NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F047114

Metagenome Family F047114

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047114
Family Type Metagenome
Number of Sequences 150
Average Sequence Length 103 residues
Representative Sequence MPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Number of Associated Samples 116
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.40 %
% of genes near scaffold ends (potentially truncated) 34.67 %
% of genes from short scaffolds (< 2000 bps) 84.00 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(52.667 % of family members)
Environment Ontology (ENVO) Unclassified
(98.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.23%    β-sheet: 11.54%    Coil/Unstructured: 44.23%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF13884Peptidase_S74 9.33
PF00398RrnaAD 0.67
PF00106adh_short 0.67
PF09374PG_binding_3 0.67
PF03422CBM_6 0.67
PF00155Aminotran_1_2 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.67 %
UnclassifiedrootN/A27.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000150|SI48aug10_120mDRAFT_c1041157Not Available536Open in IMG/M
3300000151|SI53jan11_200mDRAFT_c1004478All Organisms → cellular organisms → Bacteria4699Open in IMG/M
3300000158|SI54feb11_100mDRAFT_c1028928Not Available865Open in IMG/M
3300000164|SI39no09_200mDRAFT_c1020790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1775Open in IMG/M
3300000167|SI39nov09_120mDRAFT_c1012426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2514Open in IMG/M
3300000167|SI39nov09_120mDRAFT_c1031523Not Available1255Open in IMG/M
3300000174|SI60aug11_200mDRAFT_c1014997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1928Open in IMG/M
3300000211|SI53jan11_135mDRAFT_c1008943Not Available1936Open in IMG/M
3300000214|SI54feb11_200mDRAFT_c1025238Not Available694Open in IMG/M
3300000325|SI39nov09_100mDRAFT_1014693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1901Open in IMG/M
3300001683|GBIDBA_10023558Not Available3721Open in IMG/M
3300001974|GOS2246_10007199All Organisms → cellular organisms → Bacteria → Proteobacteria1772Open in IMG/M
3300001974|GOS2246_10150655Not Available1787Open in IMG/M
3300002514|JGI25133J35611_10203927Not Available517Open in IMG/M
3300002518|JGI25134J35505_10015217All Organisms → cellular organisms → Bacteria2447Open in IMG/M
3300002518|JGI25134J35505_10106744Not Available605Open in IMG/M
3300002519|JGI25130J35507_1010962All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2270Open in IMG/M
3300002760|JGI25136J39404_1066763All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.670Open in IMG/M
3300003478|JGI26238J51125_1018365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1726Open in IMG/M
3300003495|JGI26244J51143_1027392Not Available1121Open in IMG/M
3300003495|JGI26244J51143_1062942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.611Open in IMG/M
3300003496|JGI26241J51128_1094560Not Available571Open in IMG/M
3300003496|JGI26241J51128_1095877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.566Open in IMG/M
3300003498|JGI26239J51126_1020194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1554Open in IMG/M
3300003542|FS900DNA_10602685Not Available640Open in IMG/M
3300003600|JGI26272J51733_1065927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.523Open in IMG/M
3300003619|JGI26380J51729_10020172All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300004276|Ga0066610_10095161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1027Open in IMG/M
3300004280|Ga0066606_10151036Not Available857Open in IMG/M
3300005425|Ga0066859_10208230Not Available575Open in IMG/M
3300005427|Ga0066851_10060600All Organisms → Viruses → environmental samples → uncultured virus1270Open in IMG/M
3300005427|Ga0066851_10221216Not Available592Open in IMG/M
3300005427|Ga0066851_10223806Not Available588Open in IMG/M
3300005428|Ga0066863_10036823All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1864Open in IMG/M
3300005428|Ga0066863_10149705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.838Open in IMG/M
3300005431|Ga0066854_10138078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.818Open in IMG/M
3300005604|Ga0066852_10125730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.906Open in IMG/M
3300005948|Ga0066380_10222883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.574Open in IMG/M
3300005969|Ga0066369_10068242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1238Open in IMG/M
3300006002|Ga0066368_10331244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.515Open in IMG/M
3300006013|Ga0066382_10161743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.777Open in IMG/M
3300006019|Ga0066375_10067883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1169Open in IMG/M
3300006076|Ga0081592_1081022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1348Open in IMG/M
3300006310|Ga0068471_1266957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1346Open in IMG/M
3300006311|Ga0068478_1125720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1293Open in IMG/M
3300006313|Ga0068472_10267818Not Available709Open in IMG/M
3300006313|Ga0068472_10718223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.820Open in IMG/M
3300006330|Ga0068483_1309531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.688Open in IMG/M
3300006331|Ga0068488_1107139Not Available667Open in IMG/M
3300006331|Ga0068488_1129432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2204Open in IMG/M
3300006340|Ga0068503_10189320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1518Open in IMG/M
3300006340|Ga0068503_10214815All Organisms → cellular organisms → Bacteria3299Open in IMG/M
3300006340|Ga0068503_10214817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1980Open in IMG/M
3300006341|Ga0068493_10238157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1933Open in IMG/M
3300006347|Ga0099697_1137438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1023Open in IMG/M
3300006414|Ga0099957_1584215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.916Open in IMG/M
3300006567|Ga0099958_1310642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.629Open in IMG/M
3300006736|Ga0098033_1018996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2141Open in IMG/M
3300006736|Ga0098033_1097635Not Available837Open in IMG/M
3300006738|Ga0098035_1011062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales3692Open in IMG/M
3300006738|Ga0098035_1124247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.888Open in IMG/M
3300006738|Ga0098035_1140527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.825Open in IMG/M
3300006738|Ga0098035_1168445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.739Open in IMG/M
3300006738|Ga0098035_1186736All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.695Open in IMG/M
3300006751|Ga0098040_1040451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1468Open in IMG/M
3300006751|Ga0098040_1064008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1130Open in IMG/M
3300006753|Ga0098039_1094031Not Available1034Open in IMG/M
3300006753|Ga0098039_1225477Not Available632Open in IMG/M
3300006753|Ga0098039_1336803Not Available501Open in IMG/M
3300006754|Ga0098044_1021316Not Available2908Open in IMG/M
3300006754|Ga0098044_1064997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1532Open in IMG/M
3300006754|Ga0098044_1125239All Organisms → Viruses → environmental samples → uncultured virus1041Open in IMG/M
3300006789|Ga0098054_1053919Not Available1536Open in IMG/M
3300006793|Ga0098055_1407268Not Available503Open in IMG/M
3300006900|Ga0066376_10313847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.912Open in IMG/M
3300006902|Ga0066372_10079419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1658Open in IMG/M
3300006926|Ga0098057_1028165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1399Open in IMG/M
3300006926|Ga0098057_1070961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.850Open in IMG/M
3300006926|Ga0098057_1146030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.577Open in IMG/M
3300006927|Ga0098034_1109378All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.789Open in IMG/M
3300007160|Ga0099959_1088364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.646Open in IMG/M
3300007291|Ga0066367_1351726All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.585Open in IMG/M
3300008050|Ga0098052_1127529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1020Open in IMG/M
3300009173|Ga0114996_10205887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1584Open in IMG/M
3300009173|Ga0114996_10683017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.754Open in IMG/M
3300009409|Ga0114993_10399629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1033Open in IMG/M
3300009409|Ga0114993_10852382Not Available655Open in IMG/M
3300009420|Ga0114994_10788071Not Available618Open in IMG/M
3300009605|Ga0114906_1281542Not Available533Open in IMG/M
3300009706|Ga0115002_10409854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1000Open in IMG/M
3300010150|Ga0098056_1058507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1329Open in IMG/M
3300010155|Ga0098047_10101858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1120Open in IMG/M
3300010155|Ga0098047_10299381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.607Open in IMG/M
3300017703|Ga0181367_1074600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.587Open in IMG/M
3300017705|Ga0181372_1002792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3742Open in IMG/M
3300017775|Ga0181432_1010980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2207Open in IMG/M
3300017775|Ga0181432_1022036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1655Open in IMG/M
3300020367|Ga0211703_10107776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.704Open in IMG/M
3300020398|Ga0211637_10304716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.632Open in IMG/M
3300020447|Ga0211691_10366392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.578Open in IMG/M
3300020449|Ga0211642_10516578All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.512Open in IMG/M
3300021068|Ga0206684_1066164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1246Open in IMG/M
3300021185|Ga0206682_10192272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.935Open in IMG/M
3300022227|Ga0187827_10192213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1395Open in IMG/M
(restricted) 3300022888|Ga0233428_1006884Not Available7571Open in IMG/M
(restricted) 3300022888|Ga0233428_1007697All Organisms → Viruses6883Open in IMG/M
(restricted) 3300022902|Ga0233429_1051754All Organisms → Viruses1903Open in IMG/M
(restricted) 3300022902|Ga0233429_1062720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1656Open in IMG/M
(restricted) 3300022912|Ga0233430_1094774Not Available1349Open in IMG/M
(restricted) 3300022916|Ga0233431_1057564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2040Open in IMG/M
(restricted) 3300022931|Ga0233433_10377133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.562Open in IMG/M
(restricted) 3300022933|Ga0233427_10096417Not Available1430Open in IMG/M
(restricted) 3300024256|Ga0233446_1026497All Organisms → Viruses2210Open in IMG/M
(restricted) 3300024257|Ga0233442_1032238Not Available1747Open in IMG/M
(restricted) 3300024258|Ga0233440_1001629All Organisms → cellular organisms → Bacteria20083Open in IMG/M
(restricted) 3300024339|Ga0233445_1153339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.707Open in IMG/M
3300025066|Ga0208012_1000381All Organisms → cellular organisms → Bacteria16289Open in IMG/M
3300025066|Ga0208012_1000500Not Available13322Open in IMG/M
3300025072|Ga0208920_1054813Not Available789Open in IMG/M
3300025082|Ga0208156_1024517All Organisms → Viruses1333Open in IMG/M
3300025096|Ga0208011_1044139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1049Open in IMG/M
3300025097|Ga0208010_1085111Not Available663Open in IMG/M
3300025103|Ga0208013_1004259All Organisms → cellular organisms → Bacteria5287Open in IMG/M
3300025109|Ga0208553_1128428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.569Open in IMG/M
3300025112|Ga0209349_1136198Not Available672Open in IMG/M
3300025118|Ga0208790_1055423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1235Open in IMG/M
3300025122|Ga0209434_1009189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3750Open in IMG/M
3300025122|Ga0209434_1162708Not Available600Open in IMG/M
3300025131|Ga0209128_1048436Not Available1574Open in IMG/M
3300025131|Ga0209128_1163871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.655Open in IMG/M
3300025133|Ga0208299_1088833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1068Open in IMG/M
3300025488|Ga0209141_1051744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.918Open in IMG/M
3300025660|Ga0209045_1032470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1799Open in IMG/M
3300025873|Ga0209757_10027131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1618Open in IMG/M
3300026087|Ga0208113_1031470All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1524Open in IMG/M
3300026253|Ga0208879_1034151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2643Open in IMG/M
3300026268|Ga0208641_1061556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1130Open in IMG/M
3300027685|Ga0209554_1044696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1658Open in IMG/M
3300027779|Ga0209709_10098724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1535Open in IMG/M
3300027813|Ga0209090_10463687Not Available597Open in IMG/M
3300027844|Ga0209501_10369396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes859Open in IMG/M
3300027847|Ga0209402_10116687All Organisms → Viruses1824Open in IMG/M
3300028192|Ga0257107_1050239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1288Open in IMG/M
3300028192|Ga0257107_1097895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.878Open in IMG/M
3300028487|Ga0257109_1175184Not Available618Open in IMG/M
3300028488|Ga0257113_1158029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.679Open in IMG/M
3300031757|Ga0315328_10681858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.582Open in IMG/M
3300032138|Ga0315338_1044324All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300032278|Ga0310345_10239055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1661Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine52.67%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine14.67%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater8.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine6.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine3.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.67%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.67%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.33%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.33%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.67%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.67%
Diffuse Hydrothermal FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids0.67%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000150Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 120mEnvironmentalOpen in IMG/M
3300000151Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 200mEnvironmentalOpen in IMG/M
3300000158Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100mEnvironmentalOpen in IMG/M
3300000164Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 200mEnvironmentalOpen in IMG/M
3300000167Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120mEnvironmentalOpen in IMG/M
3300000174Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 200mEnvironmentalOpen in IMG/M
3300000211Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 135mEnvironmentalOpen in IMG/M
3300000214Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 200mEnvironmentalOpen in IMG/M
3300000325Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100mEnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003495Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNAEnvironmentalOpen in IMG/M
3300003496Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_200m_DNAEnvironmentalOpen in IMG/M
3300003498Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNAEnvironmentalOpen in IMG/M
3300003542Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNAEnvironmentalOpen in IMG/M
3300003600Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_120m_DNAEnvironmentalOpen in IMG/M
3300003619Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNAEnvironmentalOpen in IMG/M
3300004276Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165mEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005425Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199EnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005428Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253EnvironmentalOpen in IMG/M
3300005431Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75EnvironmentalOpen in IMG/M
3300005604Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63EnvironmentalOpen in IMG/M
3300005948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LVEnvironmentalOpen in IMG/M
3300005969Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_AEnvironmentalOpen in IMG/M
3300006002Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_AEnvironmentalOpen in IMG/M
3300006013Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_BEnvironmentalOpen in IMG/M
3300006019Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_AEnvironmentalOpen in IMG/M
3300006076Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid AEnvironmentalOpen in IMG/M
3300006310Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500mEnvironmentalOpen in IMG/M
3300006311Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000mEnvironmentalOpen in IMG/M
3300006313Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770mEnvironmentalOpen in IMG/M
3300006330Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000mEnvironmentalOpen in IMG/M
3300006331Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006341Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770mEnvironmentalOpen in IMG/M
3300006347Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000mEnvironmentalOpen in IMG/M
3300006414Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500mEnvironmentalOpen in IMG/M
3300006567Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770mEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300007160Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000mEnvironmentalOpen in IMG/M
3300007291Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_AEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020398Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072)EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300020449Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300022227Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022888 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MGEnvironmentalOpen in IMG/M
3300022902 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MGEnvironmentalOpen in IMG/M
3300022912 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MGEnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300024256 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MGEnvironmentalOpen in IMG/M
3300024257 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MGEnvironmentalOpen in IMG/M
3300024258 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MGEnvironmentalOpen in IMG/M
3300024339 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MGEnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025097Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025488Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025660Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300026087Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026253Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026268Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes)EnvironmentalOpen in IMG/M
3300027685Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300028192Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500mEnvironmentalOpen in IMG/M
3300028487Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000mEnvironmentalOpen in IMG/M
3300028488Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320mEnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300032138Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI48aug10_120mDRAFT_104115723300000150MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
SI53jan11_200mDRAFT_100447863300000151MarineMPTTWSTAXTSWSLATYTWSDFSIAYEXSLXGXVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
SI54feb11_100mDRAFT_102892833300000158MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQE
SI39no09_200mDRAFT_102079023300000164MarineMPTTWSTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
SI39nov09_120mDRAFT_101242613300000167MarineDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
SI39nov09_120mDRAFT_103152323300000167MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
SI60aug11_200mDRAFT_101499743300000174MarineTTWSTAITSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
SI53jan11_135mDRAFT_100894323300000211MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNKIKQKVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
SI54feb11_200mDRAFT_102523813300000214MarineTYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
SI39nov09_100mDRAFT_101469333300000325MarineMPTTWSTAITSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
GBIDBA_1002355823300001683Hydrothermal Vent PlumeMPTTWTTAITSWSLATYTWSDFSIAYELSLIREVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
GOS2246_1000719923300001974MarineMPTTWIKADLTWSAAAYTWSDFSVATELLYMVEEGGRSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
GOS2246_1015065513300001974MarineMPTTWTKADTAWSAAAYTWSDFSIAYELDQAGGRAGAYGRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKP
JGI25133J35611_1020392713300002514MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKRKVVELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQ
JGI25134J35505_1001521743300002518MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI25134J35505_1010674423300002518MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNK
JGI25130J35507_101096223300002519MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLVVAKEVGGRYKRDKWGRVIDGPYADFFKDPKKKRKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI25136J39404_106676313300002760MarineTSWSLATYTWSDFSIAYELSLVVAKEVGGRYKRDKWGRVIDGPXADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
JGI26238J51125_101836533300003478MarineMPTTWSTAXTSWSXATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI26244J51143_102739213300003495MarineTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQXVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
JGI26244J51143_106294223300003495MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI26241J51128_109456013300003496MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLXKDRXKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
JGI26241J51128_109587713300003496MarineLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI26239J51126_102019443300003498MarineFMPTTWSTAITSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
FS900DNA_1060268523300003542Diffuse Hydrothermal Flow Volcanic VentMPTTWTKADTAWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKTNKIKQRVEIPLDTKIALSDIDMVIQEVLQKPTVNINVA*
JGI26272J51733_106592713300003600MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIEXIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
JGI26380J51729_1002017213300003619MarineSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0066610_1009516113300004276MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
Ga0066606_1015103623300004280MarineATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA*
Ga0066859_1020823013300005425MarineMPTTWTKASLAWTAASYTWSDFSLAYELFLLRDVSGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0066851_1006060033300005427MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0066851_1022121623300005427MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQEVLNKP
Ga0066851_1022380623300005427MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKRKVVELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQEVLNKP
Ga0066863_1003682343300005428MarineMPTTWTKASLAWTAASYTWGDFSLAYELFLLRDVGGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNINVA*
Ga0066863_1014970523300005428MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKRKVVELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQEVLNKPMVNINVA*
Ga0066854_1013807823300005431MarineMPTTWTKSEIKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0066852_1012573023300005604MarineMPTTWTKASLAWTAASYTWGDFSLAYELFLLRDVGGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0066380_1022288323300005948MarineMPTTWTKSDITWSAAAYTWSDFSIAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0066369_1006824233300005969MarineMPTTWIKADTSWSAATYTWSDFSIAYELSQLGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKSNKIKQKVEIPLDTKIVLSDIDMVIQEVLQKPMVNIHVS*
Ga0066368_1033124423300006002MarineDTTWSAAAYTWSDFSVAYELDQIGGRAGGYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPTDIKIALSDIDMVIQEVLQKPTVDIYVS*
Ga0066382_1016174313300006013MarineADLTWSAATYTWSDFSIATELLFMLEEGGRSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDVKIVLSDIDMVIQEVLQKPTVNIHVS*
Ga0066375_1006788323300006019MarineMPTIWTKADTTWSAAAYTWSDFSLAYELFLLGGRGGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPTDIKIALSDIDMVIQEVLQKPTVDIYVS*
Ga0081592_108102233300006076Diffuse Hydrothermal FluidsMPTTWIKADLTWSAAAYTWSDFSVATELLFMLEEGGGSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068471_126695723300006310MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068478_112572033300006311MarineYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068472_1026781823300006313MarineMPTTWIKSDTTWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068472_1071822323300006313MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068483_130953113300006330MarineSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068488_110713913300006331MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIH
Ga0068488_112943223300006331MarineMPTTWTKSDTAWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068503_1018932033300006340MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDAKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068503_1021481533300006340MarineMPTTWIKSDTTWSAATYTWGDFSLAYELFLLGGRSGAYRRDQIYADLFKDRSKKRKVIELIMKVKSNKIKQRVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0068503_1021481723300006340MarineMPTTWIKSDTTWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPIDTKIVLSDIDMVIQEVLQKPTVNIHVS*
Ga0068493_1023815743300006341MarineMPTTWTKSEIKWSAAAYTWSDFSIAYELSLLGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0099697_113743833300006347MarineSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0099957_158421513300006414MarineELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0099958_131064223300006567MarineWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098033_101899643300006736MarineMPITWENAKLSWNTAAYSWTDFSVAYELFLLGGRGGAYKRQQMYTGLFKDPEKKRKVIQLIMKVKSNEIKKKVQIPADTQIALSDIDMVIQEVLNKPLVNIYVS*
Ga0098033_109763523300006736MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0098035_101106243300006738MarineMPTTWTSATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0098035_112424713300006738MarineYMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYSDFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098035_114052723300006738MarineWTTATTSWSLATYTWSDFSIAYELFLVGDLGGRGTSGRRARQDIYADFFKDRTKKRKVVELIMKVKSNKIRQKVEIPMNTQIALSDIDMVIQEVLQKPTVNINVA*
Ga0098035_116844523300006738MarineMPITWENAKLSWNTAAYSWTDFSVAYELFLLGGRGGAYKRQQMYTGLFKDPEKKRKVIQLIMKVKSNEIKKKVQIPADTQIALSDIDMVIQEVLNKPQVNIYVS*
Ga0098035_118673623300006738MarineMPTTWTKASLAWTAANYTWSDFSLAYELFLLRDVSGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNINVA*
Ga0098040_104045123300006751MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVGDLGGRGTSGRRARQDIYADFFKDRTKKRKVVELIMKVKSNKIRQKVEIPMNTQIALSDIDMVIQEVLQKPTVNINVA*
Ga0098040_106400813300006751MarineMPTTWTKAETAWSAAAYTWSDFSVATELLYMVEEGGRSGKYKRDEWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098039_109403113300006753MarineMPTTWTKAETAWSAAAYTWSDFSVATELLYMVEEGGRSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098039_122547713300006753MarineMPTTWTKASLAWTAANYTWSDFSLAYELFLLRDVSGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098039_133680313300006753MarineMPTTWLTADTPWILATYTFAEFSLAYELGVGGRITRGLKRDKYGRVINGPYADFFKDPVKKREVIQLIMKVKSNQIKQKIEIPLDTQINLSDIDMVIKEVLSKPPVVNINVV*
Ga0098044_102131633300006754MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVGDLGGRGTSGRRARQDIYADFFKDRTKKRKVVELIMKVKSNKIRQKVEIPMNTQIALSDIDMVIQEVLQKSS*
Ga0098044_106499743300006754MarineETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYSDFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098044_112523923300006754MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLVGDVGGRYKREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNI
Ga0098054_105391913300006789MarineMPITWGNATTTWTLASYTWEDFSIAYELAQVIGGRSGAYKREQIYGDLFKDRTKKRKVIQLIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0098055_140726823300006793MarineMPITWGNATTTWTLASYTWEDFSIAYELAQVIGGRSGAYKREQIYGDLFKDRTKKRKVIQLIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLN
Ga0066376_1031384733300006900MarineSDFSLAYELFLLGGRGGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPTDIKIALSDIDMVIQEVLQKPTVDIYVS*
Ga0066372_1007941943300006902MarineMPTTWTKADTAWSAAAYTWSDFSIAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098057_102816533300006926MarineMPTTWTTAITSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0098057_107096113300006926MarineLSWNTAAYSWTDFSVAYELFLLGGRGGAYKRQQMYTGLFKDPEKKRKVIQLIMKVKSNEIKKKVQIPADTQIALSDIDMVIQEVLNKPQVNIYVS*
Ga0098057_114603013300006926MarineTWSDFSIAYELSLLGGRAGGYKRDKWGRVIDGPYSDFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098034_110937823300006927MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0099959_108836423300007160MarineWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0066367_135172613300007291MarineMPTTWTKADTAWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098052_112752933300008050MarineAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0114996_1020588733300009173MarineMPTTWATAITSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRDKWGRVLDGPYADFFKDPKKKRKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0114996_1068301723300009173MarineMPITWGNATTTWTLASYTWEDFSIAYELAQVIGGRSGAYKREEIYGDLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA*
Ga0114993_1039962913300009409MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVAGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0114993_1085238213300009409MarineMPTTWATATTSWSLATYTWSDFSIAYELSLIGEVGGRYKREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDINMVIQEVLNKPTVNINVA*
Ga0114994_1078807123300009420MarineMPTTWATATTSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0114906_128154223300009605Deep OceanMPTTWIKADLTWSAAAYTWSDFSVATELLYMVEGGRSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0115002_1040985413300009706MarineDFSIAYELAQVIGGRSGAYKREEIYGDLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0098056_105850743300010150MarineYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS*
Ga0098047_1010185823300010155MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADFFKDRTKKRKVVELIMKVKSNKIRQKVEIPMNTQIALSDIDMVIQEVLQKPTVNINVA*
Ga0098047_1029938113300010155MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLVGDVGGRYKREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA*
Ga0181367_107460013300017703MarineFSVATELLYMVEEGGRSGKYKRDEWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0181372_100279263300017705MarineDNYMPTTWTSATTSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0181432_101098033300017775SeawaterMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYSDFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0181432_102203643300017775SeawaterTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKSNKIKQRVEIPMDTKIALSDIDMVIQEVLQKPMVNIHVS
Ga0211703_1010777623300020367MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0211637_1030471623300020398MarineSVATELLYMVEEGGRSGKYKRDKWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0211691_1036639223300020447MarineNYMPTTWTKSDITWNAAAYTWSDFSIAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0211642_1051657823300020449MarineMPTTWTKADTAWSAAAYTWSDFSIAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0206684_106616423300021068SeawaterMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRDKWGRTIDGPYADFFKDQEKKRKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0206682_1019227213300021185SeawaterMPTTWTTATTTWSLASYTWSDFSVAYELDQLGGRAGAYQREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPTNTQIALSDIDLVIQEVLNKPMVNINVA
Ga0187827_1019221333300022227SeawaterMPTTWTKASLAWTAASYTWGDFSLAYELFLLRDVGGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDMVIQEVLQKPTVNINVA
(restricted) Ga0233428_100688463300022888SeawaterMPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233428_100769773300022888SeawaterMPTTWSTAITSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233429_105175423300022902SeawaterMPTTWSTATTSWSLATYTWSDFSIAYELSLVGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233429_106272023300022902SeawaterMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233430_109477413300022912SeawaterATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233431_105756433300022916SeawaterMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233433_1037713323300022931SeawaterWSTATTSWSLATYTWSDFSIAYELSLVGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233427_1009641723300022933SeawaterMPTTWSTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233446_102649733300024256SeawaterMPTTWSTATTSWSLATYTWSDFSIAYELSLVGEVGGRYKRQDIYADLFKDRDKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233442_103223813300024257SeawaterMPTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233440_100162963300024258SeawaterMLTTWTTATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNKIKQTVEIPLNTQIVLSDIDMVIQEVLNKPMVNINVA
(restricted) Ga0233445_115333913300024339SeawaterTYTWSDFSIAYELSLVGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTKIALSDIDMVIQEVLNKPMVNINVA
Ga0208012_100038133300025066MarineMPTTWTSATTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0208012_1000500103300025066MarineMPITWGNATTTWTLASYTWEDFSIAYELAQVIGGRSGAYKREQIYGDLFKDRTKKRKVIQLIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNIN
Ga0208920_105481333300025072MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0208156_102451713300025082MarineNFMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0208011_104413933300025096MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVGDLGGRGTSGRRARQDIYADFFKDRTKKRKVVELIMKVKSNKIRQKVEIPMNTQIALSDIDMVIQEVLQKPTVNINVA
Ga0208010_108511123300025097MarineMPTTWTKASLAWTAANYTWSDFSLAYELFLLRDVSGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIRQKVEIPLDTKIALSDIDM
Ga0208013_100425933300025103MarineMPITWGNATTTWTLASYTWEDFSIAYELAQVIGGRSGAYKREQIYGDLFKDRTKKRKVIQLIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0208553_112842813300025109MarineMPTTWTKASLAWTAANYTWSDFSLAYELFLLRDVSGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIQQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0209349_113619813300025112MarineMPTTWTTATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKRKVVELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQEVLNKPMVNINVA
Ga0208790_105542313300025118MarineMPTTWTKAETAWSAAAYTWSDFSVAYELSQLGGRAGGYKRDEWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0209434_100918943300025122MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLVVAKEVGGRYKRDKWGRVIDGPYADFFKDPKKKRKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0209434_116270813300025122MarineMPTTWTKASLAWTAASYTWSDFSLAYELFLLRDVGGRGTYRREQIYADFFKDRTKKKKVIELIMKVKSNKIKQKVEIPLDTKIALSDIDMVIQEVLQKPTVNINVA
Ga0209644_112095813300025125MarineSEFSVAYELYLLRGKRLYKRQDIYADLFKDRSKKKKVVELIMKVKSDKIKQKVEIPINAKISLSDIDMVIQEVLFKPKVKIYVD
Ga0209128_104843633300025131MarineMPTTWTTAITSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNIN
Ga0209128_116387113300025131MarineMPTTWTTATTSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0208299_108883313300025133MarineMPTTWTKAETAWSAAAYTWSDFSVATELLYMVEEGGRSGKYKRDEWGRVIDGPYADFFKDPEKKRKVIELIMKVKSNKIKQKVEIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0209141_105174413300025488MarineTSWSLATYTWSDFSIAYELSLIGEVGGRYKRQDIYADLFKDRAKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0209045_103247013300025660MarineMPTTWSTATTSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0209757_1002713133300025873MarineMPTTWTTATTSWSLATYTWLDFSIAYELFLIVGGRYKREQIYADFFKDRTKKKKVIELIMKIKSNQIKQKVEIPLNTQIALSDIDMVIKEVLNKPMVNINVA
Ga0208113_103147023300026087MarineMPTIWTKADTTWSAAAYTWSDFSVAYELDQIGGRAGGYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPTDIKIALSDIDMVIQEVLQKPTVDIYVS
Ga0208879_103415133300026253MarineMPTTWIKADTSWSAATYTWSDFSIAYELSQLGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKSNKIKQKVEIPLDTKIVLSDIDMVIQEVLQKPMVNIHVS
Ga0208641_106155613300026268MarineATTSWSLATYTWSDFSIAYELFLVSDLGGRGTSGRRARQDIYADLFKDRTKKRKVVELIMKVKSNQIKQKVEIPLDTKIALSDIDMVIQEVLNKPMVNINVA
Ga0209554_104469633300027685MarineMPTTWIKADTTWSAATYTWSDFSIAYELSQLGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKSNKIKQKVEIPLDTKIVLSDIDMVIQEVLQKPMVNIHVS
Ga0209709_1009872423300027779MarineMPTTWATATTSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0209090_1046368713300027813MarineMPTTWATATTSWSLATYTWSDFSIAYELSLVGDVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVN
Ga0209501_1036939613300027844MarineMPTTWATAITSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRDKWGRVLDGPYADFFKDPKKKRKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVN
Ga0209402_1011668713300027847MarineMPTTWATATTSWSLATYTWSDFSIAYELSLIGEVGGRYKREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDINMVIQEVLNKPTVNINVA
Ga0257107_105023923300028192MarineMPTIWTNAETKWSAAAYTWSDFSIAYELDQIGDQIGGRAGGYKRDKWGRVIDGPYSDFFKDPEKKRKVIELIMKVKSNKIKQKVKIPMDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0257107_109789523300028192MarineWTTAITSWSLATYTWSDFSIAYELSLIREVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0257109_117518423300028487MarineMPTTWTKADTAWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRSKKKKVIELIMKVKSNKIKQRVEIPLDTKIALSDIDMVIQEVLQKPTVNIHVS
Ga0257113_115802923300028488MarineMPTTWTKSDTAWSAAAYTWSDFSVAYELDQAGGRAGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPTDIKIALSDIDMVIQEVLQKPTVDIYVS
Ga0315328_1068185823300031757SeawaterMPTTWTTATTSWSLATYTWSDFSIAYELSLVGDVGGRYKREQIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0315338_104432433300032138SeawaterMPTTWTTAITSWSLATYTWSDFSIAYELSLVVAEEVGGRYKRQDIYADLFKDRTKKKKVIELIMKVKSNQIKQKVEIPLNTQIALSDIDMVIQEVLNKPMVNINVA
Ga0310345_1023905523300032278SeawaterMPTTWTKSDITWSAAAYTWSDFSLAYELFLSGGRSGAYRRDQIYADLFKDRTKKRKVIELIMKVKSNKIQQKVEIPIDTKIVLSDIDMVIQEVLQKPTVNIYVS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.