Basic Information | |
---|---|
Family ID | F047037 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 43 residues |
Representative Sequence | MRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSREL |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.67 % |
% of genes near scaffold ends (potentially truncated) | 98.67 % |
% of genes from short scaffolds (< 2000 bps) | 95.33 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF11994 | DUF3489 | 90.67 |
PF01979 | Amidohydro_1 | 1.33 |
PF00589 | Phage_integrase | 1.33 |
PF07992 | Pyr_redox_2 | 0.67 |
PF13276 | HTH_21 | 0.67 |
PF13924 | Lipocalin_5 | 0.67 |
PF13737 | DDE_Tnp_1_5 | 0.67 |
PF13683 | rve_3 | 0.67 |
PF07506 | RepB | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.67 % |
Unclassified | root | N/A | 1.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502001|FACENC_GAMC6GA01BR7FO | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300001867|JGI12627J18819_10487103 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300004103|Ga0058903_1473771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300004268|Ga0066398_10225113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300005175|Ga0066673_10565171 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005179|Ga0066684_10811662 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300005187|Ga0066675_11080903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
3300005332|Ga0066388_104620824 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005435|Ga0070714_101237062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
3300005546|Ga0070696_100895430 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005546|Ga0070696_101946724 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005554|Ga0066661_10876919 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005561|Ga0066699_11104263 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005566|Ga0066693_10062447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1273 | Open in IMG/M |
3300005574|Ga0066694_10378317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
3300005575|Ga0066702_10604091 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300005576|Ga0066708_10625762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
3300005598|Ga0066706_10822037 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300006031|Ga0066651_10700943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300006032|Ga0066696_10480368 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300006574|Ga0074056_11712449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
3300006755|Ga0079222_10400242 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300006755|Ga0079222_11880233 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300006755|Ga0079222_12497085 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006791|Ga0066653_10554105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300006794|Ga0066658_10248762 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300006794|Ga0066658_10702876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
3300006806|Ga0079220_11686911 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300006854|Ga0075425_102283927 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006871|Ga0075434_100814703 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300006954|Ga0079219_10209770 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300006954|Ga0079219_11319451 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006954|Ga0079219_12530291 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300007076|Ga0075435_100528691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1020 | Open in IMG/M |
3300009011|Ga0105251_10261913 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300009100|Ga0075418_11855102 | Not Available | 656 | Open in IMG/M |
3300009100|Ga0075418_12625699 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300009101|Ga0105247_10478962 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300009143|Ga0099792_10995857 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009162|Ga0075423_13054356 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009553|Ga0105249_11703630 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 703 | Open in IMG/M |
3300010159|Ga0099796_10524372 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300010359|Ga0126376_11596630 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300010361|Ga0126378_12670706 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010373|Ga0134128_10708144 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300010375|Ga0105239_10890027 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300010376|Ga0126381_104768113 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010398|Ga0126383_10377401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1447 | Open in IMG/M |
3300010401|Ga0134121_10934360 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300012056|Ga0153925_1024738 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012212|Ga0150985_107362989 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300012285|Ga0137370_10642512 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300012361|Ga0137360_11569150 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012469|Ga0150984_118214377 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012582|Ga0137358_10948581 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012977|Ga0134087_10485952 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012984|Ga0164309_10483510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 944 | Open in IMG/M |
3300012985|Ga0164308_10828280 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300012989|Ga0164305_11594337 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300015077|Ga0173483_10390304 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300015372|Ga0132256_101607045 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300018433|Ga0066667_10521956 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300018468|Ga0066662_10791827 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300018468|Ga0066662_11930898 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300018482|Ga0066669_12004354 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300020022|Ga0193733_1170232 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300020140|Ga0179590_1181156 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300020579|Ga0210407_10780963 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300020579|Ga0210407_11222030 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300020580|Ga0210403_10034883 | All Organisms → cellular organisms → Bacteria | 4021 | Open in IMG/M |
3300020580|Ga0210403_10779120 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300021168|Ga0210406_10430405 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300021178|Ga0210408_10087262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2449 | Open in IMG/M |
3300021178|Ga0210408_10391490 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300021178|Ga0210408_10488361 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300021178|Ga0210408_10641418 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300021362|Ga0213882_10207621 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300021384|Ga0213876_10754521 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300021404|Ga0210389_10830083 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300021432|Ga0210384_11188649 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300021432|Ga0210384_11257330 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300021474|Ga0210390_11585460 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300021478|Ga0210402_10672588 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300021560|Ga0126371_11087986 | Not Available | 939 | Open in IMG/M |
3300022529|Ga0242668_1008141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1342 | Open in IMG/M |
3300023056|Ga0233357_1008375 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300025901|Ga0207688_10277375 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300025908|Ga0207643_10345187 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300025915|Ga0207693_11042664 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025916|Ga0207663_10112048 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
3300025929|Ga0207664_10754522 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300026088|Ga0207641_11310869 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026312|Ga0209153_1269909 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300026316|Ga0209155_1145093 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300026320|Ga0209131_1272797 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300026322|Ga0209687_1063478 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300026345|Ga0257148_1009468 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300026497|Ga0257164_1076112 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026515|Ga0257158_1054321 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300026547|Ga0209156_10307290 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300026547|Ga0209156_10416481 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300026551|Ga0209648_10395442 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300026552|Ga0209577_10065997 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
3300026557|Ga0179587_10603367 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300027104|Ga0208095_1009497 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027521|Ga0209524_1017479 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300027537|Ga0209419_1057622 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300027603|Ga0209331_1053365 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300027646|Ga0209466_1085085 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300027667|Ga0209009_1066645 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300027698|Ga0209446_1106973 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300027701|Ga0209447_10053811 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300027703|Ga0207862_1090566 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300027729|Ga0209248_10202297 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300027737|Ga0209038_10122135 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300027737|Ga0209038_10251958 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300027765|Ga0209073_10426839 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027767|Ga0209655_10005722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 4273 | Open in IMG/M |
3300027768|Ga0209772_10012516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2342 | Open in IMG/M |
3300027768|Ga0209772_10051236 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300027855|Ga0209693_10089912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1518 | Open in IMG/M |
3300027889|Ga0209380_10017720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4040 | Open in IMG/M |
3300027903|Ga0209488_11113867 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300028047|Ga0209526_10353177 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300029636|Ga0222749_10424639 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300030935|Ga0075401_11803920 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300030973|Ga0075395_11213081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300031057|Ga0170834_108114758 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031231|Ga0170824_126183399 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300031469|Ga0170819_13095719 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031679|Ga0318561_10299478 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300031715|Ga0307476_11207384 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031719|Ga0306917_11599562 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031736|Ga0318501_10503244 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300031768|Ga0318509_10262123 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300031821|Ga0318567_10620447 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300031890|Ga0306925_11755078 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031893|Ga0318536_10436640 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300031910|Ga0306923_12537582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300031945|Ga0310913_10428878 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300032013|Ga0310906_10853153 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300032051|Ga0318532_10188894 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300032059|Ga0318533_10113586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
3300032063|Ga0318504_10166631 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300032261|Ga0306920_100318448 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
3300032261|Ga0306920_101793191 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300033289|Ga0310914_11129300 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300033290|Ga0318519_10133684 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300033290|Ga0318519_10519495 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300034268|Ga0372943_0751055 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.67% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.67% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012056 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCE_2279520 | 2040502001 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLLRAVAYR |
JGI12627J18819_104871032 | 3300001867 | Forest Soil | MSRALRDVGACREALARLPELDLTELRQQWRTLYKSDASRHLS |
Ga0058903_14737712 | 3300004103 | Forest Soil | MSRAIQDVTACREALARLPQLGLGELRQQWRVLYKAEASAYLSRELLLRAVAY |
Ga0066398_102251132 | 3300004268 | Tropical Forest Soil | MSRAIRDATACREAFARLLELDLAELRQQWRALYKTEPSPRLSRELLLRAV |
Ga0066673_105651711 | 3300005175 | Soil | MKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAPANLSRELL |
Ga0066684_108116622 | 3300005179 | Soil | MSRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYL |
Ga0066675_110809031 | 3300005187 | Soil | MSRATQDAAACREALARLPELDLGELRQQWRALYKAEASPHLSRELL |
Ga0066388_1046208242 | 3300005332 | Tropical Forest Soil | MSRAIRAATACREAFARLPRLDLGELREHWRALYKTEPSPRLS |
Ga0070714_1012370621 | 3300005435 | Agricultural Soil | MSRAIQDPAACLEALARLPELDLGALRQQWRTLYKAEASPHLSRELLVRAV |
Ga0070696_1008954301 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAIHAAACQEALSGLPELDLGELRQQWRALYKADVSPHLSRE |
Ga0070696_1019467241 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRALPDATACREALSHLTELNLGELRQQWRALYKAEASPHLSRELLVRAV |
Ga0066661_108769192 | 3300005554 | Soil | MKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAP |
Ga0066699_111042632 | 3300005561 | Soil | MRRAIQDVTACREALLRLPKLGLGELRRQWRVLYKAEASPYLSRELLLRAVAY |
Ga0066693_100624473 | 3300005566 | Soil | MSRAIQDATACREALSRLPQLDLGELRQQWRTLYKANASPHLSRELLLRA |
Ga0066694_103783172 | 3300005574 | Soil | MSRAVRDVAICREALARLPELSLSELRQQWRTLYKFDASPHLSRELLLRAV |
Ga0066702_106040911 | 3300005575 | Soil | MSRSIKDATACREALARLPELELSELRQHWRALYKSDASPHLSRELLVRA |
Ga0066708_106257621 | 3300005576 | Soil | MSRTVRDVAICREALARLPELALSELRQQWRTLYKSEASPHLSRELL |
Ga0066706_108220372 | 3300005598 | Soil | MSRALRDVRVCQEALARLPELALSELRQQWRALYKS |
Ga0066651_107009432 | 3300006031 | Soil | MRRAIQDATACGEALARLPELDLGELRQQWRALYKADASPHLSRELLVR |
Ga0066696_104803683 | 3300006032 | Soil | MSRVLQDATVRREALARLPELNLGELRQQWRALYKAD |
Ga0074056_117124491 | 3300006574 | Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLLRAVA |
Ga0079222_104002421 | 3300006755 | Agricultural Soil | MKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQPT |
Ga0079222_118802332 | 3300006755 | Agricultural Soil | MSRAIQDATACREVLSRLPKLDLGELRQQWRALYKSE |
Ga0079222_124970851 | 3300006755 | Agricultural Soil | MSRAVRDATICREALARLPELALSELRQQWRTLYK |
Ga0066653_105541051 | 3300006791 | Soil | MKPRIQDATAYREALSRLPTLDIGELRQQWRGLYKTQAPPNVSRELLLRAV |
Ga0066658_102487621 | 3300006794 | Soil | MSRARQNVTDCREALARLPELALSELRQQWRALYKSEASPHLSREL |
Ga0066658_107028762 | 3300006794 | Soil | MSRAVRDVAICREALARLREFALSELRQQWRTLYKSEASPHL |
Ga0079220_116869112 | 3300006806 | Agricultural Soil | MSRARRNVTGCREALARLPELALSALRQQWRALYKSEASPHLSRELLL |
Ga0075425_1022839272 | 3300006854 | Populus Rhizosphere | MRRAIQDAAACREALARLPELDLGELRQQWRALYKSDASP |
Ga0075434_1008147032 | 3300006871 | Populus Rhizosphere | MSRAIRDATACREAFARLLELDLAELRQQWRALYKTAASP |
Ga0079219_102097703 | 3300006954 | Agricultural Soil | MRRAIQDATACGEALARLPELDLGELRRQWRALYKSEASPHL |
Ga0079219_113194513 | 3300006954 | Agricultural Soil | MSRALRDVTVCREALARLPELELSELRQQWRALYKS |
Ga0079219_125302911 | 3300006954 | Agricultural Soil | MSRTIEDATACREALSRLPELDLGELRQQWRALYKADASPHL |
Ga0075435_1005286911 | 3300007076 | Populus Rhizosphere | MRRPIQDATTCREALARLPELDLGELRQQWRALYKSDASPHLSREL |
Ga0105251_102619132 | 3300009011 | Switchgrass Rhizosphere | MRHAIQDATPCREALARLPELDLGELRQQWRALYKSEASPHLSRELLVR |
Ga0075418_118551022 | 3300009100 | Populus Rhizosphere | MRRAIQDATTCREALARLPELDLGELRQQWRALYKSDASP |
Ga0075418_126256991 | 3300009100 | Populus Rhizosphere | MRRAIQDATPCREALARLPELDLGELREQWRALYKSEASPHLSREL |
Ga0105247_104789621 | 3300009101 | Switchgrass Rhizosphere | MRRAIHDATACREALLRLPKLGLGELRRQWRVLYKAEASPYLSRELLLRAVAYR |
Ga0099792_109958572 | 3300009143 | Vadose Zone Soil | MNRAIQHATACREALSRLPTLEIGELSQQWRALYKAEASPHL |
Ga0075423_130543561 | 3300009162 | Populus Rhizosphere | MNRQVQIPTACREALSRLPGLELGGLRQQWRALYKNQAPP |
Ga0105249_117036302 | 3300009553 | Switchgrass Rhizosphere | MSRAIHNAAACREAIARLPELDLGELCRQWRALYKTAASPHLSRELLM |
Ga0099796_105243722 | 3300010159 | Vadose Zone Soil | MSRAIQRASACREALARLPELDISELRQQWRALYKA |
Ga0126376_115966302 | 3300010359 | Tropical Forest Soil | MSRAIHDATACREALARLPALDLGELRQQWRALYKTAASPHFSREL |
Ga0126378_126707062 | 3300010361 | Tropical Forest Soil | MPTAGPEALSRLPELDLSELRQQWRALYKAEASPHL |
Ga0134128_107081441 | 3300010373 | Terrestrial Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAQASAYLSRELLLRAVAYRM |
Ga0105239_108900271 | 3300010375 | Corn Rhizosphere | MRRTIHDATACREALARLPELDLGGLRQQWRTLYKAEASPHLSRELLLRAVA |
Ga0126381_1047681131 | 3300010376 | Tropical Forest Soil | MSRVIQDATACREALARLPELDLGELRQKWRALYKTEP |
Ga0126383_103774014 | 3300010398 | Tropical Forest Soil | MSRAIQDATACREALSRLPELDLGELRQRWRALYKADASPHLSRELL |
Ga0134121_109343602 | 3300010401 | Terrestrial Soil | MRRAIQDATTCREALARLPELDLGELRQQWRALYKSEASPHLSREL |
Ga0153925_10247381 | 3300012056 | Attine Ant Fungus Gardens | MSRAIHDATACREALSRLPELDLSELRQHWRALYKADASPHLS |
Ga0150985_1073629892 | 3300012212 | Avena Fatua Rhizosphere | MKRGIQDATACREALSRLPTLDIGELRQQWRGLYKTQAPAN |
Ga0137370_106425122 | 3300012285 | Vadose Zone Soil | MSRAIHHATGCREALARLPELGLRELRQHWRVLYKTEASPHLSR |
Ga0137360_115691501 | 3300012361 | Vadose Zone Soil | MSRAIQDATACREALARLPELDLGALRRQWRAFYKA |
Ga0150984_1182143772 | 3300012469 | Avena Fatua Rhizosphere | MSRALRDVTACREALARLPELALSELRQQWRALYKSDSSPHL |
Ga0137358_109485811 | 3300012582 | Vadose Zone Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAE |
Ga0134087_104859522 | 3300012977 | Grasslands Soil | MSRAVQDATACREALLRLPELNLGELRQRWRILYKTG |
Ga0164309_104835101 | 3300012984 | Soil | RAIQDATACREALLRLPKLGLGELRQQWRVLYKAAASPYL* |
Ga0164308_108282801 | 3300012985 | Soil | MSRAIQDVTACREALARLPELDLGGVRQQWRTLYKAEASPHLSR |
Ga0164305_115943372 | 3300012989 | Soil | MSRALQDATACREALARLPELDLGELRQHWRALYKAEASPHLSRE |
Ga0173483_103903042 | 3300015077 | Soil | MRRAIQDATTCGEALTRLPELDLGELRRQWRALYKSEASPHLSREL |
Ga0132256_1016070452 | 3300015372 | Arabidopsis Rhizosphere | MSRTIEDATACREALARLPELDLGELRQRWRTLYKADASPH |
Ga0066667_105219562 | 3300018433 | Grasslands Soil | MSRALRDVRVCREALARLPELALSELRQQWRALYKSEASPHLSRELLL |
Ga0066662_107918271 | 3300018468 | Grasslands Soil | MSRALRDVRTCREALVRLPQLELRELRQQWRALYKSEA |
Ga0066662_119308981 | 3300018468 | Grasslands Soil | MSRAVRDVAICREALARLPELALSELRQQWRTLYKFEASPHLSRE |
Ga0066669_120043542 | 3300018482 | Grasslands Soil | MNRAIPDATACREALSGLTELDLGELRQQWRGLYKMEASSHLSRDLLVRAGACRLQ |
Ga0193733_11702321 | 3300020022 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLL |
Ga0179590_11811561 | 3300020140 | Vadose Zone Soil | MSRAIQDATAWREALARLPELNLRELRQQWRILYKTEASPHLSRELLVRAVA |
Ga0210407_107809631 | 3300020579 | Soil | MSRAIHDATACREALARLPKVGLGELRQQWRVLYKAEASPY |
Ga0210407_112220301 | 3300020579 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKA |
Ga0210403_100348836 | 3300020580 | Soil | MSRAIQDATACRQALLRLPKLGLGELRQQWRVLYKAEAS |
Ga0210403_107791202 | 3300020580 | Soil | MSRVIQDATACREALSRLTELNLGELRQRWRILYKTEASLHLSRELLVRA |
Ga0210406_104304051 | 3300021168 | Soil | MSRSIKDATACWEALARLPELDLSELRQQCRALYKADAS |
Ga0210408_100872621 | 3300021178 | Soil | MSRAIQHATACREALARLPELDLGELRDQWRALYKSDASPHLSRELLLRA |
Ga0210408_103914901 | 3300021178 | Soil | MSRAIQDATACREALVRLPELDLGELRQQWRALYKADVSPHL |
Ga0210408_104883612 | 3300021178 | Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRTLYKAEASPHLS |
Ga0210408_106414182 | 3300021178 | Soil | MRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSREL |
Ga0213882_102076211 | 3300021362 | Exposed Rock | MSRAVRDATACREALSRLPELDLGELRQQWGALYKAEASPHLSRGLL |
Ga0213876_107545212 | 3300021384 | Plant Roots | MSRAIQDATSCREALARLPKLSLRELRQQWRVLYKAEASPHLSRELLLRAV |
Ga0210389_108300832 | 3300021404 | Soil | MSPAIQDAPACREALSRLAELDLGELRQQWRSLYKAD |
Ga0210384_111886492 | 3300021432 | Soil | MRRAIQDATACREALARLPELDLGELRQQWRALYKADASPHLSRELMLRA |
Ga0210384_112573302 | 3300021432 | Soil | MSRAIQDATACREALARLPELDLGELRQRWRALYKANASPHLSRELLV |
Ga0210390_115854602 | 3300021474 | Soil | MSRAVRDATACREALSRLPKLDLGELRQQWRILYKTEASPHLSRDL |
Ga0210402_106725883 | 3300021478 | Soil | MSRAIQDVTACREALARLPELDLGGVRQQWRTLYKAEAS |
Ga0126371_110879862 | 3300021560 | Tropical Forest Soil | MSRVIRDATACREAFARLLELDLAELRQQCRVLYK |
Ga0242668_10081411 | 3300022529 | Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASA |
Ga0233357_10083751 | 3300023056 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLL |
Ga0207688_102773751 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRALPDATACREALSHLTELNLGELRQQWRALYKAEASPHLSRELLGARR |
Ga0207643_103451871 | 3300025908 | Miscanthus Rhizosphere | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASAY |
Ga0207693_110426641 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRAIQDATACGEALSRLPELNLGELRQKWRTLYKAEASPHLN |
Ga0207663_101120483 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRAIQDATTCREALARLPELDLGELRQQWRALYKSEASPHLSRELLVRAV |
Ga0207664_107545221 | 3300025929 | Agricultural Soil | MSRALRDVTVCRKALARLPELALSELRQQWRALYKSDAS |
Ga0207641_113108691 | 3300026088 | Switchgrass Rhizosphere | MRRAIQDATTCRETLARLPELDLGELRQQWRALYKSDVSCGRQS |
Ga0209153_12699091 | 3300026312 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPHLSRELLLR |
Ga0209155_11450932 | 3300026316 | Soil | MSRALRDVRACREALARLPELALSELRQQWRALYKSEAS |
Ga0209131_12727972 | 3300026320 | Grasslands Soil | MSRAIQDATACREALSRLPQLDLGALRQEWRALYKAEASPHLSRGLTPMVREIEV |
Ga0209687_10634782 | 3300026322 | Soil | MSRTIKDVTACREALARLPELDLGELRQQWRALYKADASPHL |
Ga0257148_10094682 | 3300026345 | Soil | MNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHLSRELLVRAI |
Ga0257164_10761122 | 3300026497 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAYLSRELLLRAVAY |
Ga0257158_10543211 | 3300026515 | Soil | MNRAIPDATACREALSRLTELNLGELRQQWRTLYKA |
Ga0209156_103072902 | 3300026547 | Soil | MSRAIQDATACREALSRLPELNLDELRHQWRTLYKA |
Ga0209156_104164812 | 3300026547 | Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAAASPCLSRE |
Ga0209648_103954421 | 3300026551 | Grasslands Soil | MNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEAS |
Ga0209577_100659975 | 3300026552 | Soil | MSRAIQDATACREALSRLPQLDLGELRQEWRALYKAEA |
Ga0179587_106033671 | 3300026557 | Vadose Zone Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASAY |
Ga0208095_10094972 | 3300027104 | Forest Soil | MNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHLSRELL |
Ga0209524_10174794 | 3300027521 | Forest Soil | MSRAIQDATTCREALSRLPQLDLGELRQEWRALYK |
Ga0209419_10576221 | 3300027537 | Forest Soil | MSRAIHDGTACREALARLPKVGFGELRQQWRTLYKAEASPDLSRELLLRA |
Ga0209331_10533653 | 3300027603 | Forest Soil | MNRAIPDATACREALSRLTELNLGELRQQWRTLYKAEASPHFS |
Ga0209466_10850851 | 3300027646 | Tropical Forest Soil | MSRAIEDATACREALSRLPELDLGEIRQRGRALYKADASPHLSRELL |
Ga0209009_10666452 | 3300027667 | Forest Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASP |
Ga0209446_11069733 | 3300027698 | Bog Forest Soil | MSRAIQDATACREALSRLPDLDLGELRQQWRALYKA |
Ga0209447_100538112 | 3300027701 | Bog Forest Soil | MSRAIQDATACRGALARLPQLSLRELRQQWRVLYKA |
Ga0207862_10905663 | 3300027703 | Tropical Forest Soil | MSRAIHNAAACREALARLPELDLGELRRQWRVLYKTAASPHLS |
Ga0209248_102022971 | 3300027729 | Bog Forest Soil | VSPAIPAAACQEALARLPQLDLGELRRQWRALYKTDASPYLSRELMVRAVA |
Ga0209038_101221352 | 3300027737 | Bog Forest Soil | MSRAIQDATACREALARLPKLGLRELRQQWRVLYKTEASPHLS |
Ga0209038_102519582 | 3300027737 | Bog Forest Soil | MNRGIQDAMACREALSRLPTLDIGELRQQWRGLYKTQAPANLSR |
Ga0209073_104268391 | 3300027765 | Agricultural Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPH |
Ga0209655_100057227 | 3300027767 | Bog Forest Soil | MSRAIQDATGCREALARLPKLGLGELRQQWRVLYWD |
Ga0209772_100125161 | 3300027768 | Bog Forest Soil | MSRAIQDTTGCREALVRLPKLGLRELRQHWRVLYKAEASPHLSRE |
Ga0209772_100512363 | 3300027768 | Bog Forest Soil | MSRAIQDATGCREALARLPKLGLRELRQHWRVLYKAEASPHLSR |
Ga0209693_100899121 | 3300027855 | Soil | MSRAIQDATACREALSRLPQLDLGELRQEWRALYKAEASPHLSGELLVRAVACRPVTP |
Ga0209380_100177201 | 3300027889 | Soil | MNRAIPDATACREALSRLPQLDLGELRQEWRALYKAE |
Ga0209488_111138672 | 3300027903 | Vadose Zone Soil | MSRAIHDATACREALSRLPELDLSELRQQWRALYK |
Ga0209526_103531773 | 3300028047 | Forest Soil | MSRAIQDATACREALSRLPQLDLGELRQEWGALYKAEASPHLSR |
Ga0222749_104246391 | 3300029636 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEAS |
Ga0075401_118039203 | 3300030935 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSR |
Ga0075395_112130812 | 3300030973 | Soil | MRRAIHDATACREALLRLPKLGLGELRQHWRVLYKAEASPYLSRELLLRAVAY |
Ga0170834_1081147582 | 3300031057 | Forest Soil | MSRAIQDATACREALSRLTALNLGELRQQWRALYKADA |
Ga0170824_1261833991 | 3300031231 | Forest Soil | MSRAIQDATACREALSRLPELNLGELRQQWRTLYKAEALP |
Ga0170819_130957191 | 3300031469 | Forest Soil | MSRAVQDATACREALSRLPELNLGELRQQWRVLYKAEASAY |
Ga0318561_102994782 | 3300031679 | Soil | MSRAIHNAAACREALARLPELDLGELRRQWRILYK |
Ga0307476_112073841 | 3300031715 | Hardwood Forest Soil | MRRAIHDATACREALLRLPKLGLGELRQQWRVLYKAEASPYLSRELLL |
Ga0306917_115995622 | 3300031719 | Soil | MSRTLPDARAYREALARLPTLDLGELRQKWRALDKS |
Ga0318501_105032442 | 3300031736 | Soil | MSRAIHNAAACREALARLTELDLGELRRQWRVLYKTAASPH |
Ga0318509_102621233 | 3300031768 | Soil | MSRTLPDARAYREALARLPTLDLGELRQKWRALDKSELLV |
Ga0318567_106204471 | 3300031821 | Soil | MSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLLRAVAY |
Ga0306925_117550781 | 3300031890 | Soil | MSPVIHAAACQEALARLPKLDRDELRQQWRALYQAEASPHLSREL |
Ga0318536_104366401 | 3300031893 | Soil | MSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLLR |
Ga0306923_125375822 | 3300031910 | Soil | MSRAIQDAPACREALARLPELDLGELRQQWRALYK |
Ga0310913_104288782 | 3300031945 | Soil | MSRAIPDSTACREALARLPKLDLGELRQHWRALYKADASPHLSRELLL |
Ga0310906_108531531 | 3300032013 | Soil | MRRAIQDATACREALARLPELDLGELRQQWRALYKSNA |
Ga0318532_101888942 | 3300032051 | Soil | MSRAIHNAAACREALARLPELDLGELRRQWRVLYK |
Ga0318533_101135864 | 3300032059 | Soil | MSPVIHAAACQEALARLPKLDRDELRQQWRALYQAEASPHLS |
Ga0318504_101666312 | 3300032063 | Soil | MSRAIPDSTACREALARLPKLDLGELRQHWRALYKADAS |
Ga0306920_1003184481 | 3300032261 | Soil | MSRALPDGKACRETLARLPELDLAELRQQWRALYKS |
Ga0306920_1017931912 | 3300032261 | Soil | MRRAIQDATACREALLRLPKLGLGELRRQWRALYNAQASPY |
Ga0310914_111293001 | 3300033289 | Soil | MSRALPDGKACRETLARLPELDLAELRQQWRALYKSDV |
Ga0318519_101336843 | 3300033290 | Soil | MSRAIHNAAACREALARLPELDLGELRRQWRILYKTAA |
Ga0318519_105194952 | 3300033290 | Soil | MSPVIHAAACQEALARLPKLDRDELRQQWRALYKAEASPHLSREL |
Ga0372943_0751055_1_123 | 3300034268 | Soil | MRRAIQDATACREALLRLPKLGLGELRQQWRVLYKAEASPY |
⦗Top⦘ |