Basic Information | |
---|---|
Family ID | F048009 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 44 residues |
Representative Sequence | ELEVAAEMIGEAGDAVEMILTQGIDAAMNKYNRRKPADPEEPEEK |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.70 % |
% of genes near scaffold ends (potentially truncated) | 94.63 % |
% of genes from short scaffolds (< 2000 bps) | 90.60 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.329 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.832 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.201 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.020 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF01250 | Ribosomal_S6 | 82.55 |
PF01084 | Ribosomal_S18 | 8.05 |
PF03948 | Ribosomal_L9_C | 2.68 |
PF01281 | Ribosomal_L9_N | 2.68 |
PF03796 | DnaB_C | 0.67 |
PF01195 | Pept_tRNA_hydro | 0.67 |
PF03551 | PadR | 0.67 |
PF01168 | Ala_racemase_N | 0.67 |
PF00772 | DnaB | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG0360 | Ribosomal protein S6 | Translation, ribosomal structure and biogenesis [J] | 82.55 |
COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 8.05 |
COG0359 | Ribosomal protein L9 | Translation, ribosomal structure and biogenesis [J] | 5.37 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.34 |
COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.67 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.67 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.67 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.33 % |
Unclassified | root | N/A | 0.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001154|JGI12636J13339_1032926 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300001356|JGI12269J14319_10348250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101350097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
3300002562|JGI25382J37095_10239087 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300003351|JGI26346J50198_1006809 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300004091|Ga0062387_100457850 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300004091|Ga0062387_100488533 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300004092|Ga0062389_103320552 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300004114|Ga0062593_103247289 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300004152|Ga0062386_100718880 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005363|Ga0008090_14236855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 688 | Open in IMG/M |
3300005434|Ga0070709_11020867 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300005436|Ga0070713_100583107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1061 | Open in IMG/M |
3300005436|Ga0070713_100586890 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300005444|Ga0070694_100086119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2195 | Open in IMG/M |
3300005542|Ga0070732_10664436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 634 | Open in IMG/M |
3300005555|Ga0066692_10855247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 558 | Open in IMG/M |
3300005561|Ga0066699_10729943 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005576|Ga0066708_10127707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1540 | Open in IMG/M |
3300005576|Ga0066708_10924506 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005591|Ga0070761_10210230 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300005602|Ga0070762_10038173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2604 | Open in IMG/M |
3300005610|Ga0070763_10216429 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300005610|Ga0070763_10740249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 578 | Open in IMG/M |
3300005719|Ga0068861_101372798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
3300005921|Ga0070766_10339511 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300006046|Ga0066652_100024384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4225 | Open in IMG/M |
3300006175|Ga0070712_100247745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1422 | Open in IMG/M |
3300006797|Ga0066659_10932292 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300006800|Ga0066660_10843523 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300006893|Ga0073928_10000496 | All Organisms → cellular organisms → Bacteria | 92532 | Open in IMG/M |
3300006954|Ga0079219_10385124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300006954|Ga0079219_10532777 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300009088|Ga0099830_10524757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300009143|Ga0099792_10096668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1543 | Open in IMG/M |
3300009792|Ga0126374_11836005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300010048|Ga0126373_12174749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300010048|Ga0126373_12313905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300010084|Ga0127461_1036742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300010093|Ga0127490_1083686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300010322|Ga0134084_10043979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
3300010358|Ga0126370_10293974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
3300010359|Ga0126376_13064952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300010361|Ga0126378_13052582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300010371|Ga0134125_11414802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300011270|Ga0137391_10544223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300011270|Ga0137391_11479615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300011271|Ga0137393_10509191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
3300011271|Ga0137393_11418863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300012189|Ga0137388_10021940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4822 | Open in IMG/M |
3300012189|Ga0137388_11056765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300012189|Ga0137388_11949687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300012202|Ga0137363_11538066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300012205|Ga0137362_10306295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1375 | Open in IMG/M |
3300012205|Ga0137362_11458465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300012206|Ga0137380_10039870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4329 | Open in IMG/M |
3300012210|Ga0137378_11169438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300012211|Ga0137377_11494758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300012224|Ga0134028_1075382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1760 | Open in IMG/M |
3300012361|Ga0137360_10945205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300012363|Ga0137390_10403627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
3300012363|Ga0137390_11580970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300012582|Ga0137358_10748959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300012683|Ga0137398_10588094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300012922|Ga0137394_10814361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300012923|Ga0137359_10267799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
3300012923|Ga0137359_10619071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300012923|Ga0137359_10624357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300012924|Ga0137413_11454834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300012927|Ga0137416_10525143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
3300012929|Ga0137404_10445538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
3300012944|Ga0137410_10861582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300012971|Ga0126369_13167850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300015053|Ga0137405_1086033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1920 | Open in IMG/M |
3300015053|Ga0137405_1268408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300015264|Ga0137403_10106270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2811 | Open in IMG/M |
3300017657|Ga0134074_1324585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300017933|Ga0187801_10100318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
3300017934|Ga0187803_10190040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300017937|Ga0187809_10266812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
3300017943|Ga0187819_10100387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1729 | Open in IMG/M |
3300017970|Ga0187783_10765447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300018019|Ga0187874_10305829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300018431|Ga0066655_10206409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
3300018433|Ga0066667_10161319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
3300018433|Ga0066667_11048002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300019789|Ga0137408_1411063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2181 | Open in IMG/M |
3300019877|Ga0193722_1134122 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300020579|Ga0210407_10801261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300020579|Ga0210407_10969836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300020582|Ga0210395_11243737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300021046|Ga0215015_11003019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300021171|Ga0210405_11273388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300021178|Ga0210408_10206923 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
3300021178|Ga0210408_10462507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
3300021401|Ga0210393_11065886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300021401|Ga0210393_11627442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300021433|Ga0210391_11220743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300021439|Ga0213879_10253039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300021478|Ga0210402_10070338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3095 | Open in IMG/M |
3300021478|Ga0210402_10559668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300021479|Ga0210410_11222101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300021559|Ga0210409_11028586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300022507|Ga0222729_1047199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300025928|Ga0207700_10448408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300025986|Ga0207658_10896265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300026307|Ga0209469_1051011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
3300026322|Ga0209687_1006541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3909 | Open in IMG/M |
3300026376|Ga0257167_1059720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300026377|Ga0257171_1002022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2902 | Open in IMG/M |
3300026467|Ga0257154_1058697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300026532|Ga0209160_1103833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
3300026542|Ga0209805_1400091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300026551|Ga0209648_10525266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300027565|Ga0209219_1061073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300027643|Ga0209076_1207267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300027655|Ga0209388_1142308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300027701|Ga0209447_10191575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300027727|Ga0209328_10257428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300027846|Ga0209180_10726101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300027853|Ga0209274_10173524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
3300027855|Ga0209693_10141574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1189 | Open in IMG/M |
3300027857|Ga0209166_10418703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300027862|Ga0209701_10282427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300027884|Ga0209275_10031185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2463 | Open in IMG/M |
3300027884|Ga0209275_10647158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300027908|Ga0209006_10572879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300028536|Ga0137415_10981892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300028906|Ga0308309_10491250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
3300030730|Ga0307482_1073562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
3300030862|Ga0265753_1094047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300031231|Ga0170824_110927550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300031712|Ga0265342_10554944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300031720|Ga0307469_10673940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300031720|Ga0307469_12485321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300031740|Ga0307468_101400612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300031753|Ga0307477_10130400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
3300031754|Ga0307475_11154580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300031763|Ga0318537_10116933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 990 | Open in IMG/M |
3300031820|Ga0307473_10772621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300031962|Ga0307479_10532121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
3300031962|Ga0307479_10704442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300032065|Ga0318513_10408737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300032180|Ga0307471_100961080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
3300032180|Ga0307471_103943368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300032261|Ga0306920_104013636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300032515|Ga0348332_13495110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300033547|Ga0316212_1001087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.70% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.01% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.34% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.34% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.67% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12636J13339_10329262 | 3300001154 | Forest Soil | IGEAGDAVEMILTQGIDAAMTKYNRRKQTDPEDSEEPEKK* |
JGI12269J14319_103482502 | 3300001356 | Peatlands Soil | EMIGKAGDAVEMILAKEIEPAMNIFNRRKPAEAEEPETE* |
JGIcombinedJ26739_1013500971 | 3300002245 | Forest Soil | KPELEVASEMLGQVCYAVELILTQGLDAAMTKYNRRRPPETEAEP* |
JGI25382J37095_102390872 | 3300002562 | Grasslands Soil | KAELEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPAESEEAEEE* |
JGI26346J50198_10068091 | 3300003351 | Bog Forest Soil | AAEMIGKAGDAVEMILAKGIEPAMNIFNRRKPEAEEPENE* |
Ga0062387_1004578502 | 3300004091 | Bog Forest Soil | ELEIASEMIAEAADAVEMILQQGFAAAMNKYNRRKQADEGPETPDEK* |
Ga0062387_1004885332 | 3300004091 | Bog Forest Soil | MKKAELEVASEMVAEAADAVAMILQQGFAAAMNKYNRRKPADEGPETPDE* |
Ga0062389_1033205522 | 3300004092 | Bog Forest Soil | KKAELEIAAEMLGDAGDAVELILTKGIEAAMNRYNRRKPAESEEPEK* |
Ga0062593_1032472891 | 3300004114 | Soil | GEMVGEAGDAVEMILANGIDAAMNKFNRRKLPEAEEPEKE* |
Ga0062386_1007188802 | 3300004152 | Bog Forest Soil | VAAEMIGQAGDAVEMILREGIDAAMNRYNRKSPAAGDAEETK* |
Ga0008090_142368552 | 3300005363 | Tropical Rainforest Soil | RPMKKADLQAAAEMVGEAGDAVEMILTQGLDAAMTKYNRRRPAEPE* |
Ga0070709_110208671 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAEMLDEAGNAVEAILTEGIDAAMTKFNRRKPSEDEAPGL* |
Ga0070713_1005831073 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AELEAAAEMLDEAGDAVETILKEGIDAAMTKFNRRKQAEGEET* |
Ga0070713_1005868903 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ELEIAAEMLDEAGNAVEAILTEGIDAAMTKFNRRKPSEDEAPGL* |
Ga0070694_1000861195 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVATEMLAEAGDAVELILTQGLDAAMTKYNRRKLTEDAAE* |
Ga0070732_106644362 | 3300005542 | Surface Soil | NSRREHVLRPVRKPELELAAEMIDEAGNAVEVILKEGLDAAMNKFNRRKPTEGEAET* |
Ga0066692_108552471 | 3300005555 | Soil | RPMKKPELEVAAEMVGEAGNAVEMILAQGLDAAMTKYNRRKPAEPDDPV* |
Ga0066699_107299432 | 3300005561 | Soil | EAGDAVEMILTQGLDAAMTKYNRRKPADVEEPEEK* |
Ga0066708_101277071 | 3300005576 | Soil | LRPMKKAELEVAAEMIGEAGDAVEMILTQGLDATMTKYNRRKPADVEEPEEK* |
Ga0066708_109245062 | 3300005576 | Soil | NAELEVAAEMLGEAGDAVEMILTQGLDAAMTKYNRRKLTEDEAE* |
Ga0070761_102102301 | 3300005591 | Soil | EAAEMIGKAGDAVEMILAKGIESAMNIFNRRKPPDPEADGPEGL* |
Ga0070762_100381735 | 3300005602 | Soil | PMKKAELEEAAEMIGKAGDAVEMMLAKGIEPAMNIFNRRKLPEAEEPEEE* |
Ga0070763_102164291 | 3300005610 | Soil | EMLGQVGDAVELILTQGLDAAMTKYNRRKPQEPEEEK* |
Ga0070763_107402491 | 3300005610 | Soil | MRKAELEVAAEMIAEAADAAEMIVAQGIDAAMNRYNRRKEPPVDETET* |
Ga0068861_1013727981 | 3300005719 | Switchgrass Rhizosphere | LRPMKKAELEVATEMLAEAGDAVELILTQGLDAAMTKYNRRKLTEDAAE* |
Ga0070766_103395113 | 3300005921 | Soil | AAEMVGKAGDAVEMILEKGIEPAMNIFNRRKPEAEESGEE* |
Ga0066652_1000243846 | 3300006046 | Soil | AVEMILTQGLHAAMTKYNRRRLAEPEQPEQPEQK* |
Ga0070712_1002477451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NAAEMLEQAGDAVELILTQGLDAAMNKYNRRKPSDPDATP* |
Ga0066659_109322921 | 3300006797 | Soil | SGEAGDAVEMILTQGLDAAMTKYNRRKPEDPEEAEEK* |
Ga0066660_108435231 | 3300006800 | Soil | AELEVAAEMIGEAGDAVEMILTQGLDAAMTKYNRRKPADVEEPEEK* |
Ga0073928_1000049698 | 3300006893 | Iron-Sulfur Acid Spring | MRKGELEVASEMIAEAADAVEVMVAKGIDAAMNKYNRRKEPPADEASE* |
Ga0079219_103851242 | 3300006954 | Agricultural Soil | KEHVLRRMKKAELEAAAEMVGEAGDAVEIILTQSLDAAMTKFNRRKPAEPEDET* |
Ga0079219_105327771 | 3300006954 | Agricultural Soil | EAAAEMVGEAGDAVEMILTQGLDAAMTKYNRRKPTEPEEAV* |
Ga0099830_105247574 | 3300009088 | Vadose Zone Soil | GQAGDAVEMILAQGIDAAMNKYNRRKPAEPEEPEEPEKE* |
Ga0099792_100966681 | 3300009143 | Vadose Zone Soil | MIGEAGDAVEMILSQGLDAAMTKYNRRKPSEPEEPEEK* |
Ga0126374_118360052 | 3300009792 | Tropical Forest Soil | RKAELEVAAEMLDEAGNAVEMILKEGIDAAMTRFNRRKPGAAAEGEAM* |
Ga0126373_121747491 | 3300010048 | Tropical Forest Soil | AELEAAAEMVAEAVDAVEMILKQGLDGAMTKYNRRKPAEPPEPET* |
Ga0126373_123139052 | 3300010048 | Tropical Forest Soil | ELEVAAEMLGEAGDAVEMILTQGLDAAMTKYNRRKPPEPEDPEEPVKK* |
Ga0127461_10367421 | 3300010084 | Grasslands Soil | ELEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPAESEEAEEE* |
Ga0127490_10836862 | 3300010093 | Grasslands Soil | EVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPAESEEAEEE* |
Ga0134084_100439793 | 3300010322 | Grasslands Soil | IGEAGDAVDMILTQGLDAAMTKYNRRKPADVEEPEEK* |
Ga0126370_102939743 | 3300010358 | Tropical Forest Soil | EVAAEMVGEAGDAVEMILAQGLDAAMTKYNRRKLAGPEEPV* |
Ga0126376_130649522 | 3300010359 | Tropical Forest Soil | MRKAELEVAAEMIADAGDAVELLLSKGIQAAMNRYNRRELVDGEGLPGE* |
Ga0126378_130525822 | 3300010361 | Tropical Forest Soil | KKAELQAASEMIADAGDAVEMILSQGLDAAMTKYNRRKPPQEEEPEEPKKK* |
Ga0134125_114148022 | 3300010371 | Terrestrial Soil | EMLAEAGDAVELILTQGLDAAMTKYNRRKLTEDAAE* |
Ga0137391_105442233 | 3300011270 | Vadose Zone Soil | RKVELEAAAEMIDEAGNAVETILQEGIDAAMNKFNRRKPIEGEANL* |
Ga0137391_114796152 | 3300011270 | Vadose Zone Soil | GEAGDAVEIILSQGLDAAMTKYNRRKPEEPEEPV* |
Ga0137393_105091911 | 3300011271 | Vadose Zone Soil | AELEVAAEMIGEAGDAVEMILAQGIDAAMNKYNRRKPADPEEPEEK* |
Ga0137393_114188631 | 3300011271 | Vadose Zone Soil | GEAGDAVEMILSQGLDAAMTKYNRRKPEEPEEPV* |
Ga0137388_100219401 | 3300012189 | Vadose Zone Soil | LEVAAEMIGEAGDAVEMSLSQGLDAAMTKYNRRKPAEPEEPEEPEEE* |
Ga0137388_110567652 | 3300012189 | Vadose Zone Soil | EVAAEMIGEAGDAVEMILTQGIDAAMTKYNRRKPADPEELEEK* |
Ga0137388_119496871 | 3300012189 | Vadose Zone Soil | MRKAELEVAAEMIDEAGNAVVKILQEGLDAAMNKFNRSKPTEGEADV* |
Ga0137363_115380662 | 3300012202 | Vadose Zone Soil | RPMRKAQLKIASEMIDEAGNAVETILQEGIDAAMNKFNRRKPTEGETDL* |
Ga0137362_103062953 | 3300012205 | Vadose Zone Soil | REYVLRRMKKTELEIAAEMLDEAGNAVETVLKEGIDAAMTRFNRRKPVDGEPVG* |
Ga0137362_114584651 | 3300012205 | Vadose Zone Soil | AGDAVEMILSQGLDAAMTKYNRRKPAEPEEPEEPEEK* |
Ga0137380_100398701 | 3300012206 | Vadose Zone Soil | ELEAAAEMISEAGDAVEMILTQGIDAAMTKYNRRKPADAEEPEEK* |
Ga0137378_111694382 | 3300012210 | Vadose Zone Soil | PMKKAELEAAAEMISEAGDAVEMILTQGIDAAMTKYNRRKLTEPEEPDEPGQR* |
Ga0137377_114947581 | 3300012211 | Vadose Zone Soil | EMIGEAGDAVEMILSQGIDAAMTKYNRRKPADPEEPEEK* |
Ga0134028_10753821 | 3300012224 | Grasslands Soil | MNKAELEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPAESEEAEEE* |
Ga0137360_109452051 | 3300012361 | Vadose Zone Soil | DAVEMILSQGFDAAMTKYNRRKPSEPEEPEEPEEK* |
Ga0137390_104036274 | 3300012363 | Vadose Zone Soil | AEMIGEAGDAVEMILTQGIDAAMTKYNRRKPADPEEQEEK* |
Ga0137390_115809701 | 3300012363 | Vadose Zone Soil | IAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPAEPEEPEEK* |
Ga0137358_107489591 | 3300012582 | Vadose Zone Soil | AGDAVEMILTQGIDAAMNKYNRRKPADPEEPEEK* |
Ga0137398_105880942 | 3300012683 | Vadose Zone Soil | RPMKKAELEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPADAEEQLEK* |
Ga0137394_108143613 | 3300012922 | Vadose Zone Soil | AELEIAAEMIGEAGDAVEMILKQGIDAAMNQYNRRKVAESEEPEEK* |
Ga0137359_102677991 | 3300012923 | Vadose Zone Soil | KKAELEVAAEMLDEAGNAVEMILKEGLDAAMTKYNRRKPSEAEGESL* |
Ga0137359_106190711 | 3300012923 | Vadose Zone Soil | EMIDEAGNAVETILQEGIDAAMNKFNRRKPTEGETDL* |
Ga0137359_106243572 | 3300012923 | Vadose Zone Soil | MKKADLEVAAEMLDEAGNAVEMILKEGIDAAMTKFNRRKQADGEAEAET* |
Ga0137413_114548341 | 3300012924 | Vadose Zone Soil | LEVAAEMIGEAGDAVEMILSQGLEAAMTKYNRRKPADPEEAEEK* |
Ga0137416_105251433 | 3300012927 | Vadose Zone Soil | LEVAAEMIAEAGDAVEMILSQGLDAAMTKYNRRKPEEPEEAEEK* |
Ga0137404_104455381 | 3300012929 | Vadose Zone Soil | VAAEMIGEAGDAVEMILTQGLDAAMTKYNRRKPLEPEEPEET* |
Ga0137410_108615821 | 3300012944 | Vadose Zone Soil | EMIGEAGDAVEMILTQGLDAAMTKYNRRKPLEPEEPEEK* |
Ga0126369_131678501 | 3300012971 | Tropical Forest Soil | MIGQAGDAVEMILTKGIDAAMNKYNRREPPPTDEESGTAEK* |
Ga0137405_10860331 | 3300015053 | Vadose Zone Soil | MRKAELEVAAEMIGQAGDAVELILTKGIDAAMTKYNRRESPPAAEENL* |
Ga0137405_12684081 | 3300015053 | Vadose Zone Soil | MRKAELEAASEMIGNAGDAVELILSQGIEAAMTKYNRRKPADPEEPEL* |
Ga0137403_101062707 | 3300015264 | Vadose Zone Soil | KKAELEIAAEMIGEAGDAVEMILKQGIDAAMNQYNRRKAAESEEPEEK* |
Ga0134074_13245851 | 3300017657 | Grasslands Soil | MIGEAGDAVEMILTQGLDAAMTKYNRRKPPSGEEPEDPV |
Ga0187801_101003181 | 3300017933 | Freshwater Sediment | MIGEAGDAVEMILTQGFDAAMTKYNRRKPLDPEEAEEK |
Ga0187803_101900401 | 3300017934 | Freshwater Sediment | ELEVAAEMIGEAGDAVEMILTQGIDAAMNKYNRRKPAEEAPGDAPD |
Ga0187809_102668121 | 3300017937 | Freshwater Sediment | EMLGQVGDAVELILTQGLDAAMTKYNRRKPQEPDDEK |
Ga0187819_101003871 | 3300017943 | Freshwater Sediment | VAAEMIGEAGDAVEMILTQGLDAAMTKYNRRKPEPEEPEEK |
Ga0187783_107654472 | 3300017970 | Tropical Peatland | MRKAELEVAAEMIGKAGDAVEMILEKGIEPAMNVFNRRKPPEPEADAPGK |
Ga0187874_103058291 | 3300018019 | Peatland | LEVASEMIGEAGDAVELMLAQGIDAAMTKYNRRKPLDAEE |
Ga0066655_102064093 | 3300018431 | Grasslands Soil | EAGDAVEMILTQGLDKAMTKYNRRMPDEPGESEQN |
Ga0066667_101613191 | 3300018433 | Grasslands Soil | EVAAEMIGEAGDAVEMILTQGLDAAMTKYNRRKPADVEEPEEK |
Ga0066667_110480022 | 3300018433 | Grasslands Soil | AELEVAAEMLGEAGDAVEMILTQGLDAAMTKYNRRKLTEDEAE |
Ga0137408_14110631 | 3300019789 | Vadose Zone Soil | VLRPIKKAELEIAAEMIGEAGDAVEMILRQGIDAAMNQYNRRKVAESEEPEKK |
Ga0193722_11341221 | 3300019877 | Soil | ELVAASEMIAEAADAVEMILRDGIDAAMNRYNRRKEPPGETDEPEKK |
Ga0210407_108012611 | 3300020579 | Soil | ELEVAAEMIGEAGDAVEMILTQGIDAAMNKYNRRKPADPEEPEEK |
Ga0210407_109698362 | 3300020579 | Soil | AAEMLDEAGNAVEMILQEGLDAAMTKFNRRKPAEGEAET |
Ga0210395_112437371 | 3300020582 | Soil | AAEMIGEAGDAVELILTQGLDAAMTKFNRRKQEPDGPEAET |
Ga0210401_107147613 | 3300020583 | Soil | RPMKKAELEVAAEMVATAGDAVEMILSQSIASAMNKYNRRMPPPPEEK |
Ga0215015_110030192 | 3300021046 | Soil | AELEAAAEMIGEVGDAVEMILSQGLDAAMTKYNRRKPADPEEPEEK |
Ga0210405_112733881 | 3300021171 | Soil | AEMVGKAGDAVEMILAKGIEPAMNIFNRRKPEVEEPETD |
Ga0210408_102069234 | 3300021178 | Soil | KAELEVAAEMIGEAGDAVEMILKQGIEAAMNKYNRRKPAQEEPL |
Ga0210408_104625071 | 3300021178 | Soil | AELEVAAEMIDEAGNAVEVILKEGLDAAMNKFNRRKPVEGEAET |
Ga0210393_110658862 | 3300021401 | Soil | KAELEIAAEMIDEAGNAVEVILKEGLDAAMNKFNRRKPVEGEAET |
Ga0210393_116274422 | 3300021401 | Soil | RPMKKPELEAASEMVAQAGDAVEMILQQGLAAAMNKYNRKAPPPDPAAES |
Ga0210391_112207432 | 3300021433 | Soil | AELEVASEMIGEAGDAVELILSQGIEAAMNKFNRRKPPDPEP |
Ga0213879_102530392 | 3300021439 | Bulk Soil | KAELEVASEMLEHVGDAVELILTHGLDAAMTKYNRRKPEEPEAEK |
Ga0210402_100703385 | 3300021478 | Soil | EAGDAVEMILSQGLDAAMTKYNRRKPADPEEAEEK |
Ga0210402_105596681 | 3300021478 | Soil | AELEIASEMIDEAGNAVETILQEGIDAAMNKFNRRKPTEGETDL |
Ga0210410_112221011 | 3300021479 | Soil | KAALEVAAEMVGKAGDAVEMILEKGIEPAMNIFNRRKLPEAEERQNE |
Ga0210409_110285862 | 3300021559 | Soil | AEMIGEAGDAVEMILKQGIDAAMNKYNRRKPADPEEPEEK |
Ga0222729_10471992 | 3300022507 | Soil | IGKAGDAVEMILAKGIEPAMNIFNRRKPEAEETEED |
Ga0207700_104484081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KAELEAAAEMLDEAGDAVETILKEGIDAAMTKFNRRKQAEGEET |
Ga0207658_108962653 | 3300025986 | Switchgrass Rhizosphere | KAELEVATEMLAEAGDAVELILTQGLDAAMTKYNRRKLTEDATE |
Ga0209469_10510112 | 3300026307 | Soil | MKKAELEAAAEMVGEAGDAVEMILTQGLHAAMTKYNRRRLAEPEQPEQPEQK |
Ga0209687_10065411 | 3300026322 | Soil | LRPMKKAELEAAAEMVGEAGDAVEMILTQGLDKAMTKYNRRMPDEPGESEQN |
Ga0257167_10597201 | 3300026376 | Soil | EAAAEMIGEAGDAVELILSQGIDAAMTKYNRRKPAEPEEPEEE |
Ga0257171_10020226 | 3300026377 | Soil | AELVIASEMIGEAGDAVEMILKQGIDAAMNQYNRRKAAESEEPEEK |
Ga0257154_10586972 | 3300026467 | Soil | KKAELEVAAEMVAKAGDAVEMILEKGIEPAMNIFNRRKLPEAEEPGNE |
Ga0209160_11038334 | 3300026532 | Soil | IASEMIGEAGDAVEMILSQGLDAAMTKYNRRKPSEPEEPEEK |
Ga0209805_14000911 | 3300026542 | Soil | AELETAAEMIGEAGDAVEMILTQGLDAAMTKYNRRKPPSGEEPEDPV |
Ga0209648_105252661 | 3300026551 | Grasslands Soil | KAELEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPSEPEELEEK |
Ga0209219_10610731 | 3300027565 | Forest Soil | VLRPMKKPELEEAAAMVGKAGDAAEMILAKGIEQAMNIFNRRKLPEAEEPEKE |
Ga0209076_12072672 | 3300027643 | Vadose Zone Soil | ASEMIGEAGDAVEMILKQGIDAAMNQYNRRKAAESEGPEEK |
Ga0209388_11423082 | 3300027655 | Vadose Zone Soil | AAEMIGEAGDAVEMILKQGIDAAMNQYNRRKAAESEEPEEK |
Ga0209447_101915751 | 3300027701 | Bog Forest Soil | AEMVGKAGDAVEMILAKGIEPAMNIFNRRKPPDAEEPEEE |
Ga0209328_102574282 | 3300027727 | Forest Soil | ELEVAAEMIGEAGDAVEMILTQGIDAAMNKYNRRKPADPEEPEEE |
Ga0209180_107261012 | 3300027846 | Vadose Zone Soil | KKAELEIAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPSEPEEPEEK |
Ga0209274_101735243 | 3300027853 | Soil | KAELAEAAEMIGKAGDAVEMILAKGIESAMNIFNRRKPPDPEADGPEGL |
Ga0209693_101415741 | 3300027855 | Soil | EMLGQVGDAVELILTQGLDAAMTKYNRRKPQEPEEEK |
Ga0209166_104187031 | 3300027857 | Surface Soil | MKKAELEIAAEMLDEAGNAVETILKEGIAAAMTKFNRRKPVEGEAEL |
Ga0209701_102824273 | 3300027862 | Vadose Zone Soil | AGDAVEMILAQGIDAAMNKYNRRKPAEPEEPEEPEKE |
Ga0209275_100311851 | 3300027884 | Soil | LRPMKKAELEEAAEMIGKAGDAVEMMLAKGIEPAMNIFNRRKLPEAEEPEEE |
Ga0209275_106471581 | 3300027884 | Soil | EVASEMLGQVGDAVELILTQGLDAAMTKYNRRKPLDPDVEQ |
Ga0209006_105728793 | 3300027908 | Forest Soil | KKPELEVASEMLGQVCYAVELILTQGLDAAMTKYNRRRPPETEAEP |
Ga0137415_109818922 | 3300028536 | Vadose Zone Soil | RPMKKAELEAAAKMIGEAGDAVEMILSQGIDAAMTKYNRRKPAEPEEPEEK |
Ga0308309_104912503 | 3300028906 | Soil | MKKAELEVASEMLGHVGDAVEMILTQGLDAAMTKYNRRKPPDAEAV |
Ga0307482_10735621 | 3300030730 | Hardwood Forest Soil | KKAELEVAAEMLDEAGNAVEVILKEWLDAAMTRFNRRKPAAEGEPET |
Ga0265753_10940471 | 3300030862 | Soil | AEMIGKAGDAVEMILAKGIEPAMNIFNRRKPEVEEPEEE |
Ga0170824_1109275502 | 3300031231 | Forest Soil | KKAVLEVAAEMIGEAGDAVEMILSQGLDAAMTKYNRRKPSEPEEQ |
Ga0265342_105549442 | 3300031712 | Rhizosphere | AEMIATAANAVELMLKEGIDAAMNQYNRRKPPDEPGQE |
Ga0307469_106739401 | 3300031720 | Hardwood Forest Soil | LEIAAEMLDEAGNAVETILKEGIDAAMTKFNRRKPVDGEGDL |
Ga0307469_124853212 | 3300031720 | Hardwood Forest Soil | HVLRPMRKAELEVAAEMIDEAGNAVETILREGIDAAMNKFNRRKPVEGEADL |
Ga0307468_1014006121 | 3300031740 | Hardwood Forest Soil | EMLGEAGDAVELILTQGLEAAMTKYNRRKTAESADEAE |
Ga0307477_101304001 | 3300031753 | Hardwood Forest Soil | MIDEAGNAVEVILKEGLDAAMNKFNRRKPAEGEAET |
Ga0307475_111545801 | 3300031754 | Hardwood Forest Soil | KKAELGVAAEMIGEAGDAVEMILTHGLDAAMTKYNRRKPADPEEPEEK |
Ga0318537_101169333 | 3300031763 | Soil | KKTELEAAAEMVGEAGDAVEMILMQGLHAAMTKYNRRRPDEPDQAEPK |
Ga0307473_107726212 | 3300031820 | Hardwood Forest Soil | ELAVAAEMIADAADGVEMVLGKGIDAAMNKYNRRKPSEEEAEEKK |
Ga0307479_105321211 | 3300031962 | Hardwood Forest Soil | ELEVASEMIAEAADAVEMIVAQGIEAAMTKYNRRKEPPADETEE |
Ga0307479_107044421 | 3300031962 | Hardwood Forest Soil | EAGDAVEMILSKGIDAAMNKYNRRKPSEDAGEEKQ |
Ga0318513_104087372 | 3300032065 | Soil | PMKKTELEAAAEMVGEAGDAVEMILMQGLHAAMTKYNRRRPDEPDQAEPK |
Ga0307471_1009610801 | 3300032180 | Hardwood Forest Soil | AELEVAAEMIDEAGNAVEVILKEGLDAAMNKFNRRKPAESEAET |
Ga0307471_1039433681 | 3300032180 | Hardwood Forest Soil | KKAELEIAAEMIGDAGDAVEMILKQGIDAAMNQYNRRKAAESEEPEEK |
Ga0306920_1040136361 | 3300032261 | Soil | AAEMIDQAGNAVETILKEGLDAAMTKFNRRRSAEDEATEL |
Ga0348332_134951101 | 3300032515 | Plant Litter | ELEVAAEMIGKAGDAVEMILESGIEPAMNIFNRRKLPEAEEPQNG |
Ga0316212_10010875 | 3300033547 | Roots | LRPMKKAELEVASEMVAEAGDAVEMILRQGFAAAMNKYNRKKPSEASETEEGK |
⦗Top⦘ |