NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046628

Metagenome / Metatranscriptome Family F046628

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046628
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 89 residues
Representative Sequence MLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTF
Number of Associated Samples 122
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 60.26 %
% of genes from short scaffolds (< 2000 bps) 94.04 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (92.053 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(21.854 % of family members)
Environment Ontology (ENVO) Unclassified
(58.278 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(45.033 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.28%    β-sheet: 4.96%    Coil/Unstructured: 48.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF13499EF-hand_7 12.58
PF13833EF-hand_8 6.62
PF13202EF-hand_5 1.32
PF00036EF-hand_1 1.32
PF03946Ribosomal_L11_N 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0080Ribosomal protein L11Translation, ribosomal structure and biogenesis [J] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.04 %
UnclassifiedrootN/A5.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10143039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea802Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10054053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1201Open in IMG/M
3300001354|JGI20155J14468_10049485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1799Open in IMG/M
3300002835|B570J40625_100411633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1309Open in IMG/M
3300002835|B570J40625_101525673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila548Open in IMG/M
3300003787|Ga0007811_1021935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300004112|Ga0065166_10093833Not Available1080Open in IMG/M
3300004690|Ga0065175_1002422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1186Open in IMG/M
3300004691|Ga0065176_1007256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1001Open in IMG/M
3300004692|Ga0065171_1021017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1049Open in IMG/M
3300004769|Ga0007748_10899945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1044Open in IMG/M
3300004789|Ga0007752_11084344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1175Open in IMG/M
3300005580|Ga0049083_10318542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300005662|Ga0078894_10477058Not Available1122Open in IMG/M
3300005941|Ga0070743_10031444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1834Open in IMG/M
3300006165|Ga0075443_10118289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila921Open in IMG/M
3300006875|Ga0075473_10206603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila793Open in IMG/M
3300007513|Ga0105019_1061473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2190Open in IMG/M
3300007513|Ga0105019_1070558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1999Open in IMG/M
3300007516|Ga0105050_10092554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2014Open in IMG/M
3300007558|Ga0102822_1080763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300008113|Ga0114346_1203891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea786Open in IMG/M
3300008993|Ga0104258_1100601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300008993|Ga0104258_1112852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella508Open in IMG/M
3300009003|Ga0102813_1124618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300009071|Ga0115566_10080262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2132Open in IMG/M
3300009071|Ga0115566_10082338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2100Open in IMG/M
3300009071|Ga0115566_10186377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1275Open in IMG/M
3300009077|Ga0115552_1062734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1671Open in IMG/M
3300009077|Ga0115552_1329378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea607Open in IMG/M
3300009080|Ga0102815_10765503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300009086|Ga0102812_10641171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300009155|Ga0114968_10146149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1406Open in IMG/M
3300009172|Ga0114995_10109286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1551Open in IMG/M
3300009172|Ga0114995_10270398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea937Open in IMG/M
3300009254|Ga0103867_1026949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300009432|Ga0115005_10336270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1192Open in IMG/M
3300009437|Ga0115556_1058631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1558Open in IMG/M
3300009441|Ga0115007_10060049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2385Open in IMG/M
3300009441|Ga0115007_11342417Not Available502Open in IMG/M
3300009476|Ga0115555_1083093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1391Open in IMG/M
3300009495|Ga0115571_1129099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1073Open in IMG/M
3300009495|Ga0115571_1317020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300009497|Ga0115569_10290406Not Available724Open in IMG/M
3300009526|Ga0115004_10215243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1149Open in IMG/M
3300009538|Ga0129287_10039198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2029Open in IMG/M
3300009606|Ga0115102_10718565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1304Open in IMG/M
3300009677|Ga0115104_10028564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1054Open in IMG/M
3300010334|Ga0136644_10338679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300012415|Ga0138263_1029342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1782Open in IMG/M
3300012470|Ga0129329_1042988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1205Open in IMG/M
3300012715|Ga0157599_1130942Not Available1029Open in IMG/M
3300012727|Ga0157531_1124737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300012756|Ga0138272_1138434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300012968|Ga0129337_1020559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300012969|Ga0129332_1146764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1272Open in IMG/M
3300012969|Ga0129332_1375750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1863Open in IMG/M
3300013014|Ga0164295_10274143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1268Open in IMG/M
3300013295|Ga0170791_12453530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300016734|Ga0182092_1084262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300016734|Ga0182092_1402808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1745Open in IMG/M
3300016766|Ga0182091_1387035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300016771|Ga0182082_1042395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300017299|Ga0186338_1005028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1905Open in IMG/M
3300018421|Ga0181592_11081176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300018692|Ga0192944_1006802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1351Open in IMG/M
3300019036|Ga0192945_10289713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae512Open in IMG/M
3300020182|Ga0206129_10379018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
3300020732|Ga0214201_1058000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300021336|Ga0210307_1278694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300021359|Ga0206689_11005386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea653Open in IMG/M
3300021935|Ga0063138_1061807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1062Open in IMG/M
3300021962|Ga0222713_10113316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1922Open in IMG/M
3300023174|Ga0214921_10569541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300025339|Ga0208502_1006542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1013Open in IMG/M
3300025355|Ga0208254_1003985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1025Open in IMG/M
3300025399|Ga0208107_1042467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea786Open in IMG/M
3300025640|Ga0209198_1191765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300025690|Ga0209505_1030837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1899Open in IMG/M
3300025704|Ga0209602_1186196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300025849|Ga0209603_1151684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea942Open in IMG/M
3300025869|Ga0209308_10204810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea872Open in IMG/M
3300025880|Ga0209534_10324445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea697Open in IMG/M
3300027248|Ga0208176_1052259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300027308|Ga0208796_1096093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300027586|Ga0208966_1042209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1315Open in IMG/M
3300027687|Ga0209710_1075907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1407Open in IMG/M
3300027687|Ga0209710_1105696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1101Open in IMG/M
3300027757|Ga0208671_10121189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300027771|Ga0209279_10019952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2068Open in IMG/M
3300027780|Ga0209502_10072660Not Available1817Open in IMG/M
3300027780|Ga0209502_10175196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1008Open in IMG/M
3300027780|Ga0209502_10380859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300027810|Ga0209302_10232192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300027833|Ga0209092_10310479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea851Open in IMG/M
3300027963|Ga0209400_1110227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1263Open in IMG/M
3300027976|Ga0209702_10169393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea950Open in IMG/M
3300028137|Ga0256412_1180583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea779Open in IMG/M
3300030670|Ga0307401_10103125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1233Open in IMG/M
3300030670|Ga0307401_10449827Not Available586Open in IMG/M
3300030670|Ga0307401_10454864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300030699|Ga0307398_10231364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea988Open in IMG/M
3300030699|Ga0307398_10626341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300030709|Ga0307400_10086395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1774Open in IMG/M
3300030709|Ga0307400_10132157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1500Open in IMG/M
3300030709|Ga0307400_10191687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1272Open in IMG/M
3300030788|Ga0073964_11743152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300031622|Ga0302126_10096350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1159Open in IMG/M
3300031626|Ga0302121_10059895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1166Open in IMG/M
3300031710|Ga0307386_10063223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1487Open in IMG/M
3300031717|Ga0307396_10272656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea808Open in IMG/M
3300031734|Ga0307397_10033366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1762Open in IMG/M
3300031734|Ga0307397_10033507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1760Open in IMG/M
3300031737|Ga0307387_10163406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1238Open in IMG/M
3300031738|Ga0307384_10282080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300031784|Ga0315899_10415353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1306Open in IMG/M
3300032463|Ga0314684_10043835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1837Open in IMG/M
3300032463|Ga0314684_10726910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300032470|Ga0314670_10031479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1842Open in IMG/M
3300032470|Ga0314670_10132253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1180Open in IMG/M
3300032492|Ga0314679_10107346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1217Open in IMG/M
3300032517|Ga0314688_10583984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300032518|Ga0314689_10048428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1777Open in IMG/M
3300032518|Ga0314689_10149450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1173Open in IMG/M
3300032521|Ga0314680_10043850All Organisms → Viruses → Predicted Viral1843Open in IMG/M
3300032521|Ga0314680_10046862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1812Open in IMG/M
3300032522|Ga0314677_10553063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300032540|Ga0314682_10041241All Organisms → cellular organisms → Eukaryota1860Open in IMG/M
3300032540|Ga0314682_10138644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1235Open in IMG/M
3300032540|Ga0314682_10146504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1209Open in IMG/M
3300032615|Ga0314674_10141805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1181Open in IMG/M
3300032616|Ga0314671_10051884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1778Open in IMG/M
3300032651|Ga0314685_10041624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1906Open in IMG/M
3300032708|Ga0314669_10033435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1781Open in IMG/M
3300032711|Ga0314681_10036879All Organisms → Viruses → Predicted Viral1852Open in IMG/M
3300032714|Ga0314686_10440717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300032724|Ga0314695_1070782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1192Open in IMG/M
3300032724|Ga0314695_1368882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300032727|Ga0314693_10079372All Organisms → Viruses → Predicted Viral1427Open in IMG/M
3300032729|Ga0314697_10157828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea984Open in IMG/M
3300032732|Ga0314711_10157003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1121Open in IMG/M
3300032746|Ga0314701_10126265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1094Open in IMG/M
3300032750|Ga0314708_10074742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1457Open in IMG/M
3300032751|Ga0314694_10213686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea818Open in IMG/M
3300032752|Ga0314700_10154349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1145Open in IMG/M
3300032752|Ga0314700_10625662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300032754|Ga0314692_10234932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea984Open in IMG/M
3300034068|Ga0334990_0118694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1437Open in IMG/M
3300034073|Ga0310130_0306879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater21.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.53%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.93%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.64%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.99%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.32%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.32%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.32%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.32%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.66%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.66%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.66%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.66%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.66%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.66%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.66%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.66%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.66%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.66%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004690Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (version 2)EnvironmentalOpen in IMG/M
3300004691Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2)EnvironmentalOpen in IMG/M
3300004692Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009254Microbial communities of water from Amazon river, Brazil - RCM20EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017299Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126)Host-AssociatedOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300025339Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025355Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1014303913300000130MarineMLGYESERRLKNFLVAVGDGERDLEMARQRLCNIPDFAPHAAFQRIDRDYSLQVSSREFGNFLRDNGIYHV*
KGI_S1_ANT02_95mDRAFT_1005405313300000136MarineMLGYESERRLKNFLVAVGDGERDLELARQRLCSISDFAPHASFQRLDRDYSLQISSRELGNFLRDNGIYHC*
JGI20155J14468_1004948543300001354Pelagic MarineKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCSIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
B570J40625_10041163313300002835FreshwaterMLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGVVTVLDSEC*
B570J40625_10152567323300002835FreshwaterLGYVSESKLKNLLVALGDGERDCEAARQRLCTIRDFALHAAFERVDRDSSLSVSGREINNFLRDNGVVTVLDSECQALVNYFDSDSNGKL*
Ga0007811_102193523300003787FreshwaterYQMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI*
Ga0065166_1009383333300004112Freshwater LakeFISQKNLMLGYVSESKLKNLLVALGDGERDCEAARQRLCTIRDFALHAAFERVDRDSSLSVSGREINNFLRDNGVVTVLDSECQALVNYFDSDSNGKL*
Ga0065175_100242233300004690FreshwaterMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI*
Ga0065176_100725613300004691FreshwaterYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI*
Ga0065171_102101733300004692FreshwaterQMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI*
Ga0007748_1089994513300004769Freshwater LakeLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGREINNFLRENGVVTVLDSEC*
Ga0007752_1108434413300004789Freshwater LakeKISMLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGVVTVLDSECQALVNYFDSDSNGKL*
Ga0049083_1031854223300005580Freshwater LenticMLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGREINNFLRENGVVTVLDSEC*
Ga0078894_1047705813300005662Freshwater LakeMLGYVSESKLKNLLVALGDGERDCEAARQRLCTIRDFALHAAFERVDRDSSLSVSGREINNFLRDNGVVTVLDSECQALVNYFDSDSNGKL*
Ga0070743_1003144413300005941EstuarineMLGYESERRLKNFLVAVGDGERELEFARSRLCSISDFAPHSAFQRLDRDYANSLSSREIVNFLRDNSVYHVSDSEAYILCQFFDSNGDSRLDFQEFL*
Ga0075443_1011828923300006165MarineKKMLGYESERRLKNFLVAIGDGERTLEASRQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAHSLV*
Ga0075473_1020660313300006875AqueousMLGYESESRLKNLLVAVGDGERGLEAARQRLCSIRDFAPHSAFQRLDRDNNNAISACEVLNFLRD*
Ga0105019_106147343300007513MarineMLGYDSERRLRNLLVAVGEGERDLEAARTRLCAIPDFSLHAAFERVDRDASASITSFELINFFRDNGVLHVAEGEAFELVKFFDSDGNCRLTFQEFI*
Ga0105019_107055853300007513MarineMLGYESERRLKNFLVAVGDGERELEFARSRLCNISDYAPHSGFERIDRDASGVVDSREICNFLRDNGVYHVSEGEAYTLVQFFDNNGNGRLEF*
Ga0105050_1009255413300007516FreshwaterMLGYESERRLKNFLVAIGEGERELENARARLCNIPDFAPHSAFQRIDRDYSTQVSSREFGNFLRDNQVYHVSESELHTLVCFFDSNGN*
Ga0102822_108076313300007558EstuarineLTTTKTKMLGYESERRLKNFLVAVGDGERQLEGARSRLCSIRDFAPHSAFQRMDRDYSGSVSSREVTNFLRDNSVYHVSESEAYTLV*
Ga0114346_120389123300008113Freshwater, PlanktonSTIINNLFLFRKKISMLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGVVTVLDSEC*
Ga0104258_110060133300008993Ocean WaterERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF*
Ga0104258_111285213300008993Ocean WaterKMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV*
Ga0102813_112461823300009003EstuarineMLGYESERRLKNFLVAVGDGERQLEGARSRLCSIRDFAPHSAFQRMDRDYSGSVSSREVTNFLRDNSVYHVSESEAYTLV*
Ga0115566_1008026213300009071Pelagic MarineMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERLDRDVSGAITSIEIINFLRDNSVYHVAESEAFNLVSFFDSDGNKRLTFQEFL*
Ga0115566_1008233823300009071Pelagic MarineMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTF*
Ga0115566_1018637713300009071Pelagic MarineMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV*
Ga0115552_106273423300009077Pelagic MarineMLGYASEERLKALLIAVGDGERDLEASRQRLCSIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0115552_132937813300009077Pelagic MarineMLGYESEKRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTF*
Ga0102815_1076550313300009080EstuarineMLGYESENRLKDLLVAVGDGERDLEIARQRLCQIRDFAPHAAFERIDRNMSNFVNSFELLNFLRDN*
Ga0102812_1064117113300009086EstuarineGYESENRLKDLLVAVGDGERDLEIARQRLCQIRDFAPHASFERIDRNMSNFVNSFELLNFLRDN*
Ga0114968_1014614913300009155Freshwater LakeMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSTFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI*
Ga0114995_1010928623300009172MarineLYNLIYLSLKTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF*
Ga0114995_1027039813300009172MarineMLCPASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF*
Ga0103867_102694913300009254River WaterESESRLKNLLVAVGDGERGLEAARQRLCSIRDFAPHSAFQRLDRDNNNAISACEVLNFLRD*
Ga0115005_1033627023300009432MarineMLGYESERRLKDFLVAVGDGERQLEGARSRLCSIRDFAPNSAFQRMDRNCSGNVSSREFIDFLRSQGVYHV*
Ga0115556_105863123300009437Pelagic MarineLIKLSFIIFNFILIARQKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0115007_1006004933300009441MarineMLSYESEGRLRNLLVGVGDGERDLEAARTRLCAIPDFSVHAAFERVDRDARCSITSHEILNFLRDNTVLHVAEPEAFELVKFFDSDGNARLTLNEFM*
Ga0115007_1134241713300009441MarineMLGYESERRLRNLLIAVGEGERDLEAARTRLCAIPDFDLRGAYERVDRDASAAITSLELLNFFRDNGVHHVAEGEAFELIKFFDS
Ga0115555_108309313300009476Pelagic MarineLIKLSFIIFNFILIARQKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCSIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0115571_112909913300009495Pelagic MarineTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF*
Ga0115571_131702013300009495Pelagic MarineERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0115569_1029040613300009497Pelagic MarineMLGYESERRLKNLMVAIQEGERDIEQSRQRLCSIADFALHSAFQRVDRNCSANISSHEIINFLRDNACYHVGESEAF*
Ga0115004_1021524323300009526MarineLIKLSFIIFNFILIARQKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSGKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0129287_1003919813300009538Beach Aquifer PorewaterMLGYESERRLKNFLVAVGDGERDLELARQRLCNIPDFAPHASFQRIDRDYSLQISSREFGNFLRDNGIYHCMDSEL*
Ga0115102_1071856523300009606MarineLIARQKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0115104_1002856413300009677MarineTNTMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTF*
Ga0136644_1033867913300010334Freshwater LakeMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLV*
Ga0138263_102934223300012415Polar MarineYESERRLKNFLVAIGDGERTLEASRQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEANSLV*
Ga0129329_104298813300012470AqueousKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0157599_113094233300012715FreshwaterLMLGYVSESKLKNLLVALGDGERDCEAARQRLCTIRDFALHAAFERVDRDSSLSVSGREINNFLRDNGVVTVLDSECQALVNYFDSDSNGKL*
Ga0157531_112473723300012727FreshwaterVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGVVTVLDSEC*
Ga0138272_113843413300012756Freshwater LakeSYLSEQKLRNLLVAVGDGERDLEASRQRLSAIRDFGLRSAFERIDRDSDNSVGPLEIINFLRDNGVLHVLESEAVNLVNFFDSDSNGLLNF*
Ga0129337_102055923300012968AqueousQMLGYESERRLKNFLVAVGDGERELEFARSRLCSISDFAPHSAFQRLDRDYANSLSSREIVNFLRDNSVYHVSDSEAYILCQFFDSNGDSRLDFQEFL*
Ga0129332_114676423300012969AqueousKKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF*
Ga0129332_137575013300012969AqueousQNKTQMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERLDRDVSGAITSIEIINFLRDNSVYHVAESEAFNLVSFFDSDGNKILTFQEFL*
Ga0164295_1027414323300013014FreshwaterMLGYVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGLVTVLDSECQALVNYFDSDSNGKL*
Ga0170791_1245353013300013295FreshwaterKLRNLLVAVGDGERDLEASRQRLSAIRDFGLRSAFERIDRDSDNSVGPLEIINFLRDNGVLHVLESEAVNLVNFFDSDSNGLLNF*
Ga0182092_108426223300016734Salt MarshAKQKLTSKMLGYESERRLTNLIVAVGDGERDLEGARQRLCSIRDFATHSAFERVDRDVSGAISSIELINFLRDNSVYHVAESEMFNLVCFFDSDGNRRLTYQEFI
Ga0182092_140280813300016734Salt MarshNYQTTMLGFESERRLKNFLVAVGDGERQLEGARSRLCSIRDFAPHSAFQRMDRDYSGSVSSREITNFLRDNSVYHVSESEAYTLV
Ga0182091_138703513300016766Salt MarshERDLEAARQRLCSIRDFALHSAFERVDRDATNWASSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0182082_104239513300016771Salt MarshMLGYESERRLKNFLVAVGDGERDLELARQRLCNIPDFAPHAAFQRIDRDYSLQVSTRELSNYLRDNGIYHVLDSELAILL
Ga0186338_100502813300017299Host-AssociatedMLGYESENRLKNLLVAVGDGERVLEASRQRLCNIRDFAPLALFERIDRDANGAITSYELNNFLRDHHVYTISESEAFNLVKFFDSDNDNRLSFQE
Ga0181592_1108117613300018421Salt MarshMLGYESERRLKNFLVAVGDGERDLELARQRLCNIPDFAPHAAFQRIDRDYSLQVSTRELSNYLRDNGIYHVLDSELAILV
Ga0192944_100680233300018692MarineMLSPPSEQRLKVLLVSVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSSKEIVSFLRDNSVFHCTDGEIFNLIKFFDSDGNAKLTF
Ga0192945_1028971313300019036MarineMLGFESERKLKNFLVAVGDGERNIEYARASLCNIADFAPRSAFERIDRDGSGQTDSREICNFLKDNGIYSVLESEAHALV
Ga0206129_1037901813300020182SeawaterMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0214201_105800013300020732FreshwaterMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI
Ga0210307_127869423300021336EstuarineMLGYESERRLTNLIVAVGDGERDLEAARQRLCSIRDFMTHSAFERIDRDCSGVISSVEIINFLRDNSVYHVAESEMFNLVCFFDSDGNRRLSFQEFL
Ga0206689_1100538613300021359SeawaterNQKLFMLGYESERRLKNFLVAVGDGERELEFARSRLCNISDYAPHSGFERIDRDASGVVDSREICNFLRDNGVYHVSEGEAHTLVQFFDNNGNGRLEF
Ga0063138_106180713300021935MarineQKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0222713_1011331613300021962Estuarine WaterMLGYESERRLKNFLVAVGDGERELEFARSRLCSISDFAPHSAFQRLDRDYANSLSSREIVNFLRDNSVYHVSDSEAYILCQFFDSNGDSRLDFQEFL
Ga0214921_1056954113300023174FreshwaterVSESKLKNLLVALGDGERDCEAARQRLCSIRDFALHAAFERVDRDSSLTVSGRELNNFLRENGVVTVLDSEC
Ga0208502_100654213300025339FreshwaterQMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI
Ga0208254_100398533300025355FreshwaterYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSAFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI
Ga0208107_104246733300025399FreshwaterKLKHLLIAIGDGERDLEISRQRLCSIRDFALKAAFERVDRDSDNAVAPPEIISFLRDNGIFHVLESEAVNLV
Ga0209198_119176513300025640Pelagic MarineMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERLDRDVSGAITSIEIINFLRDNSVYHVAESEAFNLVSFFDSDGNKRLTFQEFL
Ga0209505_103083733300025690Pelagic MarineMLGYASEERLKALLIAVGDGERDLEASRQRLCSIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0209602_118619613300025704Pelagic MarineMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0209603_115168433300025849Pelagic MarineMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0209308_1020481023300025869Pelagic MarineMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLISFFDSDGNKRLTF
Ga0209534_1032444513300025880Pelagic MarineMLGYESERRLKNFLVAVGDGERDLELARQRLSNIPDFAPHSAFQRIDRDYTLQITSRELANFLRDNGIYHVMDSELHTLVCFFDSNGN
Ga0208176_105225913300027248EstuarineMLGYESERRLTNLIVAVGDGERDLEAARQRLCSIRDFMTHSAFERIDRDCSGVISSVEIINFLRDNSVYHVAESEMFNLVCFFDSDGNRRLSFQEFLQIFLPCEDNLLRNMTLD
Ga0208796_109609323300027308EstuarineMLGYESERRLKNFLVAVGDGERQLEGARSRLCSIRDFAPHSAFQRMDRDYSGSVSSREVTNFLRDNSVYHVSESEAYTLV
Ga0208966_104220933300027586Freshwater LenticMLGYVSESKLKNLLVALGDGERDCEGARQRLCSIRDFALHAAFERVDRDSSLTVSGREINNFLRENGVVTVLDSEC
Ga0209710_107590713300027687MarineKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0209710_110569613300027687MarineIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0208671_1012118913300027757EstuarineTVYNFILRKTQMLGYESERRLKNFLVAVGDGERELEFARSRLCSISDFAPHSAFQRLDRDYANSLSSREIVNFLRDNSVYHVSDSEAYILCQFFDSNGDSRLDFQEFL
Ga0209279_1001995233300027771MarineMLGYESERRLKNFLVAIGDGERTLEASRQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAHSLV
Ga0209502_1007266013300027780MarineMLGYESERRLKNLMVAIQEGERDIEQSRQRLCSIADFALHSAFQRVDRNCSANISSHEIINFLRDNACYHVGESEAF
Ga0209502_1017519623300027780MarineMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSGKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0209502_1038085923300027780MarineLIYLSLKTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0209302_1023219213300027810MarineMLSYESEGRLRNLLVGVGDGERDLEAARTRLCAIPDFSVHAAFERVDRDARCSITSHEILNFLRDNTVLHVAEPEAFELVKFFDSDGNARLTLNEFM
Ga0209092_1031047923300027833MarineMLCPASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0209400_111022733300027963Freshwater LakeMLGYISEQKLRNLLVAVGDGERDLEGARQRLCSIRDFALHSTFERFDRDFTNSVSPREIINFLRDNAIHHVLESEAINLVQYFDSDNNGILSFQEFI
Ga0209702_1016939323300027976FreshwaterMLGYESERRLKNFLVAIGEGERELENARARLCNIPDFAPHSAFQRIDRDYSTQVSSREFGNFLRDNQVYHVSESELHTLVCFFDSNGN
Ga0256412_118058313300028137SeawaterLGFSSSQKLKSLLIAVGDGERDLEAARQRLCSIRDFALHSAFERLDRDASNSLSSREIVNFLRDNSVFSVSDSEAYNLVKFFDSDGNSRLTF
Ga0307401_1010312513300030670MarineSEQRLKVLLVSVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSSKEIVSFLRDNSVFHCTDGEVSELIKFFDSDGNGRLTF
Ga0307401_1044982713300030670MarinePTKTKMLSPPSEQRLKVLLVSVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSSKEIVSFLRDNSVFHCTDGEIFNLIKFFDSDGNAKLTF
Ga0307401_1045486413300030670MarineNQIHMLGYASEERLKALLIAVGDGERDLEAARQRLCAIRDFALHSAFERTDRDSTNWVSSKELVDFLRDNGVFHVSDADAFDLVKFFDSDGNSKLSFQEFI
Ga0307398_1023136423300030699MarineLKPTKTKMLSPPSEQRLKVLLVSVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSSKEIVSFLRDNSVFHCTDGEIFNLIKFFDSDGNAKLTF
Ga0307398_1062634113300030699MarineKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKELISFLRDNSVFHCTDGEVSELIKFFDSDGNGRLTF
Ga0307400_1008639513300030709MarineRKSKNTKLTTIKMLGYESERRLKNFLVAVGDGERQLEGARARLCSIRDFAPNAAFQRMDRDYSGSVSSREIVNFLRDNSVYHVSESEAYSLI
Ga0307400_1013215713300030709MarineNKPKKMLGYESERRLKNFLVAIGDGERTLEASRQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAHSLV
Ga0307400_1019168723300030709MarineKPTKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKELISFLRDNSVFHCTDGEVSELIKFFDSDGNGRLTF
Ga0073964_1174315223300030788MarineLRNLCVAVGDGERDLEAARQRLCNIRDFALLAAFERVNRDCTGSVTSVEIVNFLRENGIGHVSEGEAYNLVCFFDSDGSKRLTFQEFI
Ga0302126_1009635033300031622MarineMLSYDSETRLRNLLVAVGEGERDLEAARTRLCAIPDFSLHAAFERVDRDATASITALEIINYLRD
Ga0302121_1005989523300031626MarineRLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSGKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0307386_1006322313300031710MarineMLGPESERRLKNLLVAVGDGERGLESARASLCNIRDFAPLSGFERIDRNGSRAVDGGELCNFLRD
Ga0307396_1027265613300031717MarineQIHMLGYASEERLKALLIAVGDGERDLEAARQRLCAIRDFALHSAFERTDRDSTNWVSSKELVDFLRDNGVFHVSDADAFDLVKFFDSDGNSKLSFQEFI
Ga0307397_1003336613300031734MarinePKHEMLGYESERRLTNLLVAIGDGERDLEGARQRLCSIRDFAPHSAFERVDRDMSGAVSSIEFINFLRDNSVYHVAESEAFNLVGFFDSDGNKRLTFQEFL
Ga0307397_1003350743300031734MarinePQTMLGYESERKLKNFLVAVGDGERQLEGSRSRLCSIRDFAPNAAFQRMDRDYSGSVSSREVVNFLRDN
Ga0307387_1016340613300031737MarinePTKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKELISFLRDNSVFHCTDGEVSELIKFFDSDGNGRLTF
Ga0307384_1028208013300031738MarineKKQPNTMPGYETERRLKNFLVAVGDGERQLEGARSRLCSIRDFAPNSAFQRMDRDYSGSVSSREIINFLRDN
Ga0315899_1041535313300031784FreshwaterMLGYVSESKLKNLLVALGDGERDCEGARQRLCSIRDFALHAAFERVDRDSSLSVSGREINNFLRDNGVVTVLDSEC
Ga0314684_1004383513300032463SeawaterVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314684_1072691013300032463SeawaterKMLCPASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314670_1003147923300032470SeawaterLCVAVGDGERDLEGARHSLCSIRDFAPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314670_1013225313300032470SeawaterTKMLCPASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314668_1022149513300032481SeawaterLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314679_1010378423300032492SeawaterQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314679_1010734613300032492SeawaterEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314688_1058398413300032517SeawaterQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314689_1004842813300032518SeawaterDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314689_1014945013300032518SeawaterTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314680_1004385023300032521SeawaterLTQNKTHMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314680_1004686213300032521SeawaterLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0314677_1055306323300032522SeawaterQNKTHMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314682_1004124133300032540SeawaterMKREYMVAKMLCPASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314682_1013864433300032540SeawaterLKTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314682_1014650413300032540SeawaterKIAMLGYASEERLKALLIAVGDGERDLEASRQRLCAIRDFALHSAFERTDRDATNWVSSKEIVDFLRDNGVFHVSDAEAYDLVKFFDSDGNGKLSF
Ga0314674_1014180513300032615SeawaterMLGFESERKLKNFLVAVGDGERNIEYARASLCNIADFAPRSAFERIDRDGSGQTDSREICNFLRDNGIHSVLESEAHALV
Ga0314671_1005188413300032616SeawaterTNPKMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0314685_1004162413300032651SeawaterNHMLGYESERRLTNLCVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314669_1003343513300032708SeawaterKMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0314681_1003687923300032711SeawaterLTQIKNHMLGYESERRLTNLCVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314686_1044071723300032714SeawaterLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314695_107078213300032724SeawaterASEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIFNLIKFFDSDGNCKLTF
Ga0314695_136888213300032724SeawaterKTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314693_1007937223300032727SeawaterGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314697_1015782813300032729SeawaterMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314711_1015700323300032732SeawaterVMLGFESERKLKNFLVAVGDGERNIEYARASLCNIADFAPRSAFERIDRDGSGQTDSREICNFLKDNGIYSVLESEAHALV
Ga0314701_1012626513300032746SeawaterQRLKALLVALGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314708_1007474213300032750SeawaterNFAKKLTNPKMLGYESERRLKNFLVAIGDGERNLEAARQSLCSIRDFAPHSAFERIDRDCSGSVTSSEFINFLRDNSVYHVAESEAYSLV
Ga0314694_1021368613300032751SeawaterTNKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314700_1015434913300032752SeawaterKTKMLCPPSEQRLKALLVAVGDGERDLEATRQRLCSIPDFALHSAFERVDRDVSNALSTKEIISFLRDNSVFHCTDGEIYNLIKFFDSDGNAKLTF
Ga0314700_1062566213300032752SeawaterTHMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTFQEFL
Ga0314692_1023493223300032754SeawaterQNKTHMLGYESERRLTNLLVAVGDGERDLEGARQRLCSIRDFTPHSAFERVDRDCSGAVSSVELINFLRDNSVYHVAEGEAFNLVSFFDSDGNKRLTSQEFL
Ga0334990_0118694_130_3303300034068FreshwaterMLGYESERKLKNFLIGICDGERALESCRQRLCSIRDFALHSAFERINRDLNGQISSFEILAFLRDN
Ga0310130_0306879_77_3703300034073Fracking WaterMLGYESERRLKNFLVAVGDGERELEFARSRLCSISDFAPHSAFQRLDRDYANSLSSRDIVNFLRDNSVYHVSDSEAYILCQFFDSNGDSRLDFQEFL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.