NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046768

Metagenome / Metatranscriptome Family F046768

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046768
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 47 residues
Representative Sequence MYNKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV
Number of Associated Samples 75
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 22.67 %
% of genes near scaffold ends (potentially truncated) 84.67 %
% of genes from short scaffolds (< 2000 bps) 99.33 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(78.667 % of family members)
Environment Ontology (ENVO) Unclassified
(93.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(87.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.28%    β-sheet: 0.00%    Coil/Unstructured: 84.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF00665rve 5.33
PF13966zf-RVT 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 5.33
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 5.33
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 5.33
COG4584TransposaseMobilome: prophages, transposons [X] 5.33

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005841|Ga0068863_100371502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1396Open in IMG/M
3300009976|Ga0105128_118782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300009976|Ga0105128_121908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300009989|Ga0105131_139978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300009989|Ga0105131_142207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300009992|Ga0105120_1042781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300009992|Ga0105120_1044562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300009992|Ga0105120_1049774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300009994|Ga0105126_1035312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300009995|Ga0105139_1030793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum864Open in IMG/M
3300009995|Ga0105139_1045941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300009995|Ga0105139_1048803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300009995|Ga0105139_1079742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300009995|Ga0105139_1082224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300010371|Ga0134125_11403711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum761Open in IMG/M
3300010396|Ga0134126_12485558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300010399|Ga0134127_13163314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300010400|Ga0134122_12673471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300010401|Ga0134121_11720014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300012949|Ga0153798_10202788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300014968|Ga0157379_11993693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300015270|Ga0182183_1038957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300015273|Ga0182102_1031087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300015280|Ga0182100_1049808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum640Open in IMG/M
3300015284|Ga0182101_1044684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum662Open in IMG/M
3300015284|Ga0182101_1054163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum622Open in IMG/M
3300015293|Ga0182103_1051230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
3300015293|Ga0182103_1086274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300015297|Ga0182104_1066140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015297|Ga0182104_1090817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015297|Ga0182104_1093769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300015297|Ga0182104_1117929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015301|Ga0182184_1044945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum663Open in IMG/M
3300015309|Ga0182098_1055158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015310|Ga0182162_1052718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum698Open in IMG/M
3300015310|Ga0182162_1117900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300015311|Ga0182182_1077516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015313|Ga0182164_1018575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1006Open in IMG/M
3300015313|Ga0182164_1078934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015313|Ga0182164_1091390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015313|Ga0182164_1126104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300015315|Ga0182120_1010691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1194Open in IMG/M
3300015315|Ga0182120_1049676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300015315|Ga0182120_1140101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300015316|Ga0182121_1018603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1060Open in IMG/M
3300015316|Ga0182121_1023814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum981Open in IMG/M
3300015316|Ga0182121_1032904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum883Open in IMG/M
3300015316|Ga0182121_1037969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum841Open in IMG/M
3300015316|Ga0182121_1088078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300015316|Ga0182121_1120275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300015317|Ga0182136_1034153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum838Open in IMG/M
3300015317|Ga0182136_1077358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum634Open in IMG/M
3300015317|Ga0182136_1084235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015317|Ga0182136_1138422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015318|Ga0182181_1053587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015319|Ga0182130_1040371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300015319|Ga0182130_1069367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300015319|Ga0182130_1088212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015319|Ga0182130_1115482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015320|Ga0182165_1049459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum760Open in IMG/M
3300015324|Ga0182134_1070581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum669Open in IMG/M
3300015324|Ga0182134_1110509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300015327|Ga0182114_1113735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300015328|Ga0182153_1080534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300015329|Ga0182135_1051374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum763Open in IMG/M
3300015329|Ga0182135_1055261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum744Open in IMG/M
3300015329|Ga0182135_1113058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300015329|Ga0182135_1121899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300015330|Ga0182152_1127501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015331|Ga0182131_1043331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum815Open in IMG/M
3300015331|Ga0182131_1078832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300015331|Ga0182131_1092154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300015331|Ga0182131_1122744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300015331|Ga0182131_1141012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015333|Ga0182147_1069362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum720Open in IMG/M
3300015333|Ga0182147_1096834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum634Open in IMG/M
3300015334|Ga0182132_1046334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum835Open in IMG/M
3300015334|Ga0182132_1059887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum762Open in IMG/M
3300015334|Ga0182132_1096108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum637Open in IMG/M
3300015336|Ga0182150_1013375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1198Open in IMG/M
3300015336|Ga0182150_1133539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015337|Ga0182151_1071751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum699Open in IMG/M
3300015337|Ga0182151_1123877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300015338|Ga0182137_1099868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300015339|Ga0182149_1075871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum705Open in IMG/M
3300015339|Ga0182149_1162326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015340|Ga0182133_1100269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum664Open in IMG/M
3300015340|Ga0182133_1106595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015340|Ga0182133_1112911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015348|Ga0182115_1038693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1345Open in IMG/M
3300015348|Ga0182115_1070187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1063Open in IMG/M
3300015348|Ga0182115_1161534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum718Open in IMG/M
3300015349|Ga0182185_1016707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1596Open in IMG/M
3300015349|Ga0182185_1095135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum850Open in IMG/M
3300015349|Ga0182185_1138165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300015350|Ga0182163_1040838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1272Open in IMG/M
3300015350|Ga0182163_1050185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1176Open in IMG/M
3300015350|Ga0182163_1287496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300015352|Ga0182169_1008654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula2257Open in IMG/M
3300015352|Ga0182169_1093999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum954Open in IMG/M
3300015352|Ga0182169_1201230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300015352|Ga0182169_1264475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300015353|Ga0182179_1107458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum841Open in IMG/M
3300015353|Ga0182179_1157548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015353|Ga0182179_1217241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum611Open in IMG/M
3300015353|Ga0182179_1220388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum607Open in IMG/M
3300015353|Ga0182179_1287501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015353|Ga0182179_1295000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015354|Ga0182167_1108782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1016Open in IMG/M
3300015354|Ga0182167_1184309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum766Open in IMG/M
3300015354|Ga0182167_1303230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015354|Ga0182167_1345514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300017412|Ga0182199_1202945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300017414|Ga0182195_1074350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum771Open in IMG/M
3300017414|Ga0182195_1081101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum747Open in IMG/M
3300017414|Ga0182195_1105396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum678Open in IMG/M
3300017414|Ga0182195_1157429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300017414|Ga0182195_1204633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300017414|Ga0182195_1208904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300017421|Ga0182213_1193776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300017432|Ga0182196_1030841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum870Open in IMG/M
3300017432|Ga0182196_1084622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300017432|Ga0182196_1128631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300017435|Ga0182194_1094120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300017440|Ga0182214_1122877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300017447|Ga0182215_1103567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300017693|Ga0182216_1054482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum869Open in IMG/M
3300017693|Ga0182216_1089678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum723Open in IMG/M
3300017693|Ga0182216_1105178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300017792|Ga0163161_11211581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300020023|Ga0182178_1010288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300020223|Ga0182118_102230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum877Open in IMG/M
3300025972|Ga0207668_11116544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300025972|Ga0207668_11629103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300028050|Ga0268328_1018880All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum797Open in IMG/M
3300028050|Ga0268328_1019733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum786Open in IMG/M
3300028062|Ga0268342_1037292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300028064|Ga0268340_1086170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300028151|Ga0268308_1017527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300028473|Ga0268319_1010489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300028477|Ga0268309_1007257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum688Open in IMG/M
3300028526|Ga0268339_1003178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum846Open in IMG/M
3300032465|Ga0214493_1081268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum772Open in IMG/M
3300032502|Ga0214490_1128582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300032551|Ga0321339_1086285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum720Open in IMG/M
3300032551|Ga0321339_1122531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300032689|Ga0214497_1140175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300032812|Ga0314745_1100512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300032889|Ga0314751_1077445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300032913|Ga0314739_1071481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere78.67%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated8.67%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere5.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020223Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032913Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068863_10037150223300005841Switchgrass RhizosphereMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMMQKYYV*
Ga0105128_11878223300009976Switchgrass AssociatedMHRKWEGPFIVASMVRPEACRLSTLEGVEDPYSWNKDML
Ga0105128_12190813300009976Switchgrass AssociatedVTSMARPEACRIRTLEGTEDPYSWNKDMLQKYYV*
Ga0105131_13997813300009989Switchgrass AssociatedGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV*
Ga0105131_14220713300009989Switchgrass AssociatedRIPKAKQKGKMHSKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDML*
Ga0105120_104278113300009992Switchgrass AssociatedKQQEKMHSKWEGPFLVASMVRPEACRIRTLEGVEEPYSWNKDMLQRYYV*
Ga0105120_104456213300009992Switchgrass AssociatedGPFIIVSMARPEACRLRTLEGTEDPYSWNKDMLQRYYA*
Ga0105120_104977413300009992Switchgrass AssociatedMHSKWEGPFLVASIARPEACRLRTLEGVEEPYSWNKDMLQRYFV*
Ga0105126_103531213300009994Switchgrass AssociatedIPKAKQKGKMHNKWEDPFIVASMARPEACGLCTLEGTEDPYLWNKDMLQKYYM*
Ga0105139_103079313300009995Switchgrass AssociatedNLVFRRMLKAKQKGKMYNKWEGPFIVASMARLEACRLRTLEGTEDPYSWNKDML*
Ga0105139_104594113300009995Switchgrass AssociatedMHNKWEGPFIVASMARPEACRLRTLEGTKDTYSWNKDMLQKYYV*
Ga0105139_104880313300009995Switchgrass AssociatedMYSKWEGPFLVTSMARPEACRLRTLEGVEEPFSWNKDLLQ*
Ga0105139_107974213300009995Switchgrass AssociatedMHSKWEGPFIVASMARPEACRLCTLEGTKYPYSWNKDMLQTYYM*
Ga0105139_108222413300009995Switchgrass AssociatedMHSKWEGPFLVDSMARPEACRLCTLEGVEEPNSWNKDMLQRYYV*
Ga0134125_1140371113300010371Terrestrial SoilSKWDGPFIVASMVRLEACRLHTLEGFEDPYSWNKDMLQKYYV*
Ga0134126_1248555823300010396Terrestrial SoilHSKWEGSFLVASMARPEVCRLRTLEGVEEPYSRNKDMLQRYYV*
Ga0134127_1316331413300010399Terrestrial SoilVASMARPEAYRLHTLEGTEDPYSWNKDMLQKYYV*
Ga0134122_1267347113300010400Terrestrial SoilNKWKGPFMVTSMAMPEACGLPTLEGVEDPYSWNKDMLQCYYV*
Ga0134121_1172001413300010401Terrestrial SoilPKAKQTSKMHSKWEGPFIVASMAMPEACRLRTLEDTEDSYSWNKDMLQKYYV*
Ga0153798_1020278813300012949Switchgrass DegradingKWEGPFIVASMARPEACRLRTIEGTEDPYSWNKDMLQKYYV*
Ga0157379_1199369323300014968Switchgrass RhizosphereGPFIVTSMARPEVCRLRMLEGTKDPYSWNKDMLQKYYV*
Ga0182183_103895723300015270Switchgrass PhyllosphereGPFLVTSMARPEACRLRTLEGVEEPYSWNKDMLQRYYI*
Ga0182102_103108713300015273Switchgrass PhyllosphereGPFTVASMVRPEDCRLRTLEGIKDPYSWNKDMLQKYYV*
Ga0182100_104980823300015280Switchgrass PhyllospherePFLATSMARPESCRLRTLEGVEEPYSWNKDMLQRYFV*
Ga0182101_104468423300015284Switchgrass PhyllosphereMYSKWEGPFLVISMTRPEACRLHTLEGVEEPYSWNKDMLQRYYV*
Ga0182101_105416313300015284Switchgrass PhyllosphereKMYSKWKGPFIVAFMVRPEACRIRTKEGIEDPYSWNKDMLQKYYF*
Ga0182103_105123023300015293Switchgrass PhyllosphereRQIPKSKQKEKMYSKWEGPFIVTSMARPEACRHQTLDGAEEPYSWNKDMLQKYFV*
Ga0182103_108627423300015293Switchgrass PhyllosphereMLKAKQKGKMYNKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182104_106614013300015297Switchgrass PhyllosphereVRPREIKEGDLVLRRIPKSKQQGKMYSKREGPFLVALMARPEACRIHTLEGVEEPYSWNKDMLQRYFV*
Ga0182104_109081713300015297Switchgrass PhyllosphereKAKQKGKMHSKWEGPFIVTSMARLEACRLRTLEGTEDPYSWNKDMLQKYYM*
Ga0182104_109376913300015297Switchgrass PhyllosphereISKSKIQGKMYSKWEGPFLVTSMARPEACRLRTLEGVKDPYSWNKDMHQRYYV*
Ga0182104_111792913300015297Switchgrass PhyllosphereEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182184_104494513300015301Switchgrass PhyllosphereRIPKSKLQGKMYNKWKGPFMVTSMARPEACGLPTLESVEDPYSWNKDMLQCYYV*
Ga0182098_105515823300015309Switchgrass PhyllosphereMHRKWEGPFLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYYV*
Ga0182162_105271813300015310Switchgrass PhyllosphereIVASMVRPEACRLCTLEGVEDPYSRNKDMMQKYYV*
Ga0182162_111790013300015310Switchgrass PhyllosphereSKSKQQGKMHRKWEGPFLVASMARPEACRLRTLEGVEEPYSWNKDMLQR*
Ga0182182_107751613300015311Switchgrass PhyllosphereMYNKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182164_101857513300015313Switchgrass PhyllosphereERPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV*
Ga0182164_107893423300015313Switchgrass PhyllosphereKWDGPFIVASMVRPEACGLRTLEGVEDPYSWNKHMLQKYYV*
Ga0182164_109139013300015313Switchgrass PhyllosphereKAKQKGRMHSKWEGPFIVASMARLEACRLRMLEGTEDPYSWNKDML*
Ga0182164_112610413300015313Switchgrass PhyllosphereVLRRIPKNKLKGKMHSKWEGPFLVTSMARPEACRLRTLDDAEDPYSWSKDMLQH
Ga0182120_101069113300015315Switchgrass PhyllosphereSKWEGPFIIASMVRPGACRLRTLEGIKDPYSWNKDML*
Ga0182120_104967613300015315Switchgrass PhyllosphereFLVTLMERPEACRLCTLEGVEEPYSWHKDMLQRYDV*
Ga0182120_114010113300015315Switchgrass PhyllosphereFIVASMARPEACRLRTLEGAEEIYSWNKVMLLKYLV*
Ga0182121_101860313300015316Switchgrass PhyllosphereMHSKWEGPFIVASMARPEACRLHTLEGTEDPYSWNKDMLQKYYV*
Ga0182121_102381413300015316Switchgrass PhyllosphereLVLRQIPKSKQKEKMYSKWEGPFIVTSMARPEACRHQTLDGAEEPYSWNKDMLQKYFV*
Ga0182121_103290413300015316Switchgrass PhyllosphereGKMHRKWEGPFLVTLMARPEACRLRTLEGVEEPYS*
Ga0182121_103796913300015316Switchgrass PhyllosphereLRRIPKAKQKGKMHSKWDEPFIVASMVRPEACRLRTLEGVEDPYSWNKDTMCRNNVRARGEK*
Ga0182121_108807813300015316Switchgrass PhyllosphereVLRRIPKAKQKGKMHNKWEGTFIVASMARPEACRLRTLEGTEDPYSWNKNMLQKYYV*
Ga0182121_112027513300015316Switchgrass PhyllosphereIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV*
Ga0182136_103415313300015317Switchgrass PhyllosphereMYSKWEGPFLVISMTRTEACRLHTLEGVEEPYSWNKDMLQRYYV*
Ga0182136_107735813300015317Switchgrass PhyllospherePKAKQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLHKYYV*
Ga0182136_108423513300015317Switchgrass PhyllosphereKAKQKGKMHREGPFIVASMARPGACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182136_113842213300015317Switchgrass PhyllosphereFIVASMVRPEACRLRTMEGIEDPYSWNKDMLQKYYV*
Ga0182181_105358713300015318Switchgrass PhyllosphereYNKWEGPFIVASMARPDACRLRMLGGTEDPYSWNKDMLQRYYV*
Ga0182130_104037123300015319Switchgrass PhyllosphereSKLQGKMYSKWEGLFLVTSMARPEACRLQTLEGVEEPYSWNKDMLQRYFV*
Ga0182130_106936723300015319Switchgrass PhyllosphereMPKAKQKGKMHSKWEGPFIVASMARPEACRLRTLEGTEDLYSWNKDMLQKYYV*
Ga0182130_108821223300015319Switchgrass PhyllosphereVLRRIPKAKQNCKMYRKWEGPFIVASMVRPEACRLRTMEGVEDPYSWNK
Ga0182130_111548223300015319Switchgrass PhyllosphereMEGDLILRRIPKGKQQGKMHSKWEGPFLVPSMARPEACRLRTLEGVRETYSWNK
Ga0182165_104945913300015320Switchgrass PhyllosphereWEGPFIVASMVRPEACRLRTLEGTEDPYSWNKDMVQKYYM*
Ga0182134_107058113300015324Switchgrass PhyllosphereMHSKWEDPFIIASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182134_111050913300015324Switchgrass PhyllosphereRPREIKEGDLVPWRIPKSKLKGKMHSKWEWTFLVTSMARPEACRLRTLDKVEDPYSWNKDMLQRYYV*
Ga0182114_111373513300015327Switchgrass PhyllosphereKMHSKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYM*
Ga0182153_108053413300015328Switchgrass PhyllosphereDPFIIASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182135_105137423300015329Switchgrass PhyllosphereVLRRIPKNKLKGNMHNKWEGPFLVTSMARPEACRLRTLDGAEDPY
Ga0182135_105526113300015329Switchgrass PhyllosphereKMHSKWEGPFLVISMARPEACRLRTLEGVEEPYSWNKDML*
Ga0182135_111305813300015329Switchgrass PhyllosphereFIVASMERPEACRLRMLEGTEDPYSWNKDMLQKYYV*
Ga0182135_112189923300015329Switchgrass PhyllosphereVKPREIQEGDLVLSRIPKAKQKGKMHSKWDGPFIVASMVRPEACRLHTDPYSWNKDMLQKYYV*
Ga0182152_112750113300015330Switchgrass PhyllospherePFKNRVLQVPFIVASMARPEAYRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182131_104333113300015331Switchgrass PhyllosphereVKPIEIREGDLVLRRILKAKQKGKMHNKWEEPFIVASMVRPEACRLHTDPYSWNKDMLQKYYV*
Ga0182131_107883213300015331Switchgrass PhyllosphereGKMYNKWEGPFLVTSMARPEACRLRTLEGVKDPYSWNKDMHQRYYV*
Ga0182131_109215413300015331Switchgrass PhyllosphereWEGPFLVASMARPETCKLRTLEGVKEPYSWNKDMLQRYFV*
Ga0182131_112274423300015331Switchgrass PhyllosphereMHSKWEGPFLVVSMARPEACRLRTLEGDEEPYSWNK
Ga0182131_114101213300015331Switchgrass PhyllosphereIPKNKLKGKMHSKWEGSFLVTSMARPEACRLRTLDGVEDPYSWNKDMLQRYYI*
Ga0182147_106936213300015333Switchgrass PhyllosphereMCSKWEGPFLVTSMARPEACRLRTLEGTEDPYSWNKEMLQKYFM*
Ga0182147_109683413300015333Switchgrass PhyllosphereFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182132_104633413300015334Switchgrass PhyllosphereMHSKWEGPFLVASMARPEACRLRTLEGAEESYSWNKDMLQRY
Ga0182132_105988713300015334Switchgrass PhyllospherePFLVSLMARPEVCRLRTLEGVEEPYSWNKDMLQRYYV*
Ga0182132_109610823300015334Switchgrass PhyllosphereMLKAKQKGKMYNKWEGPFIVASMARLEACRLRTLEGTEDPYSWNKDML*
Ga0182150_101337513300015336Switchgrass PhyllosphereRIPKAKQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV*
Ga0182150_113353913300015336Switchgrass PhyllosphereMHTKWEEPFFVTSMARPEACRLRTLDGIEDPYSWNKDMLQHYYDPYGEKKG
Ga0182151_107175113300015337Switchgrass PhyllosphereAKQKGKMHNKWEGPFIVASMARPEACRLRTMEGTEDPYSWNKDMLQKYYV*
Ga0182151_112387713300015337Switchgrass PhyllosphereMLRRIPKNKLKGKMHSKWEGPFLVTSMARSEVCRLRALNGVKDPYSWNKDMLQRYYV*
Ga0182137_109986823300015338Switchgrass PhyllosphereMDKMYSKLEGPFIIASMARSEAYRLHTLEGTEDPYSWNKDMLQNYYV*
Ga0182149_107587113300015339Switchgrass PhyllosphereHSKWEGPFLVTSMARPEACRLRTLEGVDEPYSWNKDMLQHYYV*
Ga0182149_116232613300015339Switchgrass PhyllosphereEGPFLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYFV*
Ga0182133_110026913300015340Switchgrass PhyllosphereRIPKSKQQGKMHSKWEGPFLVSLMARPEVCRLRTLEGVEEPYSWNKDMLQRYYV*
Ga0182133_110659523300015340Switchgrass PhyllosphereRKMYSKWEGSFLVASIARPEACRLHMLEGVKEPYSWNKDMFQRYFV*
Ga0182133_111291113300015340Switchgrass PhyllosphereKMYSKWEGPYLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYNV*
Ga0182115_103869313300015348Switchgrass PhyllosphereAKQKGKMYSKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV*
Ga0182115_107018713300015348Switchgrass PhyllosphereSKMQGKMYNKWEGPFLVTSMARPEACRLRTLEGVEDPYSWNKDILQRYYV*
Ga0182115_116153423300015348Switchgrass PhyllosphereMKGKMYSKWEGPFLVSSMARPEACRLRTLEGVEDPYLWNKDMLQKYFV*
Ga0182185_101670733300015349Switchgrass PhyllosphereMYSKWEGPFLVILMTRPEACRLHTLEGVEEPYSWNKDMLQRYYV*
Ga0182185_109513513300015349Switchgrass PhyllosphereEGYLVLRRIPNSKLQGKMYSKWEGLFLVTSMARPEACRLQTLEGVEEPYSWNKDMLQRYYVYFLASFL*
Ga0182185_113816513300015349Switchgrass PhyllosphereMYSKWEGPFIVASMARPEASRLRTLEGTEDPYSWNKDMLQKYFV*
Ga0182163_104083823300015350Switchgrass PhyllosphereRIPKAKQKSKMHSKWEGPFIVASMARPEACRLRTLEGTKDPYSWNKDMLMKYSM*
Ga0182163_105018513300015350Switchgrass PhyllosphereISKAKQKGKMYSKWEGPFIVTSMARPEACRLHTQEGTEDPYSWNNDMLQKYYV*
Ga0182163_128749613300015350Switchgrass PhyllosphereLVLRRIPKIKQQGKMYNKWEGSFLVASMARPEACRLHMLEGVKEPYSWNKDMFQRYFV*
Ga0182169_100865443300015352Switchgrass PhyllosphereMYSKWEGPFLIISMTRPEACRLHTLEGVEEPYSWNKDMLQRYYV*
Ga0182169_109399913300015352Switchgrass PhyllosphereKEGDLVLRRIPKSKQQGKMYNKWEGLFLVASMARLETCRLRTLEGVEEPYSWNKDMLQRYYI*
Ga0182169_120123013300015352Switchgrass PhyllospherePKSKQQGKMYRKWEGSFLVASMARPEACRLRTLEGVDEPYSWNKDMLQKYFV*
Ga0182169_126447513300015352Switchgrass PhyllosphereVLRRIPKSKMQGKMYSKWEGLFLVTSMARPEACRLRTLEGVEEPYSWNKDMLQRYYV*
Ga0182179_110745813300015353Switchgrass PhyllosphereVLRRIPKNKLKGNMHNKWEGPFLVTSMARPEACRLRTLDDAEDPYSWSKDMLQHYYV*
Ga0182179_115754813300015353Switchgrass PhyllosphereRIPKAKQKGKMHSKWEVPFIVASMARLEACRLRMLEGTEDPYSWNKDMLQKYYV*
Ga0182179_121724113300015353Switchgrass PhyllosphereKIYSKWEGPFLVALMARPEACRICTLEGVEEPYSWNKDMLQHYFV*
Ga0182179_122038813300015353Switchgrass PhyllosphereKSKQQGKMHSKWEGPFLVASMARPEACRLRTLEGVEEPYSWNKDSFSATMSSFS*
Ga0182179_128750113300015353Switchgrass PhyllosphereSKWEGPFLIDSMARPEACRLRTLEGVEEPYSWNKDMLQRYYV*
Ga0182179_129500013300015353Switchgrass PhyllosphereEGPFLVVSMARPEAPRLRTLEGDEEPCSWNKDMLQRYYV*
Ga0182167_110878223300015354Switchgrass PhyllosphereMQTREGDLVLHRISKGKLKGKMHSKWEGPFLVTSMARPEACRLHTLDGVEDPYSWNKDML
Ga0182167_118430913300015354Switchgrass PhyllosphereTYSKWEGPFLVASMARPEACRLRMLEGTEDPYSWNKDML*
Ga0182167_130323013300015354Switchgrass PhyllosphereKAKQMDKMYNKLEGLFIIASMARSEAYRLHTLEGTEDPYSWNKDMLQNYYV*
Ga0182167_134551413300015354Switchgrass PhyllosphereLALRRIPKAKQKSKMHSKWEGPFIVASMARPEACRLRTLEGTKDPYSWNKDMLMKYSM*
Ga0182199_120294513300017412Switchgrass PhyllosphereDLVLRRIPKAKQKGKMYNKWEGPFIVASMMRPEACRLRTMEGIEDPYSWNKDIL
Ga0182195_107435013300017414Switchgrass PhyllosphereRKNKLWGKMYSKWDGSYLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYNV
Ga0182195_108110113300017414Switchgrass PhyllosphereKAKQKGKMHSKWDGPFIVTSMVRPEACRPRTLEGVEDPYSWNKDML
Ga0182195_110539613300017414Switchgrass PhyllosphereFIVASMVRPEACRLCTLEGVEDPYSRNKDMIEKYYV
Ga0182195_115742913300017414Switchgrass PhyllosphereHSKWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDILQKYNV
Ga0182195_120463313300017414Switchgrass PhyllosphereKMHSKWEGPFLVTSMARPEACRLRTLEGVEEPYSWNKDMLQRYYV
Ga0182195_120890413300017414Switchgrass PhyllosphereMHSKWEGPFIVSSMARPEACRLHTLEGTEDPYSWNKDMLQKYYV
Ga0182213_119377613300017421Switchgrass PhyllosphereHRISKSKIQGKMYSKWEGPFLVTSMARPEAYRLCTLEGAEDPYYRNKDMLQRYYV
Ga0182196_103084133300017432Switchgrass PhyllosphereMHSKWEGPFLVASMARPEACRLRTLEAVQEPYSWNKDMLQRY
Ga0182196_108462213300017432Switchgrass PhyllosphereMHSKWEGPFLVASMARSEACRLRTLEGFEEPYSWNKDMLQRYYVLVSCSFLF
Ga0182196_112863113300017432Switchgrass PhyllosphereRIPKAKQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV
Ga0182194_109412013300017435Switchgrass PhyllosphereFLVASMARPEACRLCTLEGTEEPYPWNKDMLQKYFI
Ga0182214_112287713300017440Switchgrass PhyllosphereKCEGPFLVTSMARPEAYKLRTLEGVEEPYSWNKDMLQRYYV
Ga0182215_110356713300017447Switchgrass PhyllosphereSKIQGKMYSKWEGPFLVTSMARPEAYRLCTLEGAEDPYYWNKDML
Ga0182216_105448213300017693Switchgrass PhyllosphereVLRRIPKAKQKGKIYSKWEGPFIVASMVRPDACRLRTMEGVEDLYSWNKDTLQKYYV
Ga0182216_108967813300017693Switchgrass PhyllosphereLRRIPKSKMKGKMYSKREGPFLVTSMARPEACRLLTLEGVEDPYSWNKDMLQRYYV
Ga0182216_110517813300017693Switchgrass PhyllosphereEGPFLVASMAQPDACRLRTLEGIEDPYSRNKDMLQKYFV
Ga0163161_1121158113300017792Switchgrass RhizosphereGDLVLWRIQNAKQKGKMHSKWEGPFIVASMAMLEAGRLRTLEDTEDPYSWNKNMLQKYYV
Ga0182178_101028813300020023Switchgrass PhyllosphereVLRRIPKAKQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV
Ga0182118_10223013300020223Switchgrass PhyllosphereDLVLRRIPKAKQNGKMHSKWDGPFIVASMVRLEACRLRTLEGFQDPYSWNKDMLQKYYV
Ga0207668_1111654433300025972Switchgrass RhizosphereKSKQQGKMYSKWEGPFLVALMARPEACRIRTLEGVKEPYSWNKDMLQRYFV
Ga0207668_1162910313300025972Switchgrass RhizosphereYSKWEGPYLVASMARPEACRLRTLEGIEEPYSWNKDMLQRYYV
Ga0268328_101888013300028050PhyllosphereWEGPFIVASMARPEACRLRTLEGTEDPYSWNKDMLQKYYV
Ga0268328_101973313300028050PhyllosphereMYNKLEGPFIIASMARSEAYRLHTLEGTEDPYSWNKDMLQNYYV
Ga0268342_103729213300028062PhyllosphereMYSKWEGPYLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYNV
Ga0268340_108617013300028064PhyllosphereLRRIPKSKQQGKMYSKWEGPFLVISMTRPEACRLHTLEGVEEPYSWNKDMLQRYYV
Ga0268308_101752713300028151PhyllosphereGKMHSKWEGPFIVASMARPEACRLRMLEGTEDPYSWNKDML
Ga0268319_101048913300028473PhyllosphereRRIPKAKQKGKMYSKWEGPFIVASMVRPEACRLRTLESAEDPYSWNKNMLQKYYV
Ga0268309_100725713300028477PhyllosphereQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV
Ga0268339_100317813300028526PhyllospherePKAKQKGKMHSKWDGPFIVASMVRPEACRLRTLEGVEDPYSWNKDMLQKYYV
Ga0214493_108126823300032465Switchgrass PhyllosphereMHSKWEGPFMVSSMARPEACRLRTLEGVEEPYSWNKDMLQH
Ga0214490_112858213300032502Switchgrass PhyllosphereIPKAKQKGKMHSKWDGPFIVASMVRPEACRLRTPEGVEDPYSWNKDMLQKYYV
Ga0321339_108628513300032551Switchgrass PhyllosphereHCKWEGPFIVASMARPEACRLRTLEGAKDPYSWNKDMLQKYYV
Ga0321339_112253113300032551Switchgrass PhyllosphereKSKQQGKMHSKWEGPFLVASMAGPEACRLRTLEGVEEPYSWNKDMLQRYYV
Ga0214497_114017513300032689Switchgrass PhyllosphereKQKGKMHNKWEGPFIVASMARPEACRLCTLEGTEDPYSWNKDMLQNDRRGL
Ga0314745_110051213300032812Switchgrass PhyllosphereGPFLVASMARPEACRLRTLEGVEEPYSWNKDMLQRYYV
Ga0314751_107744513300032889Switchgrass PhyllosphereFIVASMVRPEAYRLRTMEDVEDPYSWNKDMLQKYYV
Ga0314739_107148113300032913Switchgrass PhyllosphereMHSKWDGPFIVASMVRPEACRLRTLEGVKDPYSWNKDMLQK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.