NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046979

Metagenome / Metatranscriptome Family F046979

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046979
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 52 residues
Representative Sequence MKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG
Number of Associated Samples 105
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.14 %
% of genes near scaffold ends (potentially truncated) 28.67 %
% of genes from short scaffolds (< 2000 bps) 70.67 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(26.667 % of family members)
Environment Ontology (ENVO) Unclassified
(68.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF13481AAA_25 19.46
PF00145DNA_methylase 12.08
PF01555N6_N4_Mtase 8.05
PF01507PAPS_reduct 2.68
PF13479AAA_24 2.01
PF05869Dam 2.01
PF00589Phage_integrase 1.34
PF11753DUF3310 1.34
PF03237Terminase_6N 1.34
PF10926DUF2800 0.67
PF05063MT-A70 0.67
PF01415IL7 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 12.08
COG0863DNA modification methylaseReplication, recombination and repair [L] 8.05
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 8.05
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 8.05
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.34

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.00 %
UnclassifiedrootN/A42.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10182719Not Available660Open in IMG/M
3300000973|BBAY93_10123024Not Available656Open in IMG/M
3300005837|Ga0078893_10882178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1649Open in IMG/M
3300006025|Ga0075474_10047354Not Available1462Open in IMG/M
3300006025|Ga0075474_10084292All Organisms → Viruses → Predicted Viral1039Open in IMG/M
3300006025|Ga0075474_10209050Not Available596Open in IMG/M
3300006026|Ga0075478_10041067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1529Open in IMG/M
3300006026|Ga0075478_10142436All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300006026|Ga0075478_10173677Not Available665Open in IMG/M
3300006027|Ga0075462_10007350All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3578Open in IMG/M
3300006029|Ga0075466_1017953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2321Open in IMG/M
3300006749|Ga0098042_1000135Not Available25895Open in IMG/M
3300006752|Ga0098048_1003676All Organisms → cellular organisms → Bacteria6173Open in IMG/M
3300006752|Ga0098048_1033004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1680Open in IMG/M
3300006752|Ga0098048_1037261All Organisms → Viruses → Predicted Viral1564Open in IMG/M
3300006752|Ga0098048_1251320Not Available516Open in IMG/M
3300006789|Ga0098054_1011056All Organisms → cellular organisms → Bacteria3718Open in IMG/M
3300006802|Ga0070749_10662520Not Available559Open in IMG/M
3300006802|Ga0070749_10739141Not Available524Open in IMG/M
3300006810|Ga0070754_10126328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1241Open in IMG/M
3300006810|Ga0070754_10379453Not Available621Open in IMG/M
3300006810|Ga0070754_10482690Not Available535Open in IMG/M
3300006867|Ga0075476_10212632All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006916|Ga0070750_10420340Not Available556Open in IMG/M
3300006916|Ga0070750_10467622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.520Open in IMG/M
3300006919|Ga0070746_10050745All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2166Open in IMG/M
3300006919|Ga0070746_10416334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.600Open in IMG/M
3300006922|Ga0098045_1016042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2046Open in IMG/M
3300006922|Ga0098045_1030736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1385Open in IMG/M
3300006924|Ga0098051_1000423All Organisms → cellular organisms → Bacteria17100Open in IMG/M
3300006925|Ga0098050_1171681Not Available543Open in IMG/M
3300007234|Ga0075460_10042018All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1740Open in IMG/M
3300007234|Ga0075460_10229243Not Available624Open in IMG/M
3300007345|Ga0070752_1386071Not Available520Open in IMG/M
3300007345|Ga0070752_1406807Not Available501Open in IMG/M
3300007539|Ga0099849_1159295Not Available869Open in IMG/M
3300007539|Ga0099849_1378115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.500Open in IMG/M
3300007640|Ga0070751_1249398Not Available675Open in IMG/M
3300007725|Ga0102951_1003214All Organisms → cellular organisms → Bacteria5899Open in IMG/M
3300007778|Ga0102954_1009639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2722Open in IMG/M
3300008012|Ga0075480_10455960Not Available622Open in IMG/M
3300009001|Ga0102963_1083209Not Available1309Open in IMG/M
3300009435|Ga0115546_1036330All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1966Open in IMG/M
3300009593|Ga0115011_10264948All Organisms → Viruses → Predicted Viral1294Open in IMG/M
3300010300|Ga0129351_1043062Not Available1857Open in IMG/M
3300010368|Ga0129324_10138420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1022Open in IMG/M
3300011252|Ga0151674_1092111All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300011253|Ga0151671_1079688All Organisms → cellular organisms → Bacteria → FCB group3067Open in IMG/M
3300011254|Ga0151675_1021779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581792Open in IMG/M
3300011254|Ga0151675_1021779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581792Open in IMG/M
3300011254|Ga0151675_1047526Not Available526Open in IMG/M
3300011258|Ga0151677_1053306Not Available512Open in IMG/M
3300016791|Ga0182095_1291514All Organisms → cellular organisms → Bacteria → FCB group1517Open in IMG/M
3300017697|Ga0180120_10094558Not Available1304Open in IMG/M
3300017710|Ga0181403_1072204Not Available717Open in IMG/M
3300017713|Ga0181391_1098492Not Available661Open in IMG/M
3300017714|Ga0181412_1003832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium5152Open in IMG/M
3300017714|Ga0181412_1020346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1865Open in IMG/M
3300017719|Ga0181390_1010073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium3343Open in IMG/M
3300017719|Ga0181390_1016353All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2492Open in IMG/M
3300017721|Ga0181373_1001763Not Available4251Open in IMG/M
3300017725|Ga0181398_1015675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1906Open in IMG/M
3300017727|Ga0181401_1021747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1909Open in IMG/M
3300017727|Ga0181401_1058266Not Available1041Open in IMG/M
3300017727|Ga0181401_1065391Not Available969Open in IMG/M
3300017738|Ga0181428_1003735All Organisms → cellular organisms → Bacteria3481Open in IMG/M
3300017739|Ga0181433_1005630Not Available3643Open in IMG/M
3300017742|Ga0181399_1049306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1103Open in IMG/M
3300017743|Ga0181402_1026794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1619Open in IMG/M
3300017743|Ga0181402_1164767Not Available558Open in IMG/M
3300017745|Ga0181427_1066777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.884Open in IMG/M
3300017746|Ga0181389_1002651Not Available6699Open in IMG/M
3300017746|Ga0181389_1027410Not Available1750Open in IMG/M
3300017751|Ga0187219_1051546Not Available1360Open in IMG/M
3300017752|Ga0181400_1113810Not Available786Open in IMG/M
3300017753|Ga0181407_1064462All Organisms → cellular organisms → Bacteria → FCB group947Open in IMG/M
3300017757|Ga0181420_1215088Not Available554Open in IMG/M
3300017760|Ga0181408_1086780Not Available819Open in IMG/M
3300017762|Ga0181422_1111390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.851Open in IMG/M
3300017763|Ga0181410_1036574All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1554Open in IMG/M
3300017768|Ga0187220_1066459Not Available1085Open in IMG/M
3300017783|Ga0181379_1083345Not Available1185Open in IMG/M
3300017824|Ga0181552_10244388Not Available906Open in IMG/M
3300017950|Ga0181607_10252645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1011Open in IMG/M
3300017950|Ga0181607_10379412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.776Open in IMG/M
3300017950|Ga0181607_10708720Not Available522Open in IMG/M
3300018048|Ga0181606_10478410Not Available654Open in IMG/M
3300018410|Ga0181561_10010912All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.7237Open in IMG/M
3300018415|Ga0181559_10072584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2201Open in IMG/M
3300018416|Ga0181553_10061121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2452Open in IMG/M
3300018417|Ga0181558_10159055All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1333Open in IMG/M
3300018417|Ga0181558_10493216Not Available638Open in IMG/M
3300019459|Ga0181562_10059053All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2309Open in IMG/M
3300019742|Ga0193965_1035106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.881Open in IMG/M
3300020051|Ga0181555_1155875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium924Open in IMG/M
3300020173|Ga0181602_10229405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.804Open in IMG/M
3300020175|Ga0206124_10217890Not Available748Open in IMG/M
3300020379|Ga0211652_10088242All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon934Open in IMG/M
3300020421|Ga0211653_10007511All Organisms → cellular organisms → Bacteria5488Open in IMG/M
3300021347|Ga0213862_10001717All Organisms → cellular organisms → Bacteria9073Open in IMG/M
3300021347|Ga0213862_10003436All Organisms → cellular organisms → Bacteria6494Open in IMG/M
3300021347|Ga0213862_10018365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2633Open in IMG/M
3300021347|Ga0213862_10022236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2363Open in IMG/M
3300021365|Ga0206123_10155721Not Available1043Open in IMG/M
3300021371|Ga0213863_10200746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.878Open in IMG/M
3300021373|Ga0213865_10025110All Organisms → cellular organisms → Bacteria → FCB group3359Open in IMG/M
3300021373|Ga0213865_10040373All Organisms → cellular organisms → Bacteria2604Open in IMG/M
3300021373|Ga0213865_10091729Not Available1631Open in IMG/M
3300021375|Ga0213869_10016118All Organisms → cellular organisms → Bacteria4312Open in IMG/M
3300021375|Ga0213869_10060041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium1946Open in IMG/M
3300021375|Ga0213869_10224017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.835Open in IMG/M
3300021378|Ga0213861_10003571All Organisms → cellular organisms → Bacteria12828Open in IMG/M
3300021389|Ga0213868_10591526Not Available582Open in IMG/M
3300021957|Ga0222717_10009051All Organisms → cellular organisms → Bacteria7009Open in IMG/M
3300021957|Ga0222717_10016649All Organisms → cellular organisms → Bacteria4983Open in IMG/M
3300021957|Ga0222717_10349449All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.831Open in IMG/M
3300021958|Ga0222718_10095355All Organisms → cellular organisms → Bacteria → FCB group1764Open in IMG/M
3300022065|Ga0212024_1030907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium908Open in IMG/M
3300022067|Ga0196895_1002814All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300022071|Ga0212028_1044210Not Available827Open in IMG/M
3300022074|Ga0224906_1064024All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300022074|Ga0224906_1069517All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300022074|Ga0224906_1149017Not Available661Open in IMG/M
3300022183|Ga0196891_1032824Not Available971Open in IMG/M
3300022187|Ga0196899_1154245Not Available636Open in IMG/M
3300022187|Ga0196899_1209609Not Available512Open in IMG/M
3300022923|Ga0255783_10008620Not Available8440Open in IMG/M
(restricted) 3300024324|Ga0233443_1097384Not Available1136Open in IMG/M
3300025070|Ga0208667_1002033Not Available6854Open in IMG/M
3300025070|Ga0208667_1002682All Organisms → cellular organisms → Bacteria5647Open in IMG/M
3300025070|Ga0208667_1013524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1770Open in IMG/M
3300025083|Ga0208791_1004490All Organisms → cellular organisms → Bacteria → Proteobacteria3986Open in IMG/M
3300025083|Ga0208791_1011790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2023Open in IMG/M
3300025101|Ga0208159_1000072Not Available35540Open in IMG/M
3300025103|Ga0208013_1093227Not Available766Open in IMG/M
3300025543|Ga0208303_1062708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.867Open in IMG/M
3300025674|Ga0208162_1031187Not Available1949Open in IMG/M
3300025674|Ga0208162_1065927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1161Open in IMG/M
3300025687|Ga0208019_1143548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.681Open in IMG/M
3300025803|Ga0208425_1020944Not Available1738Open in IMG/M
3300025828|Ga0208547_1146094All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300025881|Ga0209309_10498937Not Available506Open in IMG/M
3300026187|Ga0209929_1000334All Organisms → cellular organisms → Bacteria17923Open in IMG/M
(restricted) 3300027861|Ga0233415_10545048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.563Open in IMG/M
3300029308|Ga0135226_1005691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.834Open in IMG/M
3300031851|Ga0315320_10011288Not Available7183Open in IMG/M
3300031851|Ga0315320_10040571All Organisms → cellular organisms → Bacteria → FCB group3659Open in IMG/M
3300034374|Ga0348335_025084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2752Open in IMG/M
3300034374|Ga0348335_185877Not Available521Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.67%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater20.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.33%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh10.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.67%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine4.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.33%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.33%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.33%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.33%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.33%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.33%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.33%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.67%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.67%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.67%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.67%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1018271923300000117MarineMKCFNCNAXMKLERQKDISRYNNLFNLKLSFSCPXCGAVANAYPPKDDNQKVSHGR*
BBAY93_1012302423300000973Macroalgal SurfaceMKCFNCDANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG*
Ga0078893_1088217833300005837Marine Surface WaterMKCFNCNASMKLEREKNISRYNDLYDLKLTFKCNECGAVVNAYPPKDDHQKVSHGG*
Ga0075474_1004735423300006025AqueousMKCFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG*
Ga0075474_1008429233300006025AqueousMKLERQKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDN
Ga0075474_1020905013300006025AqueousMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG*
Ga0075478_1004106743300006026AqueousMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG*
Ga0075478_1014243633300006026AqueousMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVNHGG*
Ga0075478_1017367733300006026AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGG*
Ga0075462_1000735023300006027AqueousMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPKDDEPEVITNE*
Ga0075466_101795333300006029AqueousMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPKDDEPEVITNE*
Ga0098042_1000135383300006749MarineMKCFNCDANMKLEREKNISRYNHCFDLKLSFKCLECGAVANAYPPKDDAIKLGEQHHG*
Ga0098048_100367673300006752MarineMKCFNCNANMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHGR*
Ga0098048_103300433300006752MarineMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQEVSHGR*
Ga0098048_103726133300006752MarineMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPKCGAVANAYPPKDDNQEVSHGR*
Ga0098048_125132013300006752MarineMKCFNCDANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHG
Ga0098054_101105663300006789MarineMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG*
Ga0070749_1066252013300006802AqueousMKCFNCNAYMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG*
Ga0070749_1073914133300006802AqueousMKCFNCNTNMKLEREKDISRYNHCFDLKLTFECKECGAVANAYPPKDDNQKVSHGR*
Ga0070754_1012632813300006810AqueousMKCFNCNGNMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKN
Ga0070754_1037945313300006810AqueousNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG*
Ga0070754_1048269033300006810AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGR*
Ga0075476_1021263233300006867AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVNHGG*
Ga0070750_1042034033300006916AqueousMKCFNCNANMKLERQKDISRYNNLFDLKLSFSCPECGAVANAYPPKDDNQKVSHGR*
Ga0070750_1046762213300006916AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKC
Ga0070746_1005074543300006919AqueousMKCFNCNANMKLEREKNISRYNHCFDLKLSFSCQECGAVVNAYPPKDDGIKQGGKYYVKR
Ga0070746_1041633443300006919AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVA
Ga0098045_101604223300006922MarineMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQEVSHGR*
Ga0098045_103073613300006922MarineKMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAAANAYPPKDDNQEVSHGR*
Ga0098051_1000423153300006924MarineMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHGR*
Ga0098050_117168133300006925MarineMKCFNCNANMKLEREKDISRYNKCFNLKLSFKCLECGAVANAYPPKDDNQ
Ga0075460_1004201843300007234AqueousMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKEVKHGG*
Ga0075460_1022924343300007234AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPK
Ga0070752_138607123300007345AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGR*
Ga0070752_140680713300007345AqueousMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNN
Ga0099849_115929523300007539AqueousMKLEREKDISRYNHCFDLKLTFECKECGAVANAYPPKNDKKEVKHGG*
Ga0099849_137811533300007539AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDD
Ga0070751_124939813300007640AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAY
Ga0102951_1003214103300007725WaterMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGR*
Ga0102954_100963933300007778WaterMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGR*
Ga0075480_1045596013300008012AqueousNMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG*
Ga0102963_108320933300009001Pond WaterMKCFNCNANMVVVKETDISYYNHCFNLKITFECKECGAVANAYPPKDDNQKV
Ga0115546_103633053300009435Pelagic MarineMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGG*
Ga0115011_1026494813300009593MarineMKCFNCDANMKLDREKDISHHNRCFDIKLTFRCWDCGAIC
Ga0098049_106227413300010149MarineMKCFNCNANMKLEREKDISRYNDCFDIKLSFKCLECGAVANAYPPKDDPLDEAIRRS
Ga0129351_104306213300010300Freshwater To Marine Saline GradientMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQK
Ga0129324_1013842023300010368Freshwater To Marine Saline GradientMKCFNCNSNMKLEREKDISRYNHCFDLKLTFECKECGAVANAYPPKDDNQKVSHGR*
Ga0151674_109211153300011252MarineMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG*
Ga0151671_107968853300011253MarineMEVVKETDISYYNDFFNLKITFDCNECGAVANAYPPKDDNQEVSHGG*
Ga0151675_102177913300011254MarineMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDN
Ga0151675_102177933300011254MarineMKCFNCDANMKLTREKDISRYNNLFDLKLSFECLDCGAVVNAYPPKPKDDEPEIIKND*
Ga0151675_104752623300011254MarineMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVS
Ga0151677_105330613300011258MarineMKCFNCNANMKLTREKNISRYNNLFDLKLSFECLDCGAVANAYPPKDDEPEIIKND*
Ga0182095_129151453300016791Salt MarshFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKEVKHGG
Ga0180120_1009455813300017697Freshwater To Marine Saline GradientMKCFNCNANMKLERQKDISRYNDLFDIKLSFKCLECGAVANAYPPKDDGIKQGGKYYVKR
Ga0181403_107220433300017710SeawaterMVVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQGLSHVG
Ga0181391_109849223300017713SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPECGAVANAYPPKDDNQEVSHGR
Ga0181412_100383293300017714SeawaterMKCFNCNANMKVVKETDISYYNDCFNIKITFECKECGAVANAYPPKDDNQGLSHGG
Ga0181412_102034663300017714SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPECGAVANAYPPKDDNQEVSHVR
Ga0181390_101007363300017719SeawaterMKCFNCNASMKLLKERDISYYNNLFDIKLFFSCAKCGAAVNA
Ga0181390_101635383300017719SeawaterMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLDCGAVVNAYPPKDDEPEIIKND
Ga0181373_1001763133300017721MarineMKCFNCNANMKLEREKDISRYNDLFDLKLSFSCQECGAVVNAYPPKDDAIKLGEQHHG
Ga0181398_101567543300017725SeawaterMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANACPPKDDNQKVSHGG
Ga0181401_102174723300017727SeawaterMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLHCGAVANAYPPKDDEPEIIKND
Ga0181401_105826623300017727SeawaterMKCFNCNANMVVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQGLSHVG
Ga0181401_106539123300017727SeawaterMKCFNCDANMKLEREKNISRYNDLFDLKLSFSCQECGAVANAYPPKDDGIKQGGKYYVKR
Ga0181428_100373573300017738SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPGCGAVANAYPPKDDNQKVSH
Ga0181433_1005630133300017739SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGGER
Ga0181399_104930623300017742SeawaterMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHVG
Ga0181402_102679433300017743SeawaterMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPKDDEPEIIKND
Ga0181402_116476713300017743SeawaterMKCFNCDANMKLEREKNISRYNDLFDLKLSFSCQECGAVANAYPPKDDGIKQG
Ga0181427_106677743300017745SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVA
Ga0181389_1002651133300017746SeawaterMKLDREKNISRYNHCFDLKLSFSCQECGAVANAYPPKDDGIKEGGKYYVKR
Ga0181389_102741053300017746SeawaterMKLTREKDISRYNNLFDLKLSFECLDCGAVANAYPPKDDEPEVITND
Ga0187219_105154623300017751SeawaterMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLSCGAVVNAYPPKDDEPEIIKND
Ga0181400_111381013300017752SeawaterMKCFNCNANMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHVG
Ga0181407_106446223300017753SeawaterMKCFNCNANMKVVKETDISYYNHCFNLKITFECKECGAVANAYPPKDDNKKVSHGR
Ga0181420_121508833300017757SeawaterMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0181408_108678013300017760SeawaterRKYKMKCFNCNANMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHVG
Ga0181422_111139023300017762SeawaterMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDYNQKVSHGR
Ga0181410_103657443300017763SeawaterMKCFNCDANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPK
Ga0187220_106645933300017768SeawaterMKCFNCDANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0181379_108334543300017783SeawaterMKCFNCNANMKLDREKNISRYNHCFDLKLSFSCQECGAVANAYPPKDDGIKEGGKYYVER
Ga0181552_1024438813300017824Salt MarshMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG
Ga0181607_1025264513300017950Salt MarshMKCFNCNANMRLERQKDISRYNNLFNLKLTFSCQECGAVANAYPPKDDNQKVSHGG
Ga0181607_1037941223300017950Salt MarshMKCFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKEVKHGG
Ga0181607_1070872023300017950Salt MarshMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNRKVSHGG
Ga0181606_1047841023300018048Salt MarshMKCFNCNANMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPKDDEPEVITNE
Ga0181561_1001091243300018410Salt MarshMKCFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG
Ga0181559_1007258433300018415Salt MarshMKCFNCNANMKVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG
Ga0181553_1006112123300018416Salt MarshMKCFNCNANMKVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKEVKHGG
Ga0181558_1015905533300018417Salt MarshMKCFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKN
Ga0181558_1049321613300018417Salt MarshMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGG
Ga0181562_1005905373300019459Salt MarshMKCFNCNANMKVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKKVKHGG
Ga0193965_103510633300019742Freshwater Microbial MatMKCFNCNANMKLERQKDISRYNNLFDLKLSFSCPKCGAVANAYPPKDDNQKVSHGR
Ga0181555_115587513300020051Salt MarshCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG
Ga0181602_1022940523300020173Salt MarshMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNDKKEVKHGG
Ga0206124_1021789013300020175SeawaterMKCFNCNANMKVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQGLSHGG
Ga0211652_1008824233300020379MarineMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQEVSHGR
Ga0211653_10007511143300020421MarineMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPKCGAVANAYPPKDDNQEVSHVR
Ga0213862_1000171743300021347SeawaterMKCFNCNAYMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQGLSHGR
Ga0213862_1000343623300021347SeawaterMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGG
Ga0213862_1001836523300021347SeawaterMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGR
Ga0213862_1002223633300021347SeawaterMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPKDDEPEVITNE
Ga0206123_1015572133300021365SeawaterMKVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQGLSHGG
Ga0213863_1020074643300021371SeawaterMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0213865_1002511053300021373SeawaterMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGR
Ga0213865_1004037313300021373SeawaterMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQK
Ga0213865_1009172913300021373SeawaterNMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0213869_1001611853300021375SeawaterMKCFNCNANMKLEREKDISRYNKCFDLKLSFKCLGCGAVANAYPPKDDNQEVSHVR
Ga0213869_1006004123300021375SeawaterMVVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQGLSHGR
Ga0213869_1022401723300021375SeawaterMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGG
Ga0213861_10003571163300021378SeawaterMVVVKETDISYYNDCFNLKITFECKQCGAVANAYPPKDDNQGLSHGR
Ga0213868_1059152623300021389SeawaterMKCFNCNANMKVVKETDISYYNHCFNLKITFECKECGAVANAYPPKDDNQKVSHGR
Ga0222717_10009051173300021957Estuarine WaterMKCFNCNANMKLEREKDISRYNNLFNLKLTFSCPKCGAVANAYPPKDDNQKVSHGG
Ga0222717_1001664963300021957Estuarine WaterMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDNNQKVSHGG
Ga0222717_1034944923300021957Estuarine WaterMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQEVSHVR
Ga0222718_1009535523300021958Estuarine WaterMKCFNCNANMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGR
Ga0212024_103090723300022065AqueousMKLTREKDISRYNNLFDLKLSFECLSCGAVANAYPPK
Ga0196895_100281433300022067AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVNHGG
Ga0212028_104421033300022071AqueousMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPP
Ga0224906_106402413300022074SeawaterMKLERQKDISRYNDLFDLKLSFSCPECGAVVNAYPPKDDPLD
Ga0224906_106951713300022074SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPGCGAVANAYPPKDDNQKVSHGG
Ga0224906_114901713300022074SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG
Ga0196891_103282443300022183AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGG
Ga0196899_115424533300022187AqueousMKCFNCNANMQLKREKNISRYNHCFDLKLTFKCLNCGAVVNAY
Ga0196899_120960923300022187AqueousMKLEREKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG
Ga0255783_10008620183300022923Salt MarshKCFNCNANMEVVKETDISYYNDCFNLKITFKCNECGAVANAYPPKNNKKEVKHGG
(restricted) Ga0233443_109738413300024324SeawaterMKCFNCNANMKLDREKNISRYNNCFDLKLSFSCAECGAVVNAYPP
Ga0208667_100203323300025070MarineMKCFNCNANMVVVKETDISYYNDCFNLKITFECNECGAVANAYPPKDDNQGLSHGR
Ga0208667_1002682143300025070MarineMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPKCGAVANAYPPKDDNQEVSHGR
Ga0208667_101352423300025070MarineMEVVKETDISYYNDCFNLKITFECKECGAAANAYPPKDDNQEVSHGR
Ga0208791_100449073300025083MarineMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPKCGAVANAYPPKDDNQEV
Ga0208791_101179033300025083MarineMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQEVSHGR
Ga0208159_1000072383300025101MarineMKCFNCDANMKLEREKNISRYNHCFDLKLSFKCLECGAVANAYPPKDDAIKLGEQHHG
Ga0208013_109322713300025103MarineMKCFNCNANMKLEREKDISRYNDCFDIKLSFKCLECGAVANAYPPKDDPLDEA
Ga0208303_106270823300025543AqueousMKCFNCNAYMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0208162_103118753300025674AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHG
Ga0208162_106592733300025674AqueousMKCFNCNTNMKLEREKDISRYNHCFDLKLTFECKECGAVANAYPPKNDKKEVKHGG
Ga0208019_114354813300025687AqueousMKCFNCNTNMKLEREKDISRYNHCFDLKLTFECKECGAVANAYPPKDD
Ga0208425_102094413300025803AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPKCGAVANAYPP
Ga0208547_114609433300025828AqueousMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVNHGG
Ga0209309_1049893713300025881Pelagic MarineRXTMKCFNCNANMEVIKETDISYYNYLFNLKLTFECKECGAVANAYPPKDDNQKVSHGG
Ga0209929_1000334163300026187Pond WaterMEVVKETDISYYNDCFNLKITFECKECGAVANAYPPKDDNQKVSHGR
(restricted) Ga0233415_1054504823300027861SeawaterMKCFNCNANMVVVKETDISYYNHCFNLKITFECKECGAVANAYPPKDDNQKVSHGR
Ga0135226_100569133300029308Marine HarborMKCFNCNANMKVVKETDISYYNHCFNLKITFECKECGAVANAYPPKDDNQEVSHGR
Ga0315320_1001128833300031851SeawaterMKLEREKNISRYNHCFDLKLSFSCLECGAVVNAYPPKDDAIKLGEQHHG
Ga0315320_1004057143300031851SeawaterMKCFNCNANMKLEREKDISRYNNLFNLKLTFGCPKCGAVANAYPPKDDNQKVSHGR
Ga0348335_025084_2528_26713300034374AqueousMKLEREKDISRYNNLFNLKLSFSCPKCGAVANAYPPKDDNQKVSHGG
Ga0348335_185877_151_3213300034374AqueousMKCFNCNANMKLERQKDISRYNNLFNLKLSFSCPECGAVANAYPPKDDNQKVSHGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.