Basic Information | |
---|---|
Family ID | F047647 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 39 residues |
Representative Sequence | ANDTTALTLGITLATTDVVTVYASSANMSFAAFGSEIS |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.68 % |
% of genes near scaffold ends (potentially truncated) | 95.97 % |
% of genes from short scaffolds (< 2000 bps) | 89.26 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (53.020 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.134 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.060 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.732 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF00041 | fn3 | 4.03 |
PF13385 | Laminin_G_3 | 2.01 |
PF16778 | Phage_tail_APC | 1.34 |
PF01833 | TIG | 1.34 |
PF09636 | XkdW | 1.34 |
PF12810 | Gly_rich | 0.67 |
PF01551 | Peptidase_M23 | 0.67 |
PF13392 | HNH_3 | 0.67 |
PF03382 | DUF285 | 0.67 |
PF05065 | Phage_capsid | 0.67 |
PF01464 | SLT | 0.67 |
PF05345 | He_PIG | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 53.02 % |
All Organisms | root | All Organisms | 46.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10093430 | Not Available | 915 | Open in IMG/M |
3300001605|Draft_10641726 | Not Available | 539 | Open in IMG/M |
3300001847|RCM41_1018632 | Not Available | 1456 | Open in IMG/M |
3300001848|RCM47_1141782 | Not Available | 511 | Open in IMG/M |
3300002098|JGI24219J26650_1008768 | Not Available | 1788 | Open in IMG/M |
3300002349|B570J29580_109991 | Not Available | 526 | Open in IMG/M |
3300003499|JGI25930J51415_1046526 | Not Available | 753 | Open in IMG/M |
3300003806|Ga0007864_1013303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
3300003815|Ga0007856_1000367 | All Organisms → cellular organisms → Bacteria | 5368 | Open in IMG/M |
3300004448|Ga0065861_1107829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300005527|Ga0068876_10153039 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300005527|Ga0068876_10225304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300005528|Ga0068872_10213852 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300005581|Ga0049081_10058691 | Not Available | 1451 | Open in IMG/M |
3300005584|Ga0049082_10335158 | Not Available | 501 | Open in IMG/M |
3300006639|Ga0079301_1245263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300006802|Ga0070749_10079100 | Not Available | 1966 | Open in IMG/M |
3300006802|Ga0070749_10139809 | Not Available | 1413 | Open in IMG/M |
3300006805|Ga0075464_11074185 | Not Available | 507 | Open in IMG/M |
3300006875|Ga0075473_10050559 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
3300007276|Ga0070747_1062356 | Not Available | 1413 | Open in IMG/M |
3300007516|Ga0105050_10162115 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
3300007516|Ga0105050_10237555 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
3300007974|Ga0105747_1098163 | Not Available | 912 | Open in IMG/M |
3300008110|Ga0114343_1206985 | Not Available | 560 | Open in IMG/M |
3300008120|Ga0114355_1096530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
3300008258|Ga0114840_1007189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1937 | Open in IMG/M |
3300008259|Ga0114841_1218827 | Not Available | 664 | Open in IMG/M |
3300008266|Ga0114363_1081701 | Not Available | 1203 | Open in IMG/M |
3300008266|Ga0114363_1149120 | Not Available | 778 | Open in IMG/M |
3300008266|Ga0114363_1247562 | Not Available | 503 | Open in IMG/M |
3300008996|Ga0102831_1169219 | Not Available | 724 | Open in IMG/M |
3300009155|Ga0114968_10749932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300009159|Ga0114978_10070554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2353 | Open in IMG/M |
3300009170|Ga0105096_10371590 | Not Available | 735 | Open in IMG/M |
3300009180|Ga0114979_10869197 | Not Available | 503 | Open in IMG/M |
3300009182|Ga0114959_10337065 | Not Available | 746 | Open in IMG/M |
3300009183|Ga0114974_10469780 | Not Available | 710 | Open in IMG/M |
3300009474|Ga0127390_1052082 | Not Available | 1141 | Open in IMG/M |
3300010157|Ga0114964_10586339 | Not Available | 523 | Open in IMG/M |
3300010160|Ga0114967_10155293 | Not Available | 1267 | Open in IMG/M |
3300010334|Ga0136644_10800453 | Not Available | 507 | Open in IMG/M |
3300010389|Ga0136549_10048201 | All Organisms → Viruses → Predicted Viral | 2227 | Open in IMG/M |
3300010885|Ga0133913_10694732 | All Organisms → Viruses → Predicted Viral | 2662 | Open in IMG/M |
3300010885|Ga0133913_11429818 | Not Available | 1757 | Open in IMG/M |
3300010885|Ga0133913_12259255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
3300011010|Ga0139557_1038869 | Not Available | 826 | Open in IMG/M |
3300012750|Ga0157568_1012656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300013005|Ga0164292_10147653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10157516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10259886 | Not Available | 1264 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_11076071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300013372|Ga0177922_11290503 | Not Available | 802 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10205439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
3300014962|Ga0134315_1001249 | All Organisms → cellular organisms → Bacteria | 4874 | Open in IMG/M |
3300014962|Ga0134315_1004361 | Not Available | 2429 | Open in IMG/M |
3300017701|Ga0181364_1016968 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
3300017736|Ga0181365_1028067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300017778|Ga0181349_1172874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300017784|Ga0181348_1040715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1926 | Open in IMG/M |
3300017784|Ga0181348_1226141 | Not Available | 658 | Open in IMG/M |
3300017967|Ga0181590_10990908 | Not Available | 548 | Open in IMG/M |
3300019784|Ga0181359_1112179 | Not Available | 986 | Open in IMG/M |
3300019784|Ga0181359_1222615 | Not Available | 592 | Open in IMG/M |
3300020074|Ga0194113_10856060 | Not Available | 618 | Open in IMG/M |
3300020183|Ga0194115_10185173 | Not Available | 1044 | Open in IMG/M |
3300020198|Ga0194120_10521236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300020200|Ga0194121_10610859 | Not Available | 523 | Open in IMG/M |
3300021091|Ga0194133_10099771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2233 | Open in IMG/M |
3300021091|Ga0194133_10270041 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300021121|Ga0214173_129419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
3300021127|Ga0214193_1027515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300021364|Ga0213859_10137584 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
3300021961|Ga0222714_10130465 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300021963|Ga0222712_10420824 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300022068|Ga0212021_1003837 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2141 | Open in IMG/M |
3300022179|Ga0181353_1145287 | Not Available | 550 | Open in IMG/M |
3300022190|Ga0181354_1013955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2441 | Open in IMG/M |
3300022190|Ga0181354_1200157 | Not Available | 595 | Open in IMG/M |
3300022190|Ga0181354_1253470 | Not Available | 500 | Open in IMG/M |
3300022407|Ga0181351_1072510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1390 | Open in IMG/M |
3300022407|Ga0181351_1074671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
3300022752|Ga0214917_10085269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1909 | Open in IMG/M |
3300023174|Ga0214921_10231959 | Not Available | 1107 | Open in IMG/M |
3300023179|Ga0214923_10339614 | Not Available | 797 | Open in IMG/M |
3300023184|Ga0214919_10360509 | Not Available | 964 | Open in IMG/M |
3300023301|Ga0209414_1036509 | Not Available | 1462 | Open in IMG/M |
3300024356|Ga0255169_1023257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300024480|Ga0255223_1029020 | Not Available | 920 | Open in IMG/M |
3300024859|Ga0255278_1122134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300025357|Ga0208383_1034810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300025410|Ga0208875_1065737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300025502|Ga0208903_1031948 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
3300025595|Ga0208248_1090533 | Not Available | 683 | Open in IMG/M |
3300025818|Ga0208542_1150266 | Not Available | 634 | Open in IMG/M |
3300027492|Ga0255093_1058476 | Not Available | 739 | Open in IMG/M |
3300027499|Ga0208788_1153527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300027659|Ga0208975_1062493 | Not Available | 1124 | Open in IMG/M |
3300027693|Ga0209704_1160540 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 652 | Open in IMG/M |
3300027736|Ga0209190_1224512 | Not Available | 758 | Open in IMG/M |
3300027736|Ga0209190_1289703 | Not Available | 630 | Open in IMG/M |
3300027754|Ga0209596_1275562 | Not Available | 679 | Open in IMG/M |
3300027772|Ga0209768_10173545 | Not Available | 989 | Open in IMG/M |
3300027782|Ga0209500_10325768 | Not Available | 642 | Open in IMG/M |
3300027785|Ga0209246_10061062 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
3300027797|Ga0209107_10135925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
3300027808|Ga0209354_10160964 | Not Available | 915 | Open in IMG/M |
3300027983|Ga0209284_10163569 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300028025|Ga0247723_1071713 | Not Available | 931 | Open in IMG/M |
3300029933|Ga0119945_1019346 | Not Available | 821 | Open in IMG/M |
3300031733|Ga0316577_10220025 | Not Available | 1073 | Open in IMG/M |
3300031758|Ga0315907_10075433 | All Organisms → Viruses → Predicted Viral | 2915 | Open in IMG/M |
3300031758|Ga0315907_10262394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
3300031758|Ga0315907_10373010 | Not Available | 1156 | Open in IMG/M |
3300031758|Ga0315907_10608109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300031758|Ga0315907_10792014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300031787|Ga0315900_10227485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300031787|Ga0315900_10987329 | Not Available | 555 | Open in IMG/M |
3300031857|Ga0315909_10340672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300031857|Ga0315909_10504830 | Not Available | 834 | Open in IMG/M |
3300031951|Ga0315904_10204866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300032050|Ga0315906_10521876 | Not Available | 999 | Open in IMG/M |
3300032116|Ga0315903_10383760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300032143|Ga0315292_10648705 | Not Available | 889 | Open in IMG/M |
3300033233|Ga0334722_10620919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300033816|Ga0334980_0121004 | Not Available | 1082 | Open in IMG/M |
3300034012|Ga0334986_0330215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300034022|Ga0335005_0046686 | Not Available | 2932 | Open in IMG/M |
3300034061|Ga0334987_0093440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2335 | Open in IMG/M |
3300034061|Ga0334987_0319085 | Not Available | 1020 | Open in IMG/M |
3300034062|Ga0334995_0478574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300034064|Ga0335001_0619580 | Not Available | 568 | Open in IMG/M |
3300034066|Ga0335019_0633614 | Not Available | 622 | Open in IMG/M |
3300034068|Ga0334990_0176224 | Not Available | 1168 | Open in IMG/M |
3300034073|Ga0310130_0022706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1987 | Open in IMG/M |
3300034082|Ga0335020_0270027 | Not Available | 838 | Open in IMG/M |
3300034092|Ga0335010_0086204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2130 | Open in IMG/M |
3300034093|Ga0335012_0199877 | Not Available | 1060 | Open in IMG/M |
3300034102|Ga0335029_0280103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
3300034104|Ga0335031_0720605 | Not Available | 570 | Open in IMG/M |
3300034105|Ga0335035_0301414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300034112|Ga0335066_0186539 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
3300034118|Ga0335053_0209455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1275 | Open in IMG/M |
3300034118|Ga0335053_0688116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Aquisediminimonas → Aquisediminimonas sediminicola | 577 | Open in IMG/M |
3300034121|Ga0335058_0633228 | Not Available | 595 | Open in IMG/M |
3300034356|Ga0335048_0605111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Zoogloea → unclassified Zoogloea → Zoogloea sp. | 507 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.13% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.42% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.74% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.05% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.70% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.01% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.34% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.34% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.34% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.34% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.34% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.34% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.34% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.67% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.67% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.67% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.67% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.67% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.67% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.67% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.67% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.67% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.67% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.67% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.67% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002349 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012750 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES069 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_100934303 | 3300001282 | Freshwater | DTLTLGITLGAADVITIYASTTTMSFAAFGSELS* |
Draft_106417261 | 3300001605 | Hydrocarbon Resource Environments | ANATATFTLGVTLATTDVVTVRASTANFSFSAFGSEIS* |
RCM41_10186323 | 3300001847 | Marine Plankton | NDLLTLSIGMSLATTDVVTVYASTSTLSFTLFGSEIT* |
RCM47_11417821 | 3300001848 | Marine Plankton | AYDTAIGANDLLTLSIGMSLATTDVVTVYASTSTLSFTLFGSEIT* |
JGI24219J26650_10087684 | 3300002098 | Lentic | KQYIAYDVVLGSNATDTLTLGLTLATTDIISIAASSTSVSFNAYGSEIS* |
B570J29580_1099912 | 3300002349 | Freshwater | VGASDSIMLTLGLTLAAGDLIRVFASSADMSFSVFGSEIN* |
JGI25930J51415_10465262 | 3300003499 | Freshwater Lake | YITYDTTVPANDMVALTLGVTLATTDVVACYASTANVSFSIFGSEIS* |
Ga0007864_10133032 | 3300003806 | Freshwater | GSNSTDTLTLGLTLANSDIISIAASSTSVSFNAYGSEIS* |
Ga0007856_10003673 | 3300003815 | Freshwater | VVLGSNATDTLTLGLTLANTDVISIAASSTSVSFSAFGSELS* |
Ga0065861_11078291 | 3300004448 | Marine | GSNATDTLTLGLTLATTDIISIAASSASVSFNAYGSEIS* |
Ga0068876_101530391 | 3300005527 | Freshwater Lake | PASDATMLTLGITLATTDVVTVYASSANLSFNLFGSEIA* |
Ga0068876_102253043 | 3300005527 | Freshwater Lake | SDTLTLGITLGATDVITVYSSAATFSFNAFGSELS* |
Ga0068872_102138524 | 3300005528 | Freshwater Lake | NTSDTLTLGLTLGDTDVVTVYASSANFSFNAYGSELS* |
Ga0049081_100586913 | 3300005581 | Freshwater Lentic | ASDSIMLTLGVTLAAGDLIRVYSSSADMSFNAFGSELS* |
Ga0049082_103351582 | 3300005584 | Freshwater Lentic | ITLTIGITADAADVVTVYASSANLSFNLFGSEIA* |
Ga0079301_12452631 | 3300006639 | Deep Subsurface | ANDTTALTLGITLATTDVVTVYASSANMSFAAFGSEIS* |
Ga0070749_100791005 | 3300006802 | Aqueous | THTLSLGITLATTDVVTVYAGSADLTFIAYGSEIS* |
Ga0070749_101398094 | 3300006802 | Aqueous | ADTTVLTLGLTLGATDIITIYASTATLSFAAFGSEIA* |
Ga0075464_110741852 | 3300006805 | Aqueous | IAANDTTALTLGITLAATDIVTVYASAATMSFHVYGSEIA* |
Ga0075473_100505592 | 3300006875 | Aqueous | SLPANDSIALTLGITLATTDVVTVYAGNANVSFTLFGSEIT* |
Ga0070747_10623564 | 3300007276 | Aqueous | ANDSLFLTIGVTLAATDVVTVYASSADFTFSAFGSETA* |
Ga0105050_101621154 | 3300007516 | Freshwater | AYDIALAANDTTALTLGVSLATTDVVTVYASTDNLTFNIFGSEIV* |
Ga0105050_102375551 | 3300007516 | Freshwater | TALTLGVSLATTDVVTVYASSANLTFNIFGSEIV* |
Ga0105747_10981633 | 3300007974 | Estuary Water | VSLPANATDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS* |
Ga0114343_12069852 | 3300008110 | Freshwater, Plankton | IAANDTTALTLGITLATTDIITVYASAATMSFAAFGSEIS* |
Ga0114355_10965301 | 3300008120 | Freshwater, Plankton | DTLTLGLTLGAADVVTVYASSATFSFSAFGSELS* |
Ga0114840_10071891 | 3300008258 | Freshwater, Plankton | CPANDMIALTLGLTLAATDVVTVYASSADLSFGLFGSEVA* |
Ga0114841_12188271 | 3300008259 | Freshwater, Plankton | MLSLTLGLTLAATDVVTVNASSALISFHAYGSEIT* |
Ga0114363_10817014 | 3300008266 | Freshwater, Plankton | TDTLTLGITLGATDVVTVYASSANVSFAAFGSEIA* |
Ga0114363_11491201 | 3300008266 | Freshwater, Plankton | AFLTLGITLDTTDVVTVYASSASLSFALFGSELT* |
Ga0114363_12475622 | 3300008266 | Freshwater, Plankton | TTTLTLGLTLATTDVVTVYASSANLSFNAFGSEIA* |
Ga0102831_11692191 | 3300008996 | Estuarine | SITMTIGITLATTDVITVRANTTTVSFNLFGSELT* |
Ga0114968_107499321 | 3300009155 | Freshwater Lake | VGASDTTALTLGITLAAGDLIRVLASTTTCSFAAFGSEIA* |
Ga0114978_100705541 | 3300009159 | Freshwater Lake | DSIMLTLGITLATGDLIRVYASSADMSFNAFGSELS* |
Ga0105096_103715902 | 3300009170 | Freshwater Sediment | IYGASLPANSSDFLTVGVTLATTDVVSVYASDTNLAFSLFGDES* |
Ga0114979_108691972 | 3300009180 | Freshwater Lake | DTTVLTLGITLATTDVVTVYASTATISFNAYGDES* |
Ga0114959_103370651 | 3300009182 | Freshwater Lake | SDTTMLTVGLTLAATDVITIYASSATMSFNAYGSEA* |
Ga0114959_106239852 | 3300009182 | Freshwater Lake | SDTTFITIGATLATTDVVTVYASAQGLSFNLFGTELS* |
Ga0114974_104697802 | 3300009183 | Freshwater Lake | DAGSSVYLTLGLSLATTDVVTVLAGTATVSFGLFGSEVT* |
Ga0127390_10520822 | 3300009474 | Meromictic Pond | NDSLFLTIGVTLAATDVVTVYASSADFTFSAFGSETA* |
Ga0114964_105863392 | 3300010157 | Freshwater Lake | AASDTTALTLGVTLATTDVVRVYASSATLSFSLFGSEIS* |
Ga0114967_101552932 | 3300010160 | Freshwater Lake | DTITLTIGMTLATTDVVTVTSSSGNVSFSLFGSEIT* |
Ga0136644_108004532 | 3300010334 | Freshwater Lake | STWLTGGITLAATDVVTIYASSATLSFNIYGSEN* |
Ga0136549_100482011 | 3300010389 | Marine Methane Seep Sediment | QNDSVFLTLGITLATTDVVTVYTNSANVSFSLFGSEVSA* |
Ga0133913_106947325 | 3300010885 | Freshwater Lake | VGASDSIMLTLGLTLATGDVVRVYASSANMSFSAFGSELS* |
Ga0133913_114298181 | 3300010885 | Freshwater Lake | ASDSTVLTIGLTLATTDIVTVYASASTLSFSLFGSEIDV* |
Ga0133913_122592551 | 3300010885 | Freshwater Lake | TVLTMGLTLGAADLLTCYSSTATTSFQAYGSEIA* |
Ga0139557_10388691 | 3300011010 | Freshwater | IALTIGITLATTDVITVYSSNGYMSFAAFGSEIT* |
Ga0157568_10126561 | 3300012750 | Freshwater | LLGSNATDTLTLGVTLANTDIISIAASSTSVSFSAFGSEIS* |
Ga0164292_101476534 | 3300013005 | Freshwater | ATDTLTLGVTLGAADVITVYASAATFSFNAFGSELS* |
(restricted) Ga0172372_101575164 | 3300013132 | Freshwater | LVYDASLPANATDTLTLGVTLGATDVVSVYASTANFSFNAFGSEIS* |
(restricted) Ga0172372_102598861 | 3300013132 | Freshwater | ATNLVALTLGLTCNAADVVTVYASNANLSFGIFGSEIA* |
(restricted) Ga0172371_110760711 | 3300013138 | Freshwater | SLPANTTDTLTLGITINATDVISVYSSSANMSFHAYGSEIA* |
Ga0177922_112905032 | 3300013372 | Freshwater | QHYVAYDISLPANTSDTLTLGLTLGDTDVVTVYASSANFSFNAYGSELS* |
(restricted) Ga0172376_102054391 | 3300014720 | Freshwater | PANTTDTLTLGLTLDATDVVTVYASTANFSFNAYGSEIS* |
Ga0134315_10012499 | 3300014962 | Surface Water | LPAASSDMITVGLTLAATDVVTVYASNANFSFALYGSEVS* |
Ga0134315_10043616 | 3300014962 | Surface Water | VYDAALPATSTDAITIGLTLATTDVVTVYASSANFSFSLYGSEVS* |
Ga0181364_10169683 | 3300017701 | Freshwater Lake | VYGATVPASDTTMLTVGLTLATTDVVTVYASSATVSFNAYGSEIS |
Ga0181365_10280671 | 3300017736 | Freshwater Lake | NATDTLTLGVTVAATDVISVYASTATMSFNAFGSEIV |
Ga0181349_11728741 | 3300017778 | Freshwater Lake | ATDTLTLGVTVGATDVISVFASTATMSFNAFGSEIV |
Ga0181348_10407154 | 3300017784 | Freshwater Lake | AYDVSLPANATDTLTLGLTLATTDVITVYASSTAVGFNAYGSEIY |
Ga0181348_12261411 | 3300017784 | Freshwater Lake | IAANDTVTFTLGITLATTDIITIYASSANMSFNAFGSELT |
Ga0181590_109909082 | 3300017967 | Salt Marsh | QTDSLHLTLGITLATTDVVTVYASSVNLSFSLFGSEIT |
Ga0181359_11121791 | 3300019784 | Freshwater Lake | PANATDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS |
Ga0181359_12226152 | 3300019784 | Freshwater Lake | ANDSITLTLGITLATTDVITVRASNTSFAFQAFGSEIA |
Ga0194113_108560601 | 3300020074 | Freshwater Lake | LPANTTDTLTLGLTLDATDVVTVYASTATMSFNAFGSEIS |
Ga0194115_101851731 | 3300020183 | Freshwater Lake | ANTTDTLTLGLTLDATDVVTVYASTATMSFNAFGSEIS |
Ga0194120_105212361 | 3300020198 | Freshwater Lake | SLPANTTDTLTLGLTLDATDVVTVYASTATMSFNAFGSEIS |
Ga0194121_106108591 | 3300020200 | Freshwater Lake | PANTTDTLTLGITINATDVISVYSSSANMSFNAFGSEIA |
Ga0194133_100997716 | 3300021091 | Freshwater Lake | SDTLTLGLTLGAADIITVQASTADFSFSAFGSEIA |
Ga0194133_102700413 | 3300021091 | Freshwater Lake | TTDTLTLGLTLDATDVVTVYASTATMSFNAFGSEIS |
Ga0214173_1294191 | 3300021121 | Freshwater | AYDVTLGSNSTDTLTLGLTLANTDIISIAASSTSVSFNAYGSEIS |
Ga0214193_10275152 | 3300021127 | Freshwater | SNATDTLTLGVTLATTDIISIAASSTSVSFNAFGSEIA |
Ga0213859_101375841 | 3300021364 | Seawater | DLLSQNDTIFLTLGITLATTDVVTVYTPSSNVSFSLFGSEVS |
Ga0222714_101304655 | 3300021961 | Estuarine Water | DVSLPGNASDTLTLGITLGAADVITIYASTTTMSFSAFGSELS |
Ga0222712_104208242 | 3300021963 | Estuarine Water | NATDTLTLGVTLGATDVITVYASTATMSFNAYGSEIS |
Ga0212021_10038371 | 3300022068 | Aqueous | SITLTLGITLADTDVITVTASTADVSFSVFGTEIS |
Ga0181353_11452872 | 3300022179 | Freshwater Lake | RDTTVPANDMVALTLGVTLATTDVVACYASTANVSFSIFGSEIS |
Ga0181354_10139551 | 3300022190 | Freshwater Lake | ATDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS |
Ga0181354_12001572 | 3300022190 | Freshwater Lake | NVSLPANATDTLTLGVTVGATDVISVYSSSATMSFSAFGSEIA |
Ga0181354_12534702 | 3300022190 | Freshwater Lake | VAASDTTTLTLGLTLATTDVVTVYASSANLSFNAFGSEIA |
Ga0181351_10725104 | 3300022407 | Freshwater Lake | TDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS |
Ga0181351_10746714 | 3300022407 | Freshwater Lake | GSLPANATDTLTLGVTVAATDVISVYASTATMSFNAFGSEIV |
Ga0214917_100852691 | 3300022752 | Freshwater | DVSLPGNATDTLTLGVTLGAADVITVYASAATFSFNAFGSELS |
Ga0214921_102319594 | 3300023174 | Freshwater | SLPGNATDTLTLGVTLGAADVITVYASAATFSFNAFGSELS |
Ga0214923_103396141 | 3300023179 | Freshwater | VSLPGNASDTLTLGVTLGATDVITVYASAATFSFNAFGSEIA |
Ga0214919_103605093 | 3300023184 | Freshwater | TTTLTLGLTLATTDVVTVYASSANLSFNAFGSEIA |
Ga0209414_10365091 | 3300023301 | Hypersaline | GILLTIGLTLAATDVVTVRASTADLTFNLFGSEIS |
Ga0255169_10232573 | 3300024356 | Freshwater | ANDTVALTLGITLATTDVVTVYASSANMSFAAFGSEIS |
Ga0255223_10290204 | 3300024480 | Freshwater | GTSTDTITIGLTLAATDVVTVYASLANFSFNAYGSEIA |
Ga0255278_11221341 | 3300024859 | Freshwater | SDTTALTLGITLATTDVITVYASTANLSFHAYGDES |
Ga0208383_10348102 | 3300025357 | Freshwater | LAYDVVLGSNATDTLTLGLTLANTDVISIAASSTSVSFNAYGSELS |
Ga0208875_10657371 | 3300025410 | Freshwater | NDTIALTLGITLATTDVITINSSTTTLSFAAFGSELS |
Ga0208903_10319483 | 3300025502 | Saline Lake | STTLTLGLTLDATDVITFYASSANMSINVSGSEIS |
Ga0208248_10905332 | 3300025595 | Freshwater | LPANATDTLTLGLTLATTDVITVYSSATAVAFNAYGSEIS |
Ga0208542_11502662 | 3300025818 | Aqueous | QNDTIFLTLGITLATTDVVTVYTPSSNVSFSLFGSEVS |
Ga0255093_10584763 | 3300027492 | Freshwater | LPGDSTDAITIGLTLAATDVVTAYATSANFSFNAYGSEIA |
Ga0208788_11535271 | 3300027499 | Deep Subsurface | NDTTALTLGITLATTDVVTVYASSANMSFAAFGSEIS |
Ga0208975_10624931 | 3300027659 | Freshwater Lentic | ASDSIMLTLGVTLAAGDLIRVYSSSADMSFNAFGSELS |
Ga0209704_11605401 | 3300027693 | Freshwater Sediment | EQYNTTLLTLGITLATTDVVTVYAGTANVVFNLFGSEIT |
Ga0209190_12245122 | 3300027736 | Freshwater Lake | VAANDTIVLTLGVSLGAADVVTVYASTANVAFSLFGTEIT |
Ga0209190_12897031 | 3300027736 | Freshwater Lake | IPATDTITLTIGMTLATTDVVTVTSSSGNVSFSLFGSEIT |
Ga0209596_12755621 | 3300027754 | Freshwater Lake | YDVSLPANATDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS |
Ga0209768_101735452 | 3300027772 | Freshwater Lake | SIALTLGLTLANTDVVTVYAGSANLTFSLFGTEVS |
Ga0209500_103257682 | 3300027782 | Freshwater Lake | IAANDTTAITLGLTLATTDVVTVYASAATMSFNAYGSEIS |
Ga0209246_100610623 | 3300027785 | Freshwater Lake | ALDTTTLTLGLTLGTTDVITVYGSTATLSFNAYGSEIA |
Ga0209107_101359251 | 3300027797 | Freshwater And Sediment | STIITLGMTLATTDVVSVYSSSATTSFVLFGSEIS |
Ga0209354_101609642 | 3300027808 | Freshwater Lake | QYNTTLLTLGITLAATDVVTVYAGTANVVFNLFGSEIT |
Ga0209702_103377172 | 3300027976 | Freshwater | IAYDIALAANDTTALTLGVSLATTDVVTVYASTDNLTFNIFGSEIV |
Ga0209284_101635693 | 3300027983 | Freshwater | IAYDIALAANDTTALTLGVSLATTDVVTVYASTANLTFNIFGSEIV |
Ga0247723_10717133 | 3300028025 | Deep Subsurface Sediment | PGNATDTLTLGVTLGATDVITVYASAATFSFNAFGSELS |
Ga0247723_11145691 | 3300028025 | Deep Subsurface Sediment | SVVALTLGITLDATDKIRVYGSTADLSVNAFGSELA |
Ga0119945_10193461 | 3300029933 | Aquatic | HYVAYDISLPANTSDTLTLGLTLGDTDVVTVYASSANFSFNAYGSELS |
Ga0316577_102200253 | 3300031733 | Rhizosphere | LYDNLVLKRDSNFYTLGLTLATTDVVRVETDSAGVSFSLYGTEVS |
Ga0315907_100754331 | 3300031758 | Freshwater | AYDISLPANTSDTLTLGLTLGDTDVVTVYASSANFSFNAYGSELS |
Ga0315907_102623941 | 3300031758 | Freshwater | LPANTSDTLTLGLTLGDTDVVTVYASSANFSFNAYGSELS |
Ga0315907_103730101 | 3300031758 | Freshwater | PANDTTILTFGATLGQTDVVTVYAGSANVTFSAFGVEIT |
Ga0315907_106081091 | 3300031758 | Freshwater | ANATDTLTLGVTLGATDVITVYASSATMSFNAYGSELS |
Ga0315907_107920142 | 3300031758 | Freshwater | ANASDTLTLGLTLGAADVVTVYASSATFSFSAFGSELS |
Ga0315900_102274854 | 3300031787 | Freshwater | SLPANATDTLTLGVTLGATDVITVYASSATMSFNAYGSELS |
Ga0315900_109873291 | 3300031787 | Freshwater | DMIALTLGLTLAATDVVTVYASSADLSFGLFGSEVA |
Ga0315909_103406724 | 3300031857 | Freshwater | DTLTLGITLDYSTAGDIITVYSSSATMSFAAFGSEIS |
Ga0315909_105048301 | 3300031857 | Freshwater | ANDMIALTLGLTLAATDVVTVYASSADLSFGLFGSEVA |
Ga0315904_102048664 | 3300031951 | Freshwater | DVSLPANTTDTLTLGLTLGDTDVVTVYASSANMSFNAYGSEIS |
Ga0315906_105218761 | 3300032050 | Freshwater | VPLAGADSITLTLGLALSASDVVTVYAGSANVAFGLFGVEVT |
Ga0315903_103837604 | 3300032116 | Freshwater | TSDTLTLGITLDYSTAGDIITVYSSSATMSFAAFGSEIS |
Ga0315292_106487051 | 3300032143 | Sediment | SVLLTLGISLATTDVVTVYAGHANVAFSLFGAELT |
Ga0334722_106209192 | 3300033233 | Sediment | ANATDTLTLGLTLATTDVITVYASTTAVGFNAYGSEIS |
Ga0334980_0121004_2_112 | 3300033816 | Freshwater | DQIALTMGITLAATDVVTVYANTANVSFSMFGTELF |
Ga0334986_0330215_3_125 | 3300034012 | Freshwater | LPGNATDTLTLGVTLGAADVITVYASAATFSFNAFGSELS |
Ga0335005_0046686_3_128 | 3300034022 | Freshwater | SIPATDTITLTIGMTLATTDVVTVTSSSGNVSFSLFGSEIT |
Ga0334987_0093440_2202_2333 | 3300034061 | Freshwater | DVSLPANATDTLTLGVTVGATDVISVYASSATMSFNAFGSEIV |
Ga0334987_0319085_903_1019 | 3300034061 | Freshwater | ANATDTLTLGVTVGATDVISVYASSATMSFNAFGSEIV |
Ga0334995_0478574_2_115 | 3300034062 | Freshwater | ADSTALTLGITLAATDIVTVYASSATLSFTAFGSEIA |
Ga0335001_0619580_441_566 | 3300034064 | Freshwater | SLPANDTTILTLGLSLATTDVVTVYAGSANVAFNLYGSEIT |
Ga0335019_0633614_515_622 | 3300034066 | Freshwater | SITMTIGITLATTDVVTVRANTTTVSFSLFGSELT |
Ga0334990_0176224_1049_1168 | 3300034068 | Freshwater | PSNDSIALTLGLTLANTDVVTVYAGSANLTFSLFGTEVS |
Ga0310130_0022706_1_114 | 3300034073 | Fracking Water | ADTTVLTVGLTLDATDVITVYGSTANLVFHAYGSEIS |
Ga0335020_0270027_2_109 | 3300034082 | Freshwater | ATALTLGVTLATTDVIRVFSTTGAVNFTLFGSEIS |
Ga0335010_0086204_2017_2130 | 3300034092 | Freshwater | NATDTLTLGVTLGATDVITVYASAATFSFNAFGSELS |
Ga0335012_0199877_15_122 | 3300034093 | Freshwater | MLSLTLGLTLAATDVVTVNASSALISFHAYGSEIT |
Ga0335029_0280103_3_110 | 3300034102 | Freshwater | TDTLTLGVTVGATDVISVYASSATMSFNAFGSEIV |
Ga0335031_0720605_3_116 | 3300034104 | Freshwater | NNTTFITVGITLNATDVITVYASSATMSFNAFGSELS |
Ga0335035_0301414_1_114 | 3300034105 | Freshwater | SDTTIFTVGLTLATTDVITVYASSATVSFNAYGSEIS |
Ga0335066_0186539_1123_1239 | 3300034112 | Freshwater | ANASDTLTLGITLNATDVITVYSSTATMSFGAFGSEIS |
Ga0335053_0209455_1161_1274 | 3300034118 | Freshwater | NATDTLTLGVTLGAADVITVYASAATFSFNAFGSELS |
Ga0335053_0688116_311_451 | 3300034118 | Freshwater | VVYDTAVNANDTLFFTLGLSLAAGDVVTVQAGTATVAFNLYGTEIT |
Ga0335058_0633228_2_127 | 3300034121 | Freshwater | SLTANDSAFLTLGITLATTDVVTVYASSASLSFSLFGSEMT |
Ga0335048_0605111_393_506 | 3300034356 | Freshwater | YDTVFLTLGITLATTDVISVYAGSDLVSFSLFGSEIS |
⦗Top⦘ |