Basic Information | |
---|---|
Family ID | F047408 |
Family Type | Metagenome |
Number of Sequences | 149 |
Average Sequence Length | 50 residues |
Representative Sequence | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLREGN |
Number of Associated Samples | 63 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 83.56 % |
% of genes near scaffold ends (potentially truncated) | 13.42 % |
% of genes from short scaffolds (< 2000 bps) | 97.99 % |
Associated GOLD sequencing projects | 63 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.785 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.987 % of family members) |
Environment Ontology (ENVO) | Unclassified (98.658 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (97.987 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.62% β-sheet: 0.00% Coil/Unstructured: 65.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF03140 | DUF247 | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.79 % |
All Organisms | root | All Organisms | 32.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300013297|Ga0157378_12172020 | Not Available | 606 | Open in IMG/M |
3300014486|Ga0182004_10074474 | Not Available | 1690 | Open in IMG/M |
3300015267|Ga0182122_1007058 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 941 | Open in IMG/M |
3300015267|Ga0182122_1037585 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 605 | Open in IMG/M |
3300015268|Ga0182154_1012191 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 816 | Open in IMG/M |
3300015268|Ga0182154_1037662 | Not Available | 608 | Open in IMG/M |
3300015268|Ga0182154_1042556 | Not Available | 588 | Open in IMG/M |
3300015269|Ga0182113_1076017 | Not Available | 543 | Open in IMG/M |
3300015269|Ga0182113_1093113 | Not Available | 509 | Open in IMG/M |
3300015274|Ga0182188_1021503 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 663 | Open in IMG/M |
3300015274|Ga0182188_1028681 | Not Available | 616 | Open in IMG/M |
3300015274|Ga0182188_1036802 | Not Available | 579 | Open in IMG/M |
3300015275|Ga0182172_1035533 | Not Available | 629 | Open in IMG/M |
3300015276|Ga0182170_1026948 | Not Available | 680 | Open in IMG/M |
3300015276|Ga0182170_1030434 | Not Available | 658 | Open in IMG/M |
3300015276|Ga0182170_1051562 | Not Available | 567 | Open in IMG/M |
3300015276|Ga0182170_1075885 | Not Available | 505 | Open in IMG/M |
3300015277|Ga0182128_1034878 | Not Available | 638 | Open in IMG/M |
3300015279|Ga0182174_1003646 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1214 | Open in IMG/M |
3300015279|Ga0182174_1013354 | Not Available | 848 | Open in IMG/M |
3300015279|Ga0182174_1039177 | Not Available | 634 | Open in IMG/M |
3300015279|Ga0182174_1085061 | Not Available | 503 | Open in IMG/M |
3300015281|Ga0182160_1005815 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1049 | Open in IMG/M |
3300015281|Ga0182160_1009865 | Not Available | 910 | Open in IMG/M |
3300015281|Ga0182160_1034119 | Not Available | 650 | Open in IMG/M |
3300015281|Ga0182160_1041988 | Not Available | 615 | Open in IMG/M |
3300015281|Ga0182160_1054506 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 572 | Open in IMG/M |
3300015282|Ga0182124_1043714 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 605 | Open in IMG/M |
3300015282|Ga0182124_1054996 | Not Available | 567 | Open in IMG/M |
3300015282|Ga0182124_1057562 | Not Available | 559 | Open in IMG/M |
3300015283|Ga0182156_1026706 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 711 | Open in IMG/M |
3300015283|Ga0182156_1087181 | Not Available | 503 | Open in IMG/M |
3300015286|Ga0182176_1039583 | Not Available | 641 | Open in IMG/M |
3300015286|Ga0182176_1041074 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 634 | Open in IMG/M |
3300015286|Ga0182176_1058518 | Not Available | 568 | Open in IMG/M |
3300015287|Ga0182171_1015721 | Not Available | 817 | Open in IMG/M |
3300015289|Ga0182138_1009714 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 934 | Open in IMG/M |
3300015289|Ga0182138_1044364 | Not Available | 618 | Open in IMG/M |
3300015289|Ga0182138_1055394 | Not Available | 580 | Open in IMG/M |
3300015289|Ga0182138_1067011 | Not Available | 548 | Open in IMG/M |
3300015291|Ga0182125_1007892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1012 | Open in IMG/M |
3300015291|Ga0182125_1036998 | Not Available | 662 | Open in IMG/M |
3300015291|Ga0182125_1070513 | Not Available | 550 | Open in IMG/M |
3300015292|Ga0182141_1012648 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 886 | Open in IMG/M |
3300015292|Ga0182141_1068343 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 554 | Open in IMG/M |
3300015292|Ga0182141_1087241 | Not Available | 515 | Open in IMG/M |
3300015295|Ga0182175_1007946 | Not Available | 1029 | Open in IMG/M |
3300015295|Ga0182175_1010394 | Not Available | 955 | Open in IMG/M |
3300015295|Ga0182175_1043453 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 642 | Open in IMG/M |
3300015295|Ga0182175_1072162 | Not Available | 554 | Open in IMG/M |
3300015298|Ga0182106_1044762 | Not Available | 647 | Open in IMG/M |
3300015298|Ga0182106_1085833 | Not Available | 532 | Open in IMG/M |
3300015299|Ga0182107_1034371 | Not Available | 702 | Open in IMG/M |
3300015300|Ga0182108_1084579 | Not Available | 541 | Open in IMG/M |
3300015302|Ga0182143_1032577 | Not Available | 710 | Open in IMG/M |
3300015302|Ga0182143_1047599 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 638 | Open in IMG/M |
3300015302|Ga0182143_1064744 | Not Available | 583 | Open in IMG/M |
3300015303|Ga0182123_1075965 | Not Available | 544 | Open in IMG/M |
3300015304|Ga0182112_1023555 | Not Available | 781 | Open in IMG/M |
3300015304|Ga0182112_1081284 | Not Available | 546 | Open in IMG/M |
3300015305|Ga0182158_1018393 | Not Available | 830 | Open in IMG/M |
3300015305|Ga0182158_1020708 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 804 | Open in IMG/M |
3300015305|Ga0182158_1083364 | Not Available | 539 | Open in IMG/M |
3300015307|Ga0182144_1010385 | Not Available | 989 | Open in IMG/M |
3300015307|Ga0182144_1052942 | Not Available | 626 | Open in IMG/M |
3300015307|Ga0182144_1074015 | Not Available | 567 | Open in IMG/M |
3300015307|Ga0182144_1100216 | Not Available | 515 | Open in IMG/M |
3300015314|Ga0182140_1021486 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 828 | Open in IMG/M |
3300015321|Ga0182127_1060150 | Not Available | 633 | Open in IMG/M |
3300015321|Ga0182127_1117285 | Not Available | 512 | Open in IMG/M |
3300015322|Ga0182110_1033102 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 752 | Open in IMG/M |
3300015322|Ga0182110_1035470 | Not Available | 738 | Open in IMG/M |
3300015322|Ga0182110_1060777 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 629 | Open in IMG/M |
3300015322|Ga0182110_1085173 | Not Available | 568 | Open in IMG/M |
3300015322|Ga0182110_1118071 | Not Available | 511 | Open in IMG/M |
3300015323|Ga0182129_1063969 | Not Available | 603 | Open in IMG/M |
3300015341|Ga0182187_1014018 | Not Available | 1222 | Open in IMG/M |
3300015341|Ga0182187_1078365 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 702 | Open in IMG/M |
3300015342|Ga0182109_1085476 | Not Available | 720 | Open in IMG/M |
3300015343|Ga0182155_1047551 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 872 | Open in IMG/M |
3300015343|Ga0182155_1091298 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 698 | Open in IMG/M |
3300015343|Ga0182155_1138153 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 603 | Open in IMG/M |
3300015343|Ga0182155_1201900 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 523 | Open in IMG/M |
3300015344|Ga0182189_1101141 | Not Available | 682 | Open in IMG/M |
3300015345|Ga0182111_1082609 | Not Available | 759 | Open in IMG/M |
3300015345|Ga0182111_1103314 | Not Available | 700 | Open in IMG/M |
3300015345|Ga0182111_1117104 | Not Available | 668 | Open in IMG/M |
3300015346|Ga0182139_1052846 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 893 | Open in IMG/M |
3300015346|Ga0182139_1192516 | Not Available | 553 | Open in IMG/M |
3300015347|Ga0182177_1157979 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 600 | Open in IMG/M |
3300015347|Ga0182177_1206151 | Not Available | 541 | Open in IMG/M |
3300015347|Ga0182177_1213866 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 533 | Open in IMG/M |
3300015351|Ga0182161_1038160 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1057 | Open in IMG/M |
3300015351|Ga0182161_1108083 | Not Available | 719 | Open in IMG/M |
3300015351|Ga0182161_1182618 | Not Available | 587 | Open in IMG/M |
3300015351|Ga0182161_1194747 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 572 | Open in IMG/M |
3300015351|Ga0182161_1259163 | Not Available | 508 | Open in IMG/M |
3300015355|Ga0182159_1158167 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 710 | Open in IMG/M |
3300015355|Ga0182159_1175919 | Not Available | 679 | Open in IMG/M |
3300015355|Ga0182159_1193488 | Not Available | 652 | Open in IMG/M |
3300015355|Ga0182159_1233148 | Not Available | 602 | Open in IMG/M |
3300015355|Ga0182159_1248616 | Not Available | 585 | Open in IMG/M |
3300015355|Ga0182159_1333718 | Not Available | 514 | Open in IMG/M |
3300017404|Ga0182203_1031963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 842 | Open in IMG/M |
3300017404|Ga0182203_1040992 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 782 | Open in IMG/M |
3300017404|Ga0182203_1048431 | Not Available | 744 | Open in IMG/M |
3300017409|Ga0182204_1018894 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 868 | Open in IMG/M |
3300017409|Ga0182204_1048253 | Not Available | 662 | Open in IMG/M |
3300017409|Ga0182204_1102334 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 528 | Open in IMG/M |
3300017410|Ga0182207_1063872 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 706 | Open in IMG/M |
3300017410|Ga0182207_1141249 | Not Available | 543 | Open in IMG/M |
3300017411|Ga0182208_1129681 | Not Available | 502 | Open in IMG/M |
3300017413|Ga0182222_1091731 | Not Available | 525 | Open in IMG/M |
3300017413|Ga0182222_1094359 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 521 | Open in IMG/M |
3300017413|Ga0182222_1097622 | Not Available | 516 | Open in IMG/M |
3300017415|Ga0182202_1019287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 923 | Open in IMG/M |
3300017415|Ga0182202_1058690 | Not Available | 663 | Open in IMG/M |
3300017415|Ga0182202_1090748 | Not Available | 578 | Open in IMG/M |
3300017415|Ga0182202_1140963 | Not Available | 500 | Open in IMG/M |
3300017420|Ga0182228_1020849 | Not Available | 1016 | Open in IMG/M |
3300017424|Ga0182219_1030178 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 811 | Open in IMG/M |
3300017424|Ga0182219_1074423 | Not Available | 613 | Open in IMG/M |
3300017425|Ga0182224_1057038 | Not Available | 705 | Open in IMG/M |
3300017430|Ga0182192_1039190 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 835 | Open in IMG/M |
3300017433|Ga0182206_1020400 | Not Available | 950 | Open in IMG/M |
3300017436|Ga0182209_1040436 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 797 | Open in IMG/M |
3300017436|Ga0182209_1046366 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 765 | Open in IMG/M |
3300017438|Ga0182191_1020190 | Not Available | 1025 | Open in IMG/M |
3300017438|Ga0182191_1118738 | Not Available | 583 | Open in IMG/M |
3300017438|Ga0182191_1127571 | Not Available | 569 | Open in IMG/M |
3300017438|Ga0182191_1166736 | Not Available | 519 | Open in IMG/M |
3300017438|Ga0182191_1171746 | Not Available | 513 | Open in IMG/M |
3300017442|Ga0182221_1064579 | Not Available | 679 | Open in IMG/M |
3300017443|Ga0182193_1022689 | Not Available | 1016 | Open in IMG/M |
3300017443|Ga0182193_1063009 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 740 | Open in IMG/M |
3300017443|Ga0182193_1177266 | Not Available | 522 | Open in IMG/M |
3300017681|Ga0182226_1047973 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 771 | Open in IMG/M |
3300017682|Ga0182229_1054520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 679 | Open in IMG/M |
3300017684|Ga0182225_1011268 | Not Available | 1133 | Open in IMG/M |
3300017684|Ga0182225_1041251 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 741 | Open in IMG/M |
3300017685|Ga0182227_1092784 | Not Available | 580 | Open in IMG/M |
3300017685|Ga0182227_1119340 | Not Available | 528 | Open in IMG/M |
3300017686|Ga0182205_1087231 | Not Available | 632 | Open in IMG/M |
3300017690|Ga0182223_1023396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 792 | Open in IMG/M |
3300017690|Ga0182223_1106193 | Not Available | 526 | Open in IMG/M |
3300025942|Ga0207689_10168125 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1807 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0157378_121720201 | 3300013297 | Miscanthus Rhizosphere | LFLAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLTGKLNEQQEGLREGN* |
Ga0182004_100744743 | 3300014486 | Root | MRLMWSSFLAGKAPEPLLGRLFREKHVEDLLGLAKPSRMPTNLARRLAKQQEGLREE* |
Ga0182122_10070581 | 3300015267 | Miscanthus Phyllosphere | LAENAPELLPERPVGEEHVEDLLGQARPPRMLLNLTEKLNEHQEGLREGN* |
Ga0182122_10375851 | 3300015267 | Miscanthus Phyllosphere | LFLAEKAPELLPRRPVREERVEDLLGPARPPRMPLNLTGKLNEQQEGLRERNYGIRS* |
Ga0182154_10121912 | 3300015268 | Miscanthus Phyllosphere | LAGKAPKLLPGRPVGEEHVEDLLGLVRPPRMPTNLAGRHAEQQEGSREGN* |
Ga0182154_10376621 | 3300015268 | Miscanthus Phyllosphere | LAEKAPELLPGRPIGEEHVEDLLGLAKPPRMPTNLTGRRVEQQERLKKE* |
Ga0182154_10425562 | 3300015268 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRKPLNLAGKLNEQQEGLRERN* |
Ga0182113_10760171 | 3300015269 | Miscanthus Phyllosphere | LVEKAPEPLLEGSIGEEHVEDLLGPTRPPRMPLNLVGKLNEQQERSREGY* |
Ga0182113_10931131 | 3300015269 | Miscanthus Phyllosphere | LFLAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN* |
Ga0182188_10215031 | 3300015274 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLASKFNEQ* |
Ga0182188_10286811 | 3300015274 | Miscanthus Phyllosphere | LAKNAPELLPGRPIREEHVVDLLGPARPPRMPLNLVGKLNEQQKGLREGN* |
Ga0182188_10368022 | 3300015274 | Miscanthus Phyllosphere | LAKNAPELPPERPIGEEHVEDLLGPARPPRKPTNLSRRRAEQQEGLREEI* |
Ga0182172_10355331 | 3300015275 | Miscanthus Phyllosphere | LAENAPELLPGGPVGEEHMDDLLEPARPPRMPLNLVGKLNEQQEGLKERY* |
Ga0182170_10269483 | 3300015276 | Miscanthus Phyllosphere | LAENAPELLPERPVVEEYVEDLLGLARPPRMPTNLAGRRAEQQ |
Ga0182170_10304341 | 3300015276 | Miscanthus Phyllosphere | LFLAGKAPELLPGRPVREEHVEDLLEPTRPPRMPLNLAEKLNEQQEGLRERN* |
Ga0182170_10515621 | 3300015276 | Miscanthus Phyllosphere | LVEKAPELLPERSVREEHVEDLLRPAMLPRMPLNIAGKLNEQQKRLREGN* |
Ga0182170_10758851 | 3300015276 | Miscanthus Phyllosphere | LAEKAPELLPGRPIGEEDVEDLLGPARPPRMPTNLAGRHAEQQEGFREE* |
Ga0182128_10348782 | 3300015277 | Miscanthus Phyllosphere | LAGKAHELLLGRPVREEHMEDLLGLGRPPRMLLNLTRKLNKQQEGMRERNEGIRS* |
Ga0182174_10036464 | 3300015279 | Miscanthus Phyllosphere | LFLAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQKGLREGN* |
Ga0182174_10133542 | 3300015279 | Miscanthus Phyllosphere | LFLAGKTPDPLPGKPIREEHVEDLLGLARPPRMSLNLVGKLNEQQDGLREGN* |
Ga0182174_10391771 | 3300015279 | Miscanthus Phyllosphere | LFLAGKAPELLLGRPVREEHVEDLLGPARPPRMLLNLAGKLNE* |
Ga0182174_10850611 | 3300015279 | Miscanthus Phyllosphere | LAGKASELLQGRPVGEEHMKGLLGPARPARIPLNLARKLNKQQEGLREG* |
Ga0182160_10058152 | 3300015281 | Miscanthus Phyllosphere | LVKKTPELLPGRPVGEEHVEDLLGPARPPRMPLNLAEKLNEQQEGLKEGY* |
Ga0182160_10098651 | 3300015281 | Miscanthus Phyllosphere | LFLAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN* |
Ga0182160_10341191 | 3300015281 | Miscanthus Phyllosphere | MFLAGKAPELLPGRPVGEEHVEDLLGPARPPRMPLNLVGKLNEQQEGLREGN* |
Ga0182160_10419881 | 3300015281 | Miscanthus Phyllosphere | LAGKAPKLLPGRPVGEEHVEDLLGPARPPRMLLNLARKLNEQQEGLREG* |
Ga0182160_10545061 | 3300015281 | Miscanthus Phyllosphere | LFLAGKAPELLPERPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLR |
Ga0182124_10437141 | 3300015282 | Miscanthus Phyllosphere | LAEKAPELLPGRPVGEEHVEEILGLARPPKMQLNLAEKLNKQQEGLKEKS* |
Ga0182124_10549962 | 3300015282 | Miscanthus Phyllosphere | LAGKTPDPLPGKPIREEHVEDLLGLARPPRMSLNLVGKLNEQQKGLREGN* |
Ga0182124_10575621 | 3300015282 | Miscanthus Phyllosphere | MYSPFLAENAPELLPERLVGKEHMEDLQGPSMPPRMLLNLAGKLNKQQEGWREGN* |
Ga0182156_10267061 | 3300015283 | Miscanthus Phyllosphere | LAENAPELLPRRPVGEEHMEDLLGPARPPSMLLNLTGKVNEQQEGLREGN* |
Ga0182156_10871811 | 3300015283 | Miscanthus Phyllosphere | LAENAPELLPERPVREEHVEDLLGPARPPRMLLNLTEKLNEQQKGLREGN* |
Ga0182176_10395831 | 3300015286 | Miscanthus Phyllosphere | LFLAENAPKLLPERPVGEEHVEDLLGQARPPRMLLNLTEKLNEHQEELREGN* |
Ga0182176_10410741 | 3300015286 | Miscanthus Phyllosphere | MYNLFLAGKALELLAERPIREEHIEDLLGPARPSRMPLNLVGKLSEQQERLREGN* |
Ga0182176_10585182 | 3300015286 | Miscanthus Phyllosphere | MFLAGKAPELLPGRSVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLREGN* |
Ga0182171_10157211 | 3300015287 | Miscanthus Phyllosphere | LAEKAPELLLGRPVREEHVEDLLGPARPPRMPLNLARKLNEQQKGLREGN* |
Ga0182138_10097143 | 3300015289 | Miscanthus Phyllosphere | LFLAGKAPELLPERPVREEHVEGLLGPARPPRMPLNLAGKLNE* |
Ga0182138_10443641 | 3300015289 | Miscanthus Phyllosphere | LAEKALKLLSRRTVGEKHVEDLLEPTRPPRKPTNLAGRRAEQ* |
Ga0182138_10553941 | 3300015289 | Miscanthus Phyllosphere | LFLAEKAPELLPGRPVREEHVEDLLGLARPPRMPLNLAGKLNEQQEGLREGN* |
Ga0182138_10670111 | 3300015289 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLAEKLNKQQEGFREGN* |
Ga0182125_10078922 | 3300015291 | Miscanthus Phyllosphere | LFLAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNIARKLNEQQDGLREGN* |
Ga0182125_10369981 | 3300015291 | Miscanthus Phyllosphere | LAEKALELLLGRPIREEHVENLLGPARPPMMTQNLIGKLNKQQEGLREE* |
Ga0182125_10705131 | 3300015291 | Miscanthus Phyllosphere | LAEKAPELLPGRPVREEHVEDLLGPARLPRMPPNLAGKINEQQEGLREE* |
Ga0182141_10126481 | 3300015292 | Miscanthus Phyllosphere | LAENAPELLPGRPVREEHVEDLLGPARPPRMLLNLAEKLNEQREGLREGN* |
Ga0182141_10683432 | 3300015292 | Miscanthus Phyllosphere | LFLAEKAPELLPERPVREKHVEDLLVPARPPRMPLNLAEKLNEQQEGLRERNYGIRS* |
Ga0182141_10872411 | 3300015292 | Miscanthus Phyllosphere | LFLAEKAPELLPGRPVGVEHVEDLLGPARPPRMPLNLSGKLNEQQEGLREE* |
Ga0182175_10079461 | 3300015295 | Miscanthus Phyllosphere | LAEKALELLLGRPVGEEHVEDLLGQARPPRMLLNLTEKLNEHQEELREGN* |
Ga0182175_10103941 | 3300015295 | Miscanthus Phyllosphere | MYSPFLAENAPELLPERLVGKEHMEDLQGPSRPPRMPLNLARKLNKQQEGWREGN* |
Ga0182175_10434532 | 3300015295 | Miscanthus Phyllosphere | LAENAPELLPGRPIGEEHVEDLLGPARPPRMLTNLVRKRAEQQEGLR* |
Ga0182175_10721622 | 3300015295 | Miscanthus Phyllosphere | MWSSILAGKAPELLPGKPVGEEHVEDLLGSARPSRMSTNLTGRRAEQQEGMRGLKG* |
Ga0182106_10447621 | 3300015298 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRIPLNLAGKLNEQQEGLREGN* |
Ga0182106_10858332 | 3300015298 | Miscanthus Phyllosphere | LAENTPELLLGRPVGEEHVEDLLGPARPPRISKNLAGRRDEQREELGEE* |
Ga0182107_10343711 | 3300015299 | Miscanthus Phyllosphere | LAEKTPELLPGRPIGEEHVEDLLGLARPPRMPTNLAGKLNEQQEGVEREILGQRS* |
Ga0182108_10845791 | 3300015300 | Miscanthus Phyllosphere | LFLAEKAPELLPERPVEKEHVEDLLGPARPPRMLLNLTGKLNEHQEGLREGN* |
Ga0182143_10325771 | 3300015302 | Miscanthus Phyllosphere | LDGKAPVLLPRKPVSKEHEEDLLGPARLPRMPLNLARKLNKQQEGLREE* |
Ga0182143_10475991 | 3300015302 | Miscanthus Phyllosphere | LAENAPELLPERPVGEEHVEDLLGLARPPRMLLNLTGKLNEHQEGLKEGN* |
Ga0182143_10647441 | 3300015302 | Miscanthus Phyllosphere | GKARELILRRPVGEEHVEDLLGPARLHRMLLNLAGKLNERQEGLREGN* |
Ga0182123_10759651 | 3300015303 | Miscanthus Phyllosphere | LAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEYQEWLREGN* |
Ga0182112_10235551 | 3300015304 | Miscanthus Phyllosphere | MYNLFLAKNASELLPGRPVGEKYVEDLIKPARPPRMPLNLARKLNEQQ* |
Ga0182112_10812841 | 3300015304 | Miscanthus Phyllosphere | LAEKALELLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN* |
Ga0182158_10183931 | 3300015305 | Miscanthus Phyllosphere | LAEKALELLPGRPVREEHVEDLLGPVMPHRMPMNLARKLNEQQEGLKEGY* |
Ga0182158_10207082 | 3300015305 | Miscanthus Phyllosphere | LAERAPELLLGRPVGEEHVEGLLGLASLPRMPLNLAGKLNEQRKGLREG* |
Ga0182158_10833641 | 3300015305 | Miscanthus Phyllosphere | LFLAEKAPELLPGRPVREEHVEDLLGLARPPRMPLNLAGKLNEQQEGLREE* |
Ga0182144_10103851 | 3300015307 | Miscanthus Phyllosphere | LAEKAPELLLGRPVREEHVEDLLGPAMPPRMPLNLAGKLNEQQEGLKEGY* |
Ga0182144_10529421 | 3300015307 | Miscanthus Phyllosphere | LAGKAPELLQGRPVRKEHVEDLLGPARPPRMPLNLAEKLNKQQEGFREGN* |
Ga0182144_10740151 | 3300015307 | Miscanthus Phyllosphere | LFLAEKAPEPLPGRPVREEHVEDLLGPTRPPRMLLNLTGKLNEQQEGLREE* |
Ga0182144_11002161 | 3300015307 | Miscanthus Phyllosphere | LAEKALELLLGRPVGEEHVEDLLGLARPPRMLLNLTGKLNEQQEGLREEN* |
Ga0182140_10214861 | 3300015314 | Miscanthus Phyllosphere | LAEKTPELLPGRPIGEEHVEDLLGLARPPRMPTNLAGRHAEQQEGSREGN* |
Ga0182127_10601501 | 3300015321 | Miscanthus Phyllosphere | LAEKAPELLPGRPVREEHVEDLLGLARPPRMPLNLAGKLNEQQEGLRKEN* |
Ga0182127_11172851 | 3300015321 | Miscanthus Phyllosphere | LVEKAPEPLLEGSIGEEHVEDLLGPTRPPRMPLNLIGKLNQQQEGLREGN* |
Ga0182110_10331022 | 3300015322 | Miscanthus Phyllosphere | LAGKTPELLPGRLVREEHVEDLLGPARPSRMPLNLVGKLSEQQERLREGN* |
Ga0182110_10354701 | 3300015322 | Miscanthus Phyllosphere | MAEKAPEFLPGRSVGEEHMEDLLGPARPPRMPTNLVGRRVKQQEGLREG* |
Ga0182110_10607771 | 3300015322 | Miscanthus Phyllosphere | LFLAENAPKLLSKRPGGEEHVEDLLGLARPPKMPLNLTGKLNKHQKGLREEN* |
Ga0182110_10851731 | 3300015322 | Miscanthus Phyllosphere | LVGKAPEPFPGRPVREEHVEDLLGPARPPRIPLNLAGKLNEEQKGLREGN* |
Ga0182110_11180711 | 3300015322 | Miscanthus Phyllosphere | VEHVFFVENTYELLSGRSVGEEHVEDLLGPARPPRMLLNLTGKLNEHQEGLREGN* |
Ga0182129_10639691 | 3300015323 | Miscanthus Phyllosphere | LFLARKATEPLLGRPVRKEHVEDLLGPARLPRMPLNLAGKLNEQQEGLRERN* |
Ga0182187_10140181 | 3300015341 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHMEDLLGLARPPKMPTNLIGRHAEQQKGLREG* |
Ga0182187_10783652 | 3300015341 | Miscanthus Phyllosphere | LAEKTPEFLLGRPVREEYVDDLLGPARLPRMPLNLAEKLNEQ* |
Ga0182187_11150261 | 3300015341 | Miscanthus Phyllosphere | ELLLGRPIKEEHIEDLLGPATLPRMPLNLATKLNEQQGWDERGVKG* |
Ga0182109_10854761 | 3300015342 | Miscanthus Phyllosphere | MFLAEKAHKLLSKRPIEEEHVEDLLGPARPPRMPLNLAEKLNEQQEGLKEGY* |
Ga0182155_10475512 | 3300015343 | Miscanthus Phyllosphere | LVEKAPKLLPERPVGEEHVEDLLGSTRLPRMPLNLAGKLNEHQEGLREE* |
Ga0182155_10912981 | 3300015343 | Miscanthus Phyllosphere | LAGKAPELLPRRPIGEEHVEDLLGPAMPPKMPKNLAGRPEQQKGLRGVKGQK |
Ga0182155_11381531 | 3300015343 | Miscanthus Phyllosphere | LFLAGKAPELLPGRPVREEHVEDLLGPARPPRKPLNLAGKLNEQQEGLRERN* |
Ga0182155_12019001 | 3300015343 | Miscanthus Phyllosphere | LFLAENAPKLLPERPVREERVEDLLGPARPPRMPLNLTGKLNEQQEGL |
Ga0182189_11011411 | 3300015344 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLREGN* |
Ga0182111_10826092 | 3300015345 | Miscanthus Phyllosphere | MLSSFLAGIAPRPFLGRPMGEEHVERLLGPARPPRMPTNLARRHAEQQEGVEKG* |
Ga0182111_11033141 | 3300015345 | Miscanthus Phyllosphere | LAENAPELLPGGPVREEHVEDLLGLARLPRMPLNLTEKLNEQHEGLRKEN* |
Ga0182111_11171041 | 3300015345 | Miscanthus Phyllosphere | PELLTGRPVGEDHEEGALGPARPPRTPSNLAGRCDEQQEGLGKR* |
Ga0182139_10528462 | 3300015346 | Miscanthus Phyllosphere | LAENAPELLPIRPIGEEHGEDLLGPARPPRMPLNLAGKLNEQQDGLREGN* |
Ga0182139_11925162 | 3300015346 | Miscanthus Phyllosphere | LAEKTPEPLPGGSVREKHMEDLLGPARPPRMPTNLAGRHVEQQEGLKTE* |
Ga0182177_11579792 | 3300015347 | Miscanthus Phyllosphere | LAENTPELLPGRPIREKHVEDLLGPARPPRMPTNLARKCAKQQEGLREAN* |
Ga0182177_12061511 | 3300015347 | Miscanthus Phyllosphere | LAENAPELLLGRLVGEEHVEDLLGPARPPRMPLNLASKFNEQQEGLREEN* |
Ga0182177_12138662 | 3300015347 | Miscanthus Phyllosphere | LAKKAPELLPGRPVKEEHVEDLLGPARPPRMPLNLIGKLNEQQKGLREGN* |
Ga0182161_10381601 | 3300015351 | Miscanthus Phyllosphere | LAENAPELLPERPVGEEHVEDLLGLARPPRMLLNLTGKLNEHQEGLK |
Ga0182161_11080831 | 3300015351 | Miscanthus Phyllosphere | LAEKAPELLLGRPVREEHVEDLLGPARPPRMSLNLAEKLNKQQKGLREGN* |
Ga0182161_11826182 | 3300015351 | Miscanthus Phyllosphere | LVENAPELLLEIPVGEEHVEDLLGPARLLRMLTNLIGRRVEQQEGLREGN* |
Ga0182161_11947471 | 3300015351 | Miscanthus Phyllosphere | LVKKTPELLPGRPVGEEHVEDLLGSARPPRMPLYLAGNFNEQIDLIFF* |
Ga0182161_12591631 | 3300015351 | Miscanthus Phyllosphere | LAGKTPELLPGRPVGEEHVEDLLGPARPPRISTNLAGRRAEQQEGLRERSKRAKGVD |
Ga0182159_11581671 | 3300015355 | Miscanthus Phyllosphere | LAENAPELLPERPVWEEHVEDLLGPARPPRMLTNHAGIHAEQQEGSREGN* |
Ga0182159_11759191 | 3300015355 | Miscanthus Phyllosphere | LLGRPVREERVDDLLGPASPSRMPSNLVERHAEQQEGLTVEN* |
Ga0182159_11934881 | 3300015355 | Miscanthus Phyllosphere | LVGKAPELLPERPVREEHVEDMLGPARPPRMPLNLVGKLNEQQEGLREGN* |
Ga0182159_12331481 | 3300015355 | Miscanthus Phyllosphere | FLAGKAPEPLPGGPIREEHVEDLLGLARPLSMPTNLVGRCAEQQEGVKG* |
Ga0182159_12486161 | 3300015355 | Miscanthus Phyllosphere | MWSSILAGKAPELLPGRPVGEEHVEDLLGLVRPPRMLTNLAGRRAEQHERLREEN* |
Ga0182159_13337181 | 3300015355 | Miscanthus Phyllosphere | LAENAPELLPGGPVGEEHMDDLLEPARPPRMPLNLVGKLNEQQEGL |
Ga0182203_10319632 | 3300017404 | Miscanthus Phyllosphere | LAENAPELLPERPVWEEHVEDLLGPARPPRMLLNLTGKLN |
Ga0182203_10409921 | 3300017404 | Miscanthus Phyllosphere | LAEKAPEPLLEGSIGEEHVEDLLGPTRPPRMPLNLVGKLNEQQERSREGY |
Ga0182203_10484311 | 3300017404 | Miscanthus Phyllosphere | LAEKTPELLPRRPVGEEHVGDLLGPARPPRMPLNLDGKLNEQQE |
Ga0182204_10188942 | 3300017409 | Miscanthus Phyllosphere | LAENTPELLLERPVVEEYVEDLLGQARPPRMPLNLTGKLNEQQEGLRKEN |
Ga0182204_10482531 | 3300017409 | Miscanthus Phyllosphere | LAEKTPELLPGRPIGEEHVEDLLGLARPPRMPLNLAGKLNEQQEGLRQGN |
Ga0182204_11023341 | 3300017409 | Miscanthus Phyllosphere | MFLAGKAPELLPGRPVGEEHVEDLLGPARPPRMPLNLVGKLNEQQEGLRERN |
Ga0182207_10638721 | 3300017410 | Miscanthus Phyllosphere | LAKNAPELLPGRPIREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN |
Ga0182207_11412492 | 3300017410 | Miscanthus Phyllosphere | LAENAPELLPRRPVMEEHVEDLLGLARPPRMPLNLAEKLNEQQEGLTER |
Ga0182208_11296811 | 3300017411 | Miscanthus Phyllosphere | LAEKAPKLLPGRPVREEHVEDLLGPARPPRMPLNLARKLNEWQEGLREGN |
Ga0182222_10917312 | 3300017413 | Miscanthus Phyllosphere | LFLAGKAPELLPGRPVREKHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN |
Ga0182222_10943591 | 3300017413 | Miscanthus Phyllosphere | LAENAPELLPRRPVMEEHVEDLLGLARPPRMPLNLAEKLNEQQEGLRKEN |
Ga0182222_10976221 | 3300017413 | Miscanthus Phyllosphere | LFLARKAPEPLPRRPIREEHVEDLLGLARPPRMLLNLTGKLNEHQEGLKDGN |
Ga0182202_10192872 | 3300017415 | Miscanthus Phyllosphere | LFLAGKALELLPGRPIREEHVEDLLGLARPPRMPLNLAGKLNEQQEGLREGN |
Ga0182202_10586901 | 3300017415 | Miscanthus Phyllosphere | LFLAGKAPEPLPGRPVREEHVEDLLGLARPPRMPLNLAEKLNEQQERLRERN |
Ga0182202_10907482 | 3300017415 | Miscanthus Phyllosphere | LTENALELLLGRPVGEEHVEYLLGPARPPRMPLNLVGKLNEEQEGLREGN |
Ga0182202_11409631 | 3300017415 | Miscanthus Phyllosphere | LAEKTLELLPGRPIGEEHVEDALGPARPPRMPTNLAGRRAEQQERLKE |
Ga0182228_10208491 | 3300017420 | Miscanthus Phyllosphere | LAEKAPELLPERPVREEHVEGLLGPARPPRMPLNLAGKLNE |
Ga0182228_10739642 | 3300017420 | Miscanthus Phyllosphere | LTGKTPKLLPGRPVGEEHVEDLLGPARPPRISTNLAGRRDEQQEGLRERSKGAKGVDRLI |
Ga0182219_10301781 | 3300017424 | Miscanthus Phyllosphere | LAENAPELLPERPVWEEHVEDLLGPARPPRMLLNLTGKLNEHQEGLREGN |
Ga0182219_10744231 | 3300017424 | Miscanthus Phyllosphere | IRQILSSFLAEKAPELLPGRPIREEHVENLLGPARPLRMPLNLARKLNEQQEGLREGN |
Ga0182224_10570382 | 3300017425 | Miscanthus Phyllosphere | LDGKAPMLLPRKPVSKEHEEDLLGPARLPRMPLNLARKLNKQQEGLREE |
Ga0182190_11441041 | 3300017427 | Miscanthus Phyllosphere | ELLLGRPIKEEHIEDLLGPATLPRMPLNLATKLNEQQGWDERGVKG |
Ga0182192_10391902 | 3300017430 | Miscanthus Phyllosphere | LAENAPELLPERPVGEEHVEDLLGQARPPRMLLNLTEKLNEHQEELREGN |
Ga0182206_10204002 | 3300017433 | Miscanthus Phyllosphere | LAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN |
Ga0182209_10404362 | 3300017436 | Miscanthus Phyllosphere | MFSARKAPELLPGRLVGEEHMEDLVGSVRLPRMPLNLAGKLNEQQEEFREGN |
Ga0182209_10463661 | 3300017436 | Miscanthus Phyllosphere | LAENAPELLPERPVVEEYVEDLLGLARPPRMPLNLTGKLNEQQEGLRKEN |
Ga0182191_10201901 | 3300017438 | Miscanthus Phyllosphere | LAKNAPELLPGRPVREEHVEDLLGPARPPRMPTNFVARHAEQQEGLREEN |
Ga0182191_11187381 | 3300017438 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNIARKLNEQQEGLREGN |
Ga0182191_11275712 | 3300017438 | Miscanthus Phyllosphere | LVEKAPELLPGRPVSEEHVEDLLGPTRPPRMALNLVRKLNEQQKGLREGN |
Ga0182191_11667361 | 3300017438 | Miscanthus Phyllosphere | LAEKALELLPGRPVREEHVEDLLGPAMLPRMPLNLAGKLNEQQEGLKEGY |
Ga0182191_11717461 | 3300017438 | Miscanthus Phyllosphere | LAGKAPELLPRRPIGEEHVEDLLGPTRPPRMLLNLTGKLNEQQEGLREE |
Ga0182221_10645791 | 3300017442 | Miscanthus Phyllosphere | LAEKTLELLPGRPIGEEHVEDLLGLAKPPRMPTNLTGRRVEQQERLKKE |
Ga0182193_10226891 | 3300017443 | Miscanthus Phyllosphere | MFSVEKAHELIPGRPVREEHMEDLLGPARVPRMPLNLIGKLNERQEGLREGN |
Ga0182193_10630091 | 3300017443 | Miscanthus Phyllosphere | LAENAPELLPERPVGEEHVEDLLGPARPHMLPLNLTGKLNKNQKGLREEN |
Ga0182193_11772662 | 3300017443 | Miscanthus Phyllosphere | LAEKAPKLLPGRPVREEHVEDLLGPARPPRMPLNLVGKLNEQQKGLREGN |
Ga0182226_10479731 | 3300017681 | Miscanthus Phyllosphere | LFLAGKAPEPLPGRPVREEHVEDLLGPARPPRMPLNLAEKLNEQQEGLREMN |
Ga0182229_10545202 | 3300017682 | Miscanthus Phyllosphere | LAEKALELLPGRPVREEHVEDLLGPARPPKMPLNLAEKLNE |
Ga0182225_10112681 | 3300017684 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREKHVEDLLGPARPPRMPLNLAGKLNEQQEGLRERN |
Ga0182225_10412512 | 3300017684 | Miscanthus Phyllosphere | APELLPGRPVGKEHVDDLLGPARAPRMLLNLAGKLNEQQEGLREEN |
Ga0182227_10927842 | 3300017685 | Miscanthus Phyllosphere | LAENAPELLPGGPVGEEHMDDLLEPARPPRMPLNLVGKLNEQQGGVERGVKG |
Ga0182227_11193401 | 3300017685 | Miscanthus Phyllosphere | LAGKAPELLPGRPVREEHVEDLLGPVRPSRMPLNLVGKLNEQQKGLREGN |
Ga0182205_10872312 | 3300017686 | Miscanthus Phyllosphere | LAENAPELLPRRPVREEHVENLLGPVRPPRMPINLVGRRAEQQEGLTEGN |
Ga0182223_10233961 | 3300017690 | Miscanthus Phyllosphere | LAEKAPELLPGRPVGVEHVEGLLGPAKPPRMPLNLSGKLNEQQEGLREE |
Ga0182223_11061931 | 3300017690 | Miscanthus Phyllosphere | LAENAPELLPERPVVEEYVEDLLGLARPPRMPTNLAGRRAEQQERLKE |
Ga0207689_101681251 | 3300025942 | Miscanthus Rhizosphere | LAGKAPELLPGRPVREEHVEDLLGPARPPRMPLNLVGKLNEQQEGLKEGN |
⦗Top⦘ |