Basic Information | |
---|---|
Family ID | F047808 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 39 residues |
Representative Sequence | VFRFAVFVACAFDRAAMTAASALLSSAGLLALDGARR |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.94 % |
% of genes near scaffold ends (potentially truncated) | 16.11 % |
% of genes from short scaffolds (< 2000 bps) | 73.15 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.785 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.503 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.530 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.362 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF00009 | GTP_EFTU | 39.60 |
PF03144 | GTP_EFTU_D2 | 10.07 |
PF07221 | GlcNAc_2-epim | 2.68 |
PF13472 | Lipase_GDSL_2 | 2.68 |
PF01791 | DeoC | 2.68 |
PF01502 | PRA-CH | 2.01 |
PF00370 | FGGY_N | 2.01 |
PF01850 | PIN | 1.34 |
PF13191 | AAA_16 | 0.67 |
PF02627 | CMD | 0.67 |
PF00196 | GerE | 0.67 |
PF01037 | AsnC_trans_reg | 0.67 |
PF13847 | Methyltransf_31 | 0.67 |
PF13635 | DUF4143 | 0.67 |
PF12802 | MarR_2 | 0.67 |
PF08494 | DEAD_assoc | 0.67 |
PF04542 | Sigma70_r2 | 0.67 |
PF13476 | AAA_23 | 0.67 |
PF08837 | DUF1810 | 0.67 |
PF00561 | Abhydrolase_1 | 0.67 |
PF04191 | PEMT | 0.67 |
PF01909 | NTP_transf_2 | 0.67 |
PF13377 | Peripla_BP_3 | 0.67 |
PF03235 | DUF262 | 0.67 |
PF13419 | HAD_2 | 0.67 |
PF00877 | NLPC_P60 | 0.67 |
PF06029 | AlkA_N | 0.67 |
PF04266 | ASCH | 0.67 |
PF00313 | CSD | 0.67 |
PF00498 | FHA | 0.67 |
PF01799 | Fer2_2 | 0.67 |
PF13424 | TPR_12 | 0.67 |
PF04239 | DUF421 | 0.67 |
PF12585 | DUF3759 | 0.67 |
PF08241 | Methyltransf_11 | 0.67 |
PF00202 | Aminotran_3 | 0.67 |
PF01411 | tRNA-synt_2c | 0.67 |
PF13977 | TetR_C_6 | 0.67 |
PF04014 | MazE_antitoxin | 0.67 |
PF03466 | LysR_substrate | 0.67 |
PF10979 | DUF2786 | 0.67 |
PF03358 | FMN_red | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 2.68 |
COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 2.01 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.67 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.67 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.67 |
COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 0.67 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.67 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.67 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.67 |
COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.67 |
COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.67 |
COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.67 |
COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.67 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.67 |
COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.46 % |
Unclassified | root | N/A | 31.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10004937 | All Organisms → cellular organisms → Bacteria | 11996 | Open in IMG/M |
3300005537|Ga0070730_10085352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2205 | Open in IMG/M |
3300005537|Ga0070730_10111916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1880 | Open in IMG/M |
3300005538|Ga0070731_10020064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4642 | Open in IMG/M |
3300005538|Ga0070731_10677127 | Not Available | 686 | Open in IMG/M |
3300005542|Ga0070732_10610490 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005591|Ga0070761_10132643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1452 | Open in IMG/M |
3300005602|Ga0070762_10123322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1525 | Open in IMG/M |
3300005764|Ga0066903_103684786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
3300005921|Ga0070766_10849416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 624 | Open in IMG/M |
3300005921|Ga0070766_10935081 | Not Available | 594 | Open in IMG/M |
3300006028|Ga0070717_10039506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3840 | Open in IMG/M |
3300006175|Ga0070712_101311765 | Not Available | 631 | Open in IMG/M |
3300006176|Ga0070765_100044791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3568 | Open in IMG/M |
3300006176|Ga0070765_100218793 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300006176|Ga0070765_100331245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1412 | Open in IMG/M |
3300006176|Ga0070765_100727280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 938 | Open in IMG/M |
3300006176|Ga0070765_102072913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 531 | Open in IMG/M |
3300006755|Ga0079222_12426201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 526 | Open in IMG/M |
3300006893|Ga0073928_10085375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2691 | Open in IMG/M |
3300009522|Ga0116218_1294517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 727 | Open in IMG/M |
3300009523|Ga0116221_1305418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
3300010048|Ga0126373_11957111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300010343|Ga0074044_10637530 | Not Available | 695 | Open in IMG/M |
3300010360|Ga0126372_10435613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1209 | Open in IMG/M |
3300010366|Ga0126379_10432474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1373 | Open in IMG/M |
3300010379|Ga0136449_100363942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2589 | Open in IMG/M |
3300010386|Ga0136806_1413016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2584 | Open in IMG/M |
3300010866|Ga0126344_1012817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1863 | Open in IMG/M |
3300010876|Ga0126361_10103253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1822 | Open in IMG/M |
3300012181|Ga0153922_1013514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1911 | Open in IMG/M |
3300012189|Ga0137388_12018322 | Not Available | 505 | Open in IMG/M |
3300012359|Ga0137385_11454117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300014169|Ga0181531_10964510 | Not Available | 535 | Open in IMG/M |
3300016319|Ga0182033_10855255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
3300016319|Ga0182033_11823100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 552 | Open in IMG/M |
3300017821|Ga0187812_1109865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
3300017822|Ga0187802_10375590 | Not Available | 560 | Open in IMG/M |
3300017924|Ga0187820_1091013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300017926|Ga0187807_1055172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1233 | Open in IMG/M |
3300017926|Ga0187807_1105572 | Not Available | 887 | Open in IMG/M |
3300017926|Ga0187807_1228196 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300017942|Ga0187808_10436964 | Not Available | 601 | Open in IMG/M |
3300017943|Ga0187819_10632157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300017961|Ga0187778_10393455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 908 | Open in IMG/M |
3300017970|Ga0187783_10004072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10821 | Open in IMG/M |
3300017970|Ga0187783_10644477 | Not Available | 766 | Open in IMG/M |
3300017995|Ga0187816_10373140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 632 | Open in IMG/M |
3300018062|Ga0187784_10492970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 988 | Open in IMG/M |
3300019887|Ga0193729_1136198 | Not Available | 900 | Open in IMG/M |
3300020140|Ga0179590_1135144 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 672 | Open in IMG/M |
3300020579|Ga0210407_10242486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
3300020582|Ga0210395_10005632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9586 | Open in IMG/M |
3300020582|Ga0210395_10006174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9096 | Open in IMG/M |
3300020582|Ga0210395_10011548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. URHB0044 | 6561 | Open in IMG/M |
3300020582|Ga0210395_10053673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2953 | Open in IMG/M |
3300020583|Ga0210401_10019723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6483 | Open in IMG/M |
3300020610|Ga0154015_1072921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus | 1077 | Open in IMG/M |
3300021171|Ga0210405_11108416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 591 | Open in IMG/M |
3300021181|Ga0210388_11239296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300021181|Ga0210388_11718381 | Not Available | 519 | Open in IMG/M |
3300021401|Ga0210393_10649649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300021402|Ga0210385_10095343 | Not Available | 2067 | Open in IMG/M |
3300021407|Ga0210383_10385563 | Not Available | 1208 | Open in IMG/M |
3300021407|Ga0210383_10439968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
3300021407|Ga0210383_10674189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
3300021407|Ga0210383_11449635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 569 | Open in IMG/M |
3300021474|Ga0210390_10096921 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
3300021474|Ga0210390_10385828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
3300021475|Ga0210392_10176491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1478 | Open in IMG/M |
3300021476|Ga0187846_10070738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1522 | Open in IMG/M |
3300021477|Ga0210398_10168210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1785 | Open in IMG/M |
3300021479|Ga0210410_11148599 | Not Available | 667 | Open in IMG/M |
3300021560|Ga0126371_10127659 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300021560|Ga0126371_10458879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1421 | Open in IMG/M |
3300025634|Ga0208589_1115653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 625 | Open in IMG/M |
3300025939|Ga0207665_11126809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 626 | Open in IMG/M |
3300026356|Ga0257150_1046648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 638 | Open in IMG/M |
3300027171|Ga0207947_1004640 | Not Available | 877 | Open in IMG/M |
3300027297|Ga0208241_1039243 | Not Available | 740 | Open in IMG/M |
3300027619|Ga0209330_1007667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2413 | Open in IMG/M |
3300027729|Ga0209248_10029992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1695 | Open in IMG/M |
3300027812|Ga0209656_10032228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3096 | Open in IMG/M |
3300027853|Ga0209274_10026167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2681 | Open in IMG/M |
3300027855|Ga0209693_10326245 | Not Available | 746 | Open in IMG/M |
3300027857|Ga0209166_10091038 | Not Available | 1712 | Open in IMG/M |
3300027867|Ga0209167_10063508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1834 | Open in IMG/M |
3300027869|Ga0209579_10078271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
3300027889|Ga0209380_10037969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2726 | Open in IMG/M |
3300027895|Ga0209624_10241053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
3300027905|Ga0209415_10402767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300027908|Ga0209006_10014068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7248 | Open in IMG/M |
3300029951|Ga0311371_10607273 | Not Available | 1404 | Open in IMG/M |
3300029951|Ga0311371_11871973 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 644 | Open in IMG/M |
3300030520|Ga0311372_12739493 | Not Available | 544 | Open in IMG/M |
3300031057|Ga0170834_107889006 | Not Available | 553 | Open in IMG/M |
3300031236|Ga0302324_100508698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1756 | Open in IMG/M |
3300031544|Ga0318534_10122010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
3300031545|Ga0318541_10688461 | Not Available | 571 | Open in IMG/M |
3300031545|Ga0318541_10800622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 526 | Open in IMG/M |
3300031680|Ga0318574_10235689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1057 | Open in IMG/M |
3300031708|Ga0310686_101579732 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
3300031708|Ga0310686_102127406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1277 | Open in IMG/M |
3300031708|Ga0310686_105042689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
3300031708|Ga0310686_112109847 | Not Available | 551 | Open in IMG/M |
3300031708|Ga0310686_113197009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 824 | Open in IMG/M |
3300031713|Ga0318496_10041084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2372 | Open in IMG/M |
3300031719|Ga0306917_11237938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 579 | Open in IMG/M |
3300031744|Ga0306918_10532738 | Not Available | 920 | Open in IMG/M |
3300031754|Ga0307475_10958949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 674 | Open in IMG/M |
3300031764|Ga0318535_10068044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1519 | Open in IMG/M |
3300031765|Ga0318554_10212828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1100 | Open in IMG/M |
3300031768|Ga0318509_10223112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1050 | Open in IMG/M |
3300031792|Ga0318529_10488439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 573 | Open in IMG/M |
3300031823|Ga0307478_10293279 | Not Available | 1330 | Open in IMG/M |
3300031823|Ga0307478_10359818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
3300031823|Ga0307478_10805509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
3300031831|Ga0318564_10442549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 567 | Open in IMG/M |
3300031846|Ga0318512_10328332 | Not Available | 763 | Open in IMG/M |
3300031859|Ga0318527_10165936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
3300031910|Ga0306923_11598627 | Not Available | 678 | Open in IMG/M |
3300031945|Ga0310913_10529995 | Not Available | 836 | Open in IMG/M |
3300032009|Ga0318563_10271677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300032052|Ga0318506_10140871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
3300032052|Ga0318506_10568776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 502 | Open in IMG/M |
3300032065|Ga0318513_10418774 | Not Available | 654 | Open in IMG/M |
3300032515|Ga0348332_11132803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 605 | Open in IMG/M |
3300032770|Ga0335085_10643309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1187 | Open in IMG/M |
3300032895|Ga0335074_10876546 | Not Available | 819 | Open in IMG/M |
3300032896|Ga0335075_10017369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10698 | Open in IMG/M |
3300032896|Ga0335075_10073447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4619 | Open in IMG/M |
3300032896|Ga0335075_10587663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1106 | Open in IMG/M |
3300033545|Ga0316214_1021804 | Not Available | 898 | Open in IMG/M |
3300033547|Ga0316212_1004933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1938 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.05% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.04% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 4.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.36% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.36% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.68% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.01% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.01% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.01% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.34% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.34% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 1.34% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.34% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.67% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010386 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_1000493712 | 3300001356 | Peatlands Soil | VFRFAVFVTCALDRAGMTAASALLSPAALLALGGARR* |
Ga0070682_1008725022 | 3300005337 | Corn Rhizosphere | VFRFSVFADRVLDRAAMTAASALPSAGLSSALLSSAGLSAPDGARR* |
Ga0070714_1000949241 | 3300005435 | Agricultural Soil | RFSVFADRVLDRAAMTAASALLSSALLSSAGLSAPDGARR* |
Ga0070714_1001244655 | 3300005435 | Agricultural Soil | VFRFSVFADRVLDRAAMTAASALLSSALLSSALLSSAGLSAPDGARR* |
Ga0070681_117642431 | 3300005458 | Corn Rhizosphere | FSVFADRVLDRAAMTAASALPSAGLSSALLSSAGLSAPDGARR* |
Ga0070679_1003177552 | 3300005530 | Corn Rhizosphere | VFRFSVFADRVCDRAAMTAASALLSSALLSSAGLSARDGARR* |
Ga0070730_100853521 | 3300005537 | Surface Soil | VFRFAVLAACALDRAAMTAACAPLSSAGLLALRDARR* |
Ga0070730_101119162 | 3300005537 | Surface Soil | VFRFAVITARALDRAAMTAAPAPLSPAGLPASRGARR* |
Ga0070731_100200647 | 3300005538 | Surface Soil | VFRFAVFVARALDRAAMTAASVLLSSAGLLAVGGARG* |
Ga0070731_106771272 | 3300005538 | Surface Soil | VFRFAVFVAYACDRAAMTAASAPLSSAGPLALDGARR |
Ga0070732_106104902 | 3300005542 | Surface Soil | VFRFAVFVACARGRAAMTAALALLSPAGLLALGGARR* |
Ga0068857_1019430012 | 3300005577 | Corn Rhizosphere | CRTLTGVFRFSVFADRVCDRAAMTAASALLSSALLSSVGLSARDGARR* |
Ga0070761_101326432 | 3300005591 | Soil | VFRFAVFVACAFDRAAMTAASALLSSAGLLALDGARR* |
Ga0070762_101233222 | 3300005602 | Soil | MPHACCVFRLAVFVARACDRAAMTAASPLLSSAGPLALGGARR* |
Ga0066903_1036847862 | 3300005764 | Tropical Forest Soil | VFRFAVFVGCALDRAAVTAASALLSPAGLLALGGARR* |
Ga0070766_108494162 | 3300005921 | Soil | VFRFAVFVACARGRAAMTAALALLSPAGLLAFGGARR* |
Ga0070766_109350811 | 3300005921 | Soil | VFRFAVFVACAFDHAAMTAASALLSSAGLVALDGARR* |
Ga0070717_100395062 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRFVVLVARALGRAAMTAASALLSSAGLLALGGARR* |
Ga0070712_1013117651 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRFAVLVAYAFDRAAMTAASALASSAGLLALVGARR* |
Ga0070765_1000447911 | 3300006176 | Soil | FAVFVACARGRAAMTAALALLSPAGLLAFGGARR* |
Ga0070765_1002187931 | 3300006176 | Soil | VFRFAVFVAYACDRAAMTAASALLSSAGPLALDGTRR* |
Ga0070765_1003312451 | 3300006176 | Soil | VFRFAVFVACAFDRAAMTAASALLPSTLLALDGARR* |
Ga0070765_1007272802 | 3300006176 | Soil | VFRFAVITARALDRAAMTAAPAPLSPAARPARGARR* |
Ga0070765_1020729132 | 3300006176 | Soil | VIRFAVFVVHASDRAAMTAACALLSSAGLLALDGARR* |
Ga0079222_124262012 | 3300006755 | Agricultural Soil | VFRFAVFVASALGRAALTAASALLSPAGLLALDGVRR* |
Ga0073928_100853751 | 3300006893 | Iron-Sulfur Acid Spring | VFRFAVFVACARDRAAMTAASALLSPAGLLARDGARG* |
Ga0116218_12945172 | 3300009522 | Peatlands Soil | VFRFVVFVTCALDRAGMTAASALLSPAALLALGGARR* |
Ga0116221_13054182 | 3300009523 | Peatlands Soil | VFRFAVFVTCALDRAGMTAASALLSPAALLALGGAR |
Ga0123355_101632632 | 3300009826 | Termite Gut | VFRFSVFADRVLDRAAMTAASALLSSALLSSALLSARDGARR* |
Ga0123355_112315832 | 3300009826 | Termite Gut | FADRVVVRAAMTAASALLNSASLSSASLSAADGARR* |
Ga0123355_119121882 | 3300009826 | Termite Gut | LWYCTLGGVFRFTVFADRVVVRAAMTAASALLNSALLSSAALNGARR* |
Ga0126373_119571113 | 3300010048 | Tropical Forest Soil | VFRFAVFVACALARAVMTAASALLPPAGLPAFGGARR* |
Ga0123356_104406082 | 3300010049 | Termite Gut | LWCCTLGGVFRFSVFADRVVVRAAMTAASALLNSAPLSSAALNGARR* |
Ga0131853_113088632 | 3300010162 | Termite Gut | VFRFSVFADRAVVRAAMTAASALLNSALLSSASLLAADGTRR* |
Ga0074044_106375302 | 3300010343 | Bog Forest Soil | GVFRFAVLAACALDRAAMTAASALLPTGLLALDGARR* |
Ga0126372_104356132 | 3300010360 | Tropical Forest Soil | VFRFTVFAGRAGDRAAMTAASALLSPAGLLALGGARR* |
Ga0126379_104324742 | 3300010366 | Tropical Forest Soil | VFRFAVFVASALDRAAMTAASAPLSSAGLLALDGARR* |
Ga0136643_108844511 | 3300010369 | Termite Gut | VFRFSVFADRVVVRAAMTAASALLNSALLSALLSSAALNGARR* |
Ga0134128_103116641 | 3300010373 | Terrestrial Soil | VFRFSVFADRVLDRAAMTAASALLSSALLSSAGLSAPDGARR* |
Ga0136449_1003639422 | 3300010379 | Peatlands Soil | VFRFAVFTACALDRAAVTAASALLSPAGLLALGGARR* |
Ga0136806_14130162 | 3300010386 | Sediment | MFRFAVFVARALGRAAVTAASALLSPAGVPAIGGARR* |
Ga0134126_100101188 | 3300010396 | Terrestrial Soil | VFRFSVFADRVLDRAAMTAAPALVSSALLSSALLSSAGLSAPDGARR* |
Ga0126344_10128172 | 3300010866 | Boreal Forest Soil | VFRFAVFVAYACDRAAMTAASELLSSAGPLALDGTRR* |
Ga0126361_101032532 | 3300010876 | Boreal Forest Soil | VFRFAVFVARALDRAAMTAASALLSSVGLLALDGARR* |
Ga0153922_10135146 | 3300012181 | Attine Ant Fungus Gardens | VFRFADFVACALDRAAMTAAPALLSSAALLALDGARR* |
Ga0137388_120183222 | 3300012189 | Vadose Zone Soil | VFRFAVLVACACGRAAMTAASALLSSVGLLALDGA |
Ga0137385_114541171 | 3300012359 | Vadose Zone Soil | VFRFAVFVARALDRALDRAAMTAASALLSSALLSSAGLLALDGVRR* |
Ga0181531_109645101 | 3300014169 | Bog | VGVFRFGVFVARALGRAAMTAASVLLSSALSSAGLLALDGVRR* |
Ga0182033_108552551 | 3300016319 | Soil | VFRFAAFVDCALLRAAMTAASALLSPTGLLALDGARR |
Ga0182033_118231002 | 3300016319 | Soil | CRTLAGVFRFAVFVACALARAAMTAASALLSPAGLPAFGGARR |
Ga0187812_11098652 | 3300017821 | Freshwater Sediment | VFRFAVFMTCALGRAAMTAASALLSPAGLLARGGARG |
Ga0187802_103755902 | 3300017822 | Freshwater Sediment | VFRFAVLDARALDRAAMTAAPAPLSAGLTAFDGARR |
Ga0187820_10910132 | 3300017924 | Freshwater Sediment | VFRFAVFVTRALGRAVLTAASALRPLSGLRALGGARG |
Ga0187807_10551721 | 3300017926 | Freshwater Sediment | VFRFAVLAACAVDRAAMTAASALLSPALVWPTLVSPTLVS |
Ga0187807_11055721 | 3300017926 | Freshwater Sediment | VFRFAVFVASALARAAMTAASAPLSPAPLSPAPLS |
Ga0187807_12281962 | 3300017926 | Freshwater Sediment | VFRFAVLDARALDRAAMTAAPALLSAGLTAFDGARR |
Ga0187808_104369642 | 3300017942 | Freshwater Sediment | MFRFAVVAARALDRAGMTAASALLSSAGLLAPGGARG |
Ga0187819_106321572 | 3300017943 | Freshwater Sediment | VFRFAVFVACAFDRAAMTAASALLSPAGVAARGGARR |
Ga0187778_103934552 | 3300017961 | Tropical Peatland | VFRFAVLVARAFGRAAMTAASALLSPAGLPARGGARR |
Ga0187783_100040722 | 3300017970 | Tropical Peatland | VFRFAVLVDRALDRAAMTAALALLSPAGLLALGGARR |
Ga0187783_106444771 | 3300017970 | Tropical Peatland | VFRFAVFVTCARDRAAMTAASALLSPAGLLARGGARG |
Ga0187816_103731401 | 3300017995 | Freshwater Sediment | MFRFAVVAACALDRAGMTAASALLSSAGLLAPGGARG |
Ga0187784_104929702 | 3300018062 | Tropical Peatland | VFRFAVLVARAIDRAAMTAASALRSPAGLLALGGARR |
Ga0193729_11361981 | 3300019887 | Soil | VFRFAVFVARALDRAAMTAASALLSSAPLSSAGLLALDGTRL |
Ga0179590_11351441 | 3300020140 | Vadose Zone Soil | LVSVFRFAVFVARALDRAAMTAASALLSSAPLSSAGLLALDGTRR |
Ga0210407_102424862 | 3300020579 | Soil | VFRFAVFVACAFDRAAMTAASALLSSAGLLALDGARR |
Ga0210395_100056321 | 3300020582 | Soil | VFRFAVLDARALDRAAMTAASALLSAGLTAFDGARR |
Ga0210395_100061744 | 3300020582 | Soil | VFRFAVFPACALDRAAMTAASALLSPAGLLARDGARG |
Ga0210395_100115483 | 3300020582 | Soil | VFRFAVFVACAFDRAAMTAASALLSSAARPALDGARR |
Ga0210395_100536733 | 3300020582 | Soil | VFRFAVFAAHAFDRAAMTAACALLSSAGLLALDGARR |
Ga0210401_100197235 | 3300020583 | Soil | VFRFAVFVACAFDRAAMAAASALLSSAGLLALDGARR |
Ga0154015_10729211 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRFSVFADRVLDRAAMTAASALLSSALLSPAGLSS |
Ga0210405_111084162 | 3300021171 | Soil | VFRFAVFVTCALDRAAMTAASALLSPAALLALGGARR |
Ga0210388_112392961 | 3300021181 | Soil | MPHAFGVFRFAVFALALGRAAMTAASALLSSALLALDGVRR |
Ga0210388_117183811 | 3300021181 | Soil | VFRFGVFVARALGRAAMTAASVLLSSALSSSTGLLALDGARR |
Ga0210393_106496492 | 3300021401 | Soil | MPHAFGMFRFAVFALALGRAAMTAASALLSSALPSSAGLLVLDGVRR |
Ga0210385_100953432 | 3300021402 | Soil | VFRFAVLVARAFDRAAMTAASAPLSSAGLPTFDGARA |
Ga0210383_103855631 | 3300021407 | Soil | VFRFAVFVACAFDHAAMTAASALLSSAGLVALDGARR |
Ga0210383_104399681 | 3300021407 | Soil | MPHAFGVFRFAVFALALGRASMTAASALLSSALLSSALLSSVGLLALDGVRR |
Ga0210383_106741891 | 3300021407 | Soil | VFRFAVFVACAFDRAAMAAASALLSSTGLLALDGARR |
Ga0210383_114496352 | 3300021407 | Soil | CCVFRLAVFVARACDRAAMTAASPLLSSAGPLALGGARR |
Ga0210390_100969213 | 3300021474 | Soil | VFRFAVFAAHAFDRAVMTAACALLSSAGLLALDGARR |
Ga0210390_103858282 | 3300021474 | Soil | MPHACCVFRLAVFVARACDRAAMTAASPLLSSAGPLALGGARR |
Ga0210392_101764912 | 3300021475 | Soil | VFRFAVLVARALGRAAMTAASALLSSALLSSAGLLALDGARR |
Ga0187846_100707382 | 3300021476 | Biofilm | VFRFGVFNARALDRAAMTAASAPLSSSAGLLALDGARR |
Ga0210398_101682102 | 3300021477 | Soil | VFRFAVFVACAFDHAAMTAASALLSSAGLLALDGARR |
Ga0210410_111485991 | 3300021479 | Soil | MPHACCVFRLAVFVARACDRAAMTAASAPLSSGLPALDGARR |
Ga0126371_101276592 | 3300021560 | Tropical Forest Soil | VFRFAVFAACAFDRAAMTAASALLPSAGLLAFGGARR |
Ga0126371_104588793 | 3300021560 | Tropical Forest Soil | VFRFAVFVACALARAVMTAASALLPPAGLPAFGGARR |
Ga0224712_101478311 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | DRAAMTAASALLSSALLSSALLSSAGLSARDGARR |
Ga0208589_11156532 | 3300025634 | Arctic Peat Soil | MFRFAFFVACALGRAAMTAVSALLSSAALLALDGARR |
Ga0207665_111268092 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRFSVFADRVLDRAAMTAASALLSSALLSSAGLLALDGVRL |
Ga0257150_10466482 | 3300026356 | Soil | VFRFAVFVASAFDRAAMTAASALLSSAALLALDGARR |
Ga0207947_10046403 | 3300027171 | Forest Soil | VFRFGVFVARALGRAAMTAASVLLSSALSSPAGLLAL |
Ga0208241_10392431 | 3300027297 | Forest Soil | MPHAFGVFRFAVFVALALGRAAMTAASALLSSALLSSSALLADDGARR |
Ga0209330_10076674 | 3300027619 | Forest Soil | MPHAFGVFRFAVFALALGRAAMTAASALLSSALLSSVGQLALDGVRR |
Ga0209248_100299922 | 3300027729 | Bog Forest Soil | VFRFAVFVACAFDRTAMAAASALLSSAGLLALDGARR |
Ga0209656_100322282 | 3300027812 | Bog Forest Soil | VFRFAVFVACALTRAAVTAASVLLSPAGLLALAGARG |
Ga0209274_100261674 | 3300027853 | Soil | VFRFAVLAACALDRAAMTVASALLPAGLLALDGARR |
Ga0209693_103262452 | 3300027855 | Soil | TLVDVFRFGVFVARALGRAAMAAASVLLSSALSSSTGLLALDGARR |
Ga0209166_100910382 | 3300027857 | Surface Soil | VFRFAVITARALDRAAMTAAPAPLSPAGLPASRGARR |
Ga0209167_100635083 | 3300027867 | Surface Soil | VFRFAVFVARALDRAAMTAASVLLSSAGLLAVGGARG |
Ga0209579_100782711 | 3300027869 | Surface Soil | VFRFAVFVARALDRAAMTAASVLLSSAGLLAVGGAR |
Ga0209380_100379694 | 3300027889 | Soil | VFRFAVFVACARGRAAMTAALALLSPAGLLAFGGARR |
Ga0209624_102410531 | 3300027895 | Forest Soil | VFRFAVFVAYACDRAAMTAASALLSSAGPLALDGTRR |
Ga0209415_104027671 | 3300027905 | Peatlands Soil | VFRFAVFVTCALDRAGMTAASALLSPAALLALGGARR |
Ga0209006_100140682 | 3300027908 | Forest Soil | VFRFAVFVAYACDRAAMTAASALLSSAGPLALDGARR |
Ga0311371_106072731 | 3300029951 | Palsa | VFRFAVFVARALDRAAMTAASVLLSSALLSSAGLLALDGV |
Ga0311371_118719731 | 3300029951 | Palsa | MPHAFSVFRFAVFVARALDRAAMTAASALLSSALLSSMGLLALDGVRR |
Ga0311372_127394932 | 3300030520 | Palsa | VFRFAVFVARALDRAAMTAASALLSSALLSSMGLLAL |
Ga0170834_1078890062 | 3300031057 | Forest Soil | VFRFAVFVARVLDRAAMTAAYALLSSAGLLALDGVRR |
Ga0302324_1005086982 | 3300031236 | Palsa | VFRFAVFVARALDRAAMTAASALLSSALLSSMGLLALDGVRR |
Ga0318534_101220103 | 3300031544 | Soil | VFRFAVFICCALARAVMRAASALLSPTGLLALDGARR |
Ga0318541_106884612 | 3300031545 | Soil | VFRFAVFVACALARAAMTAASALLSPAGLPAFGGARR |
Ga0318541_108006221 | 3300031545 | Soil | VFRFAAFVDCALLRAAMTAASALLSPTDLPALDGARR |
Ga0318574_102356893 | 3300031680 | Soil | VFRFAVFVDRAFPRAAMTAASALLSPTGLLALDGARR |
Ga0310686_1015797324 | 3300031708 | Soil | VFRFGFFIACALGRAAMTAASVLLSSALSSSAGLLALDGVRR |
Ga0310686_1021274063 | 3300031708 | Soil | VFRFAVFVACALDRAAMTAASALLSSAGLPARDGARR |
Ga0310686_1050426892 | 3300031708 | Soil | VFRFAVFVVHAFDRAAMTAACALLSSAGRLALDGVRR |
Ga0310686_1121098472 | 3300031708 | Soil | VFRFAVLVARAFDRAVLTAASVLLSSAGVAARDGARR |
Ga0310686_1131970092 | 3300031708 | Soil | MFRFAVSLACALGRAALTAASAPLSPAGLPVLDGARR |
Ga0318496_100410844 | 3300031713 | Soil | VFRFAVFVARASDRAVLTAASALLSSAGPLALGGSRR |
Ga0306917_112379382 | 3300031719 | Soil | VFRFAVFVACALARAAMTAASALLSPAGLPARGGARR |
Ga0306918_105327382 | 3300031744 | Soil | VFRFAVFVARASDRAVLTAASALLSSAGLLALGGSRR |
Ga0307475_109589491 | 3300031754 | Hardwood Forest Soil | VFRFAVFVALALGRAAMTAASALLSSALLPSAGLLALDGVRR |
Ga0318535_100680442 | 3300031764 | Soil | VFRFAVFVARALGRAAMAAASALPSPAGLLALDGARR |
Ga0318554_102128281 | 3300031765 | Soil | TLAGVFRFAVFICCALARAVMRAASALLSPTGLLALDGARR |
Ga0318509_102231121 | 3300031768 | Soil | GVFRFAVFVARASDRAALTAASALLSPAGPLALGGSRR |
Ga0318529_104884392 | 3300031792 | Soil | VFRFAVFADRALPRAAMTAASALLSPMGLLALDGARR |
Ga0307478_102932791 | 3300031823 | Hardwood Forest Soil | MPHACCVFRLAVFVARACDRAAMTAASALLSSAGPLALDGARR |
Ga0307478_103598183 | 3300031823 | Hardwood Forest Soil | VFRFAVFAAHALSRAAMTVASDLPSSAGLLALDGVRR |
Ga0307478_108055092 | 3300031823 | Hardwood Forest Soil | RLAVFIACACDRAAMTAASALLSSAGPLALDGARR |
Ga0318564_104425491 | 3300031831 | Soil | VFRFAVFVDRALARAAMTAASALLSPTGLLALDGARR |
Ga0318512_103283321 | 3300031846 | Soil | GGRCRTLAGVFRFAVFVARASDRAVLTAASALLSSAGPLALGGSRR |
Ga0318527_101659362 | 3300031859 | Soil | VFRFAVFLARALDRAAMTAASALLSPAGLLAPGGARG |
Ga0306923_115986271 | 3300031910 | Soil | VFRFAVFAGCALARAAMTAASALLSPAGLPAFGGARR |
Ga0310913_105299952 | 3300031945 | Soil | VFRFAVFVACALGRAAMTAASALLSSAGLPALDGARR |
Ga0318563_102716771 | 3300032009 | Soil | FRFAVFICCALARAVMRAASALLSPTGLLAPDGARR |
Ga0318506_101408711 | 3300032052 | Soil | VFRFAVFVARASDRAALTAASALLSPAGPLALGGSRR |
Ga0318506_105687761 | 3300032052 | Soil | LAGVFRFAVFAGCALSRAAMTAASALLSPTGLLALYGARR |
Ga0318513_104187742 | 3300032065 | Soil | LAGVFRFAVFVDCALLRAAMTAASALLSPTGLLALDGARR |
Ga0348332_111328032 | 3300032515 | Plant Litter | VFRFGVFVARALGRAAMTAASALLSSELLSSAGLLAPGGVRR |
Ga0335085_106433092 | 3300032770 | Soil | VFRFAVLVARALDRAAMTAASVLLSSALLSPAALLALDGARR |
Ga0335074_108765462 | 3300032895 | Soil | VFRFAVLDASALDRAAMTAASALLSAGLPTLGGARR |
Ga0335075_1001736912 | 3300032896 | Soil | VFRFAVLVACALVRAAMTAAFALLSSAGLLPVDGARG |
Ga0335075_100734473 | 3300032896 | Soil | MLAGVFWFADFVAYALDRAAMTAASALLSPAALLALGGARR |
Ga0335075_105876632 | 3300032896 | Soil | VFRFAVLVAYALERAAMTAASALLWSVGVAALDGARR |
Ga0316214_10218041 | 3300033545 | Roots | VFRFGVFVARALGRAAMTAASALLSSAGLLALDGARR |
Ga0316212_10049332 | 3300033547 | Roots | VFRFGVFVARALGRAAMTAASALLSSALSSSAGLLALDGARR |
⦗Top⦘ |