ga0307385_1038020713300031709MarineMESYMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0307391_1066918523300031729MarineMEAYMAEFFPRTWAKFDLNNQGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIEV
Ga0307383_1062319623300031739MarineMEAYVGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDISV
Ga0307395_1039935423300031742MarineMGEFFPRTWAKFDINNTGEIDITESHTFMRSLLGRLNQFVLAPGSLTDLPV
Ga0314679_1049053513300032492SeawaterMEAYMAEFFPRTWAKFDINNAGEIDLTESHTFMRSLLGRLNQFVLAPGSLTDIAV
Ga0314685_1053894123300032651SeawaterMAEFFPRTWAKFDLNNAGEIDITESHTFMRSLMGRLNQFVLAPGSLTDLKV
Ga0334990_0284232_433_6003300034068FreshwaterMEAYIAEFFPRTWAKFDVNSAGEIDLSESHTFMRSLLGRLNQFVLAPGSLTDIKV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.